Metagenome Family F058681

Overview

Basic Information

• Family ID: F058681
• Family Type: Metagenome
• Number of Sequences: 134
• Average Sequence Length: 38 residues
• Representative Sequence: VRPNVRAKLPAEAGAVSLVRDDAPCAADQAYSACRSGS
• Number of Associated Samples: 41
• Number of Associated Scaffolds: 134

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 0.00 %
• % of genes near scaffold ends (potentially truncated): 0.75 %
• % of genes from short scaffolds (< 2000 bps): 0.75 %
• Associated GOLD sequencing projects: 36
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.31

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (99.254 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (53.788 % of family members)
• Environment Ontology (ENVO): Unclassified (66.418 % of family members)
• Earth Microbiome Project Ontology (EMPO): Unclassified (53.731 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 15.15%
  β-sheet: 0.00%
  Coil/Unstructured: 84.85%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 134 Family Scaffolds
PF00583	Acetyltransf_1	3.73
PF13302	Acetyltransf_3	2.99
PF12680	SnoaL_2	2.24
PF12681	Glyoxalase_2	2.24
PF00472	RF-1	1.49
PF14319	Zn_Tnp_IS91	1.49
PF13714	PEP_mutase	1.49
PF09932	DUF2164	1.49
PF13673	Acetyltransf_10	1.49
PF14078	DUF4259	0.75
PF08378	NERD	0.75
PF13391	HNH_2	0.75
PF04945	YHS	0.75
PF14337	Abi_alpha	0.75
PF13560	HTH_31	0.75
PF04828	GFA	0.75
PF11969	DcpS_C	0.75
PF13417	GST_N_3	0.75
PF08241	Methyltransf_11	0.75
PF13531	SBP_bac_11	0.75
PF07883	Cupin_2	0.75
PF12867	DinB_2	0.75
PF11695	DUF3291	0.75
PF14080	DUF4261	0.75
PF07978	NIPSNAP	0.75
PF03544	TonB_C	0.75
PF01451	LMWPc	0.75
PF00903	Glyoxalase	0.75
PF06649	DUF1161	0.75
PF04273	BLH_phosphatase	0.75
PF05016	ParE_toxin	0.75
PF01555	N6_N4_Mtase	0.75
PF00795	CN_hydrolase	0.75
PF04471	Mrr_cat	0.75
PF06941	NT5C	0.75
PF06877	RraB	0.75
PF04365	BrnT_toxin	0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 134 Family Scaffolds
COG0216	Protein chain release factor RF1	Translation, ribosomal structure and biogenesis [J]	1.49
COG1186	Protein chain release factor PrfB	Translation, ribosomal structure and biogenesis [J]	1.49
COG0810	Periplasmic protein TonB, links inner and outer membranes	Cell wall/membrane/envelope biogenesis [M]	0.75
COG0863	DNA modification methylase	Replication, recombination and repair [L]	0.75
COG1041	tRNA G10 N-methylase Trm11	Translation, ribosomal structure and biogenesis [J]	0.75
COG2189	Adenine specific DNA methylase Mod	Replication, recombination and repair [L]	0.75
COG2929	Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system	Defense mechanisms [V]	0.75
COG3076	Regulator of RNase E activity RraB	Translation, ribosomal structure and biogenesis [J]	0.75
COG3453	Predicted phosphohydrolase, protein tyrosine phosphatase (PTP) superfamily, DUF442 family	General function prediction only [R]	0.75
COG3791	Uncharacterized conserved protein	Function unknown [S]	0.75
COG4502	5'(3')-deoxyribonucleotidase	Nucleotide transport and metabolism [F]	0.75

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.25 %
All Organisms	root	All Organisms	0.75 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.25 %
cellular organisms	root	All Organisms → cellular organisms	0.75 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.25 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.75 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.25 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.75 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300002835|B570J40625_100451110	All Organisms → cellular organisms → Bacteria → Proteobacteria	1228

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	71.97%
Engineered	Engineered	27.27%
Host-Associated	Host-Associated	0.76%

Class

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	71.97%
Wastewater	Engineered → Wastewater	27.27%
Plants	Host-Associated → Plants	0.76%

Category

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	71.97%
Nutrient Removal	Engineered → Wastewater → Nutrient Removal	26.52%
Rhizosphere	Host-Associated → Plants → Rhizosphere	0.76%
Activated Sludge	Engineered → Wastewater → Activated Sludge	0.76%

Type

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	55.30%
Unclassified	Engineered → Wastewater → Nutrient Removal → Unclassified	26.52%
Lentic	Environmental → Aquatic → Freshwater → Lentic	15.91%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	0.76%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	0.76%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	0.76%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	55.30%
Unclassified	Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified	26.52%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	12.12%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	3.79%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	0.76%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	0.76%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	0.76%

Habitat

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	53.79%
Wastewater Effluent	Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent	26.52%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	12.12%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	3.79%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	1.52%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	0.76%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.76%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	0.76%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300002835	Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)	Environmental
3300003966	Enrichment cultures from Harmful Algal Blooms in Lake Erie HABS-00-39862	Host-Associated
3300005525	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG	Environmental
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental
3300005528	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG	Environmental
3300005656	Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB19-Kit	Engineered
3300005961	Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 B green DNA	Engineered
3300005989	Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNA	Engineered
3300008108	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA	Environmental
3300008121	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-100-LTR	Environmental
3300013004	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG	Environmental
3300020522	Freshwater microbial communities from Lake Mendota, WI - 26JUN2008 deep hole epilimnion (SPAdes)	Environmental
3300027673	Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 B green DNA (SPAdes)	Engineered
3300027786	Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNA (SPAdes)	Engineered
3300027806	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes)	Environmental
3300027816	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)	Environmental
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated
3300032093	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117	Environmental
3300033978	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002	Environmental
3300033980	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007	Environmental
3300033981	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011	Environmental
3300033992	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035	Environmental
3300033994	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046	Environmental
3300033996	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004	Environmental
3300034019	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049	Environmental
3300034020	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055	Environmental
3300034061	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028	Environmental
3300034062	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045	Environmental
3300034066	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087	Environmental
3300034071	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110	Environmental
3300034092	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069	Environmental
3300034096	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098	Environmental
3300034102	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112	Environmental
3300034103	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119	Environmental
3300034104	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120	Environmental
3300034111	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186	Environmental
3300034112	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191	Environmental
3300034119	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166	Environmental
3300034120	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172	Environmental
3300034272	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156	Environmental
3300034283	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
B570J40625_1002323274	3300002835	Freshwater	MRPNVGAKLPAEADDVSLVCEGAEGAARQACDGCRSGSA*
B570J40625_1004511104	3300002835	Freshwater	CEWIARPNVRAKLPAEAGFVSPVRDDGTTGADRAYKACRRGSA*
B570J40625_1009827343	3300002835	Freshwater	MCDLGPNVRAKLPEEACSVSLVCEGAEGAAHQAYAACRSGS
B570J40625_1011697222	3300002835	Freshwater	LAQPNVRAKLPAEAGAVSLVRDDAPCAVDQAYSACRSGSA*
Ga0063591_1019052	3300003966		MVKGLHTMYLMPNVRAKLPAEAGAVSLVRDDAPCAADQAYGACRSGSA*
Ga0063591_1020821	3300003966		VNMLRRSRVRPNVRAKLPAEARSVSLVRDDASMAADQAYA
Ga0068877_101188641	3300005525	Freshwater Lake	MPNVRGNLPAEARSVSLVRDNASMAADQAYAACRSGSG
Ga0068877_101793572	3300005525	Freshwater Lake	MAGDIGSEANVRVKPPAEAGSVSLVCEGAEGAAHQAYAACRSGSA*
Ga0068877_102909411	3300005525	Freshwater Lake	VLVVRPNVRAKLPVEAGAVSLVRDDAPSAADQAYSACR
Ga0068877_103259451	3300005525	Freshwater Lake	MTTPNVRTKLPAEAGAVSLVRDDAPCAADQAYSACRSGSA
Ga0068877_104095562	3300005525	Freshwater Lake	PNVRAKLPAEAGAVSLVRDDAPCAADQAYGACRSGSA*
Ga0068877_104122032	3300005525	Freshwater Lake	RVKPPAEAGSVSLVRDDAPCAADQAYAACRSGSA*
Ga0068877_104457372	3300005525	Freshwater Lake	MMAERYIAFVRPNVRAKLPAEAGAVSLVRDDAPSAADQAYSA
Ga0068877_106279392	3300005525	Freshwater Lake	MPNVRAKLPAEAGAVSLVRDDAPSAADQAYSACRSGSA
Ga0068876_103788364	3300005527	Freshwater Lake	PNVRAKLPAEACSVSLVCEGAEGAAHQAYAACRSGSA*
Ga0068872_103080831	3300005528	Freshwater Lake	PNVRAKLPAEAGAVSLVRDDAPSAADQAYSACRSGSA*
Ga0073902_101202693	3300005656	Activated Sludge	VPPNVRAKLLAEACLVSLVRENVQGTADQAYNACRSGSA
Ga0075157_100073641	3300005961	Wastewater Effluent	RAKLPAEAGAVSLVRDDAPRAADQAYSACRSGSA*
Ga0075157_100298871	3300005961	Wastewater Effluent	RAKLPAEAGVVSLVRDDAPCAADQAYSACRSGSA*
Ga0075157_100306047	3300005961	Wastewater Effluent	MPNVRAKLPAEAGAVSLVRDDAPSAADQAYSACRSGS
Ga0075157_100618573	3300005961	Wastewater Effluent	MPNVRAKPTAEAGGVSLVRDDAPCAADQAYAACRS
Ga0075157_100637621	3300005961	Wastewater Effluent	VWIVQPNVRAKLPAEAGAVSLVRDDAPRAADQAYSACR
Ga0075157_100991201	3300005961	Wastewater Effluent	RAKLPAEAGAVSLVREDAPCAADQAYSACRSGSA*
Ga0075157_101193951	3300005961	Wastewater Effluent	VRPNVRAKLPAEAGAVSLVRDDAPCAADQAYSACRSGSA
Ga0075157_101353442	3300005961	Wastewater Effluent	VILRPNVRAKLPAEAGAVSLVRDDAPCAADQAYSACRSGS
Ga0075157_101389351	3300005961	Wastewater Effluent	PNVRAKLPAEAGAVSLVRDDASRAADQAYSACRSGSA*
Ga0075157_101449972	3300005961	Wastewater Effluent	VRPNVRAKLPAEAGAVSLVRDDAPCAADQAYSACRGGSA*
Ga0075157_101517372	3300005961	Wastewater Effluent	MLVARPNVRAKLPAEAGAVSLVRDDAPCAADQAYSAC
Ga0075157_101567751	3300005961	Wastewater Effluent	RAKLPAEASTVSPGCDDAPSAAARAYSACRSGSA*
Ga0075157_101924841	3300005961	Wastewater Effluent	MRPNVRAKLPAEAGAVSLVRDDAPSAADQAYSACRSG
Ga0075157_102153111	3300005961	Wastewater Effluent	VVVVTPNVRAKLPAEAGAVSLVRDDAPTAADQAYSACRSGSA*
Ga0075157_102191092	3300005961	Wastewater Effluent	VQPNVRAKLPAEAGAVSLVRDDAPCAADQAYSACR
Ga0075157_102273262	3300005961	Wastewater Effluent	MRLVARPNVRAKLPAEAGAVSLVRDDAPCAADQAYSACRSGSA
Ga0075157_102341781	3300005961	Wastewater Effluent	PNVRAKLPAEACVVSLVRENVQGTANQAYNACRSGSA*
Ga0075157_102477841	3300005961	Wastewater Effluent	PNVRAKPTAEAGGVSLVRDDAPCAADQAYDACRSGSA*
Ga0075157_102496751	3300005961	Wastewater Effluent	FLMPNVRAKLPAEAGAVSLVRDDAPSAADQAYSACRSGSA*
Ga0075157_102556923	3300005961	Wastewater Effluent	PNVRAKPTAEAGAVSPDRDDSTNGAVRAYSACRSGSA*
Ga0075157_102661172	3300005961	Wastewater Effluent	TPNVRAKLPAEAGAVSLVRDDAPGAADQAYSACRSGSA*
Ga0075157_102735162	3300005961	Wastewater Effluent	MWNARPNVRAKLPAEAGAVSLVRDDAPCAADQAYSACRSGSA
Ga0075157_102848791	3300005961	Wastewater Effluent	MERRREDMTIVRPNVRAKLPAEAGAVSPVRDDAPCAADRAYSACRSGSA*
Ga0075157_103069261	3300005961	Wastewater Effluent	PNVRAKLPAEAGGVRLVRDDAPSAADQPYDACRSGSA*
Ga0075157_103329301	3300005961	Wastewater Effluent	ARPNVRAKLPAEAGAVSLVRDDATCAANQAYSACRSGSA*
Ga0075157_103449581	3300005961	Wastewater Effluent	PNVRAKLPAEAGAVSPGRDDAPFAAARAYSACRSGSA*
Ga0075157_103523001	3300005961	Wastewater Effluent	LIVQPNVRAKLPAEAGAVSLVRDDAPSAADQAYSACRSGS
Ga0075157_103544232	3300005961	Wastewater Effluent	RAKPTAEAGAVSPVRDDSTNGADRAYSACRSGSA*
Ga0075154_101422494	3300005989	Wastewater Effluent	VRPNVRAKLPAEAGAVSLVRDDAPCAADQAYSACRSGS
Ga0075154_101580771	3300005989	Wastewater Effluent	PNVRAKLPAEAGAVSLVRDDAPSAANQAYSACRSGSA*
Ga0075154_103945361	3300005989	Wastewater Effluent	TPNVRAKLPAEAGTVSLVRDDASRAADQAYSACRSGSA*
Ga0075154_105020881	3300005989	Wastewater Effluent	RAKLPAEAGGVRLVRDDAPCAADQPYAACRSGSA*
Ga0114341_103265911	3300008108	Freshwater, Plankton	VLPNVRAKLAAEAGAVSLVRDDAPSAADQAYTACRS
Ga0114356_13835112	3300008121	Freshwater, Plankton	VAFVRPNVRVKPPAEAGSVSLVRDDAPCAADQAYAACRS
Ga0164293_107664711	3300013004	Freshwater	LGSGICVGVRPNVGAKLPAEARSVSLVRDDASRAADQAYAA
Ga0208327_10210941	3300020522	Freshwater	MNVRPNVGAKLPAEARSVSLVRDDASRAADQAYAAC
Ga0209278_10335885	3300027673	Wastewater Effluent	VTPNVRGNLPAEARSVSLVRDDASMAADQAYAACRSGS
Ga0209278_10474671	3300027673	Wastewater Effluent	VTPNVRAKLPAEAGAVSLVRDDAPSAADQAYSACR
Ga0209812_101483642	3300027786	Wastewater Effluent	EALDPHTKARFLMPNVRAKLPAEAGAVSLVRDDAPSAADQAYSACRSGSA
Ga0209985_100622461	3300027806	Freshwater Lake	MLNVRPNVRGNLPAEARSVSLVRDNASMAADQAYAA
Ga0209985_101168121	3300027806	Freshwater Lake	MTPNVRAKLPAEACSVSLVCEGAEGAAHQAYAACRSG
Ga0209985_101446901	3300027806	Freshwater Lake	MRPNVRGNLPAEARSVSLVRDDASRAADQAYAACR
Ga0209985_102619912	3300027806	Freshwater Lake	MPNVRGNLPAEARSVSLVRDNASMAADQAYAACRSGS
Ga0209985_102722771	3300027806	Freshwater Lake	VLVVKPNVRVKPPAEAGSVSLVRDDAPCAADQAYAA
Ga0209990_101335901	3300027816	Freshwater Lake	MVDVNARPNVRAKLPAEAGAVSPVRDNSTAGADRAYSAC
Ga0307408_1013268922	3300031548	Rhizosphere	MMANVRVNRPAEAGGVRLVCEGAEGAAHQAYAACRSGSG
Ga0315902_108462291	3300032093	Freshwater	VLPNVRAKLPAEACSVSLVCEGAEGAAQQAYAACRS
Ga0334977_0097635_1432_1572	3300033978	Freshwater	MGVGGFCVRPNVGAKLPAEAGAVSLVRDDAPSAADQAYSACRSGSA
Ga0334977_0375742_558_665	3300033978	Freshwater	MTPNVGAKLPAEARSVSLVRDDASRAADQAYAACRS
Ga0334981_0108024_1_120	3300033980	Freshwater	MIVLPNVRVKLRATAGSVSLVREDVRSTADQAYAACRSVS
Ga0334981_0238749_3_113	3300033980	Freshwater	MNLMPNVGAKLPAEARSVSLVRDDASRAADQAYAACR
Ga0334981_0298796_2_121	3300033980	Freshwater	MRMVVFVMPNVGAKLPAEAGAVSLVRDDAPSAADQAYSAC
Ga0334981_0395282_3_110	3300033980	Freshwater	MLACGLLRPNVGAKRPAEAGAVSLVRDDAPSAADQA
Ga0334981_0401623_480_584	3300033980	Freshwater	MTPNVRGNLPAEARSVSLVRDDASRAADQAYAACR
Ga0334982_0350823_567_680	3300033981	Freshwater	MTPNVGAKLPAEARSVSLVRDDASRAADQAYAACRSGS
Ga0334982_0375362_2_115	3300033981	Freshwater	MMPNVRAKLPAEAGAVSLVRDDAPSAADQAYSACRSGS
Ga0334982_0495841_436_540	3300033981	Freshwater	MLFGGPNVGAKLPAEARSVSLVRDDASRAADQAYA
Ga0334992_0167088_1004_1117	3300033992	Freshwater	MLKRALVRPNVGAKLPAEARSVSLVRDDASRAADQAYA
Ga0334996_0075035_3_113	3300033994	Freshwater	MSGIRTPNVRAKLPAEAGAVSLVRDDAPCAADQAYSA
Ga0334996_0182608_583_708	3300033994	Freshwater	MALTPNVRAKLPAEAGAVSLVRDDAPRAANQAYSACRSGSA
Ga0334996_0188444_990_1112	3300033994	Freshwater	MSVKPNVRAKLPAEAGAVSLVRDDAPCAADQAYSACRSGSA
Ga0334996_0206752_2_109	3300033994	Freshwater	MFPGGPNVRAKLPAEAGAVSLVRDDAPSAADQAYSA
Ga0334996_0219347_878_1000	3300033994	Freshwater	MFVTPNVRAKLPAEAGAVSLVRDDAPCAADQAYSACRSGSA
Ga0334996_0234397_828_953	3300033994	Freshwater	METSFMRPNVGAKLPAEAGAVSLVRDDAPSAADQAYSACRSG
Ga0334996_0314305_2_115	3300033994	Freshwater	MVVRNFVTPNVGAKLPAEAGAVSLVRDDAPSAADQAYS
Ga0334996_0470231_2_112	3300033994	Freshwater	NVRAKLPAEACSVSLVCEGAEGAAHQAYAACRSGSA
Ga0334996_0528511_3_128	3300033994	Freshwater	MSGKRSNVGAKLPAEAGAVSLVRDDAPSAADQAYSACRSGSA
Ga0334979_0264351_2_112	3300033996	Freshwater	MPNVGAKLPAEAGAVSLVRDDAPSAADQAYSACRSGS
Ga0334979_0266863_879_983	3300033996	Freshwater	MSNVGAKLPAEAGAVSLVRDDAPSAADQAYSACRS
Ga0334979_0407600_640_750	3300033996	Freshwater	MKPNVGAKLPAEAGAVSLVRDDAPSAADQAYSACRSG
Ga0334998_0052275_2729_2842	3300034019	Freshwater	MRSNVGAKLPAEARSVSLVRDDASRAADQAYAACRSGS
Ga0334998_0549846_526_636	3300034019	Freshwater	MRPNVGAKLPAEARSVSLVRDDASRAPDQAYAACRSG
Ga0335002_0123700_1580_1717	3300034020	Freshwater	MSLKQYLILRPNVRAKLPAEAGAVSLVRDDAPCAADQAYSACRSGS
Ga0335002_0220573_2_115	3300034020	Freshwater	MRPNVGAKLPAEARSVSLVRDDASRAPDQAYAACRSGS
Ga0335002_0369299_3_125	3300034020	Freshwater	MVVRPNVGAKLPAEAGAVSLVRDDAPSAADQAYSACRSGSA
Ga0335002_0425128_622_729	3300034020	Freshwater	MMPNVRAKLPAEACSVSLVCEGAEGAAHQAYAACRS
Ga0335002_0482853_3_137	3300034020	Freshwater	MGWIVRQQCVCVRPNVGAKLPAEAGAVSLVRDDAPSAADQAYSAC
Ga0335002_0537762_3_146	3300034020	Freshwater	MVRVNAGFLATPNVRAKLPAEACSVSLVCEGAEGAAHRAYAACRSGSA
Ga0335002_0566432_2_127	3300034020	Freshwater	MASRPRAFVMPNVRAKLPAEAGAVSLVRDDAPCAADQAYSAC
Ga0335002_0676425_1_120	3300034020	Freshwater	MHCEWIARPNVRAKLPAEAGAVSLVRDDAPCAADQAYSAC
Ga0334987_0270347_1010_1144	3300034061	Freshwater	MSSCDARSVRPNVRAKLPAEAGAVSLVRDDAPSAAAQAYSACRSG
Ga0334987_0385505_784_891	3300034061	Freshwater	MTWEVMTPNVRAKLPAEAGAVSLVRDDAPCAADQAY
Ga0334987_0470562_2_121	3300034061	Freshwater	MGLGPNVGAKLPAEAGAVSLVRDDAPSAADQAYSACRSGS
Ga0334987_0517439_3_143	3300034061	Freshwater	GSAAVWVVRPNVRAKLPAEADGVSLVCEGAEGAAHQAYDDCRSGSA
Ga0334987_0588082_2_112	3300034061	Freshwater	MLTPNVRAKLPAEAGAVSLVRDDAPCAADQAYSACR
Ga0334987_0641235_504_617	3300034061	Freshwater	MLECHRRPNVRAKLPAEAGAVSLVRDDAPCAADQAYSA
Ga0334995_0718658_3_113	3300034062	Freshwater	MFPGGPNVRAKLPAEAGAVSLVRDDAPSAADQAYSAC
Ga0335019_0165569_1343_1447	3300034066	Freshwater	MCFARPNVRAKLPAEAGAVSLVRDDAPCAADQAYS
Ga0335019_0180100_1271_1375	3300034066	Freshwater	MTPNVRAKLPAEAGAVSLVRDDAPSAADQAYSACR
Ga0335019_0293515_3_113	3300034066	Freshwater	MGLRMPNVRAKLPVEACSVSLVCEGAEGAAHQAYAAC
Ga0335019_0587417_529_654	3300034066	Freshwater	MTCEVMTPNVRVKPPVEAGSVSLVCEGAEGAAHLAYAACRSG
Ga0335019_0591923_2_106	3300034066	Freshwater	MTVTPNVRAKLPAEAGAVSLVRDDAPSAADQAYSA
Ga0335019_0610408_528_635	3300034066	Freshwater	MKPNVRAKLPTEAGAVSLVRDDAPSAADQAYSACRS
Ga0335028_0456554_602_715	3300034071	Freshwater	MTPNVGAKLPAEAGAVSLVRDDAPSAADQAYSACRSGS
Ga0335010_0525968_493_615	3300034092	Freshwater	MWWWNLRPNVGAKLPAEAGAVSLVRDDAPSAADQAYSACRS
Ga0335025_0168175_1_105	3300034096	Freshwater	MSNVGAKLPAEARSVSLVRDDASRAADQAYAACRS
Ga0335029_0469641_12_137	3300034102	Freshwater	MALTPNVRAKLPAKAGAVSLVRDDAPSAADQAYSACRSGSA
Ga0335030_0456855_707_814	3300034103	Freshwater	MFLPPNVGAKLPAEARSVSLVRDDASRAADQAYAAC
Ga0335031_0268273_1006_1122	3300034104	Freshwater	MQTAALVRPNVRAKLPAEAGAVSLVRDDAPCAADQAYSA
Ga0335063_0468132_3_110	3300034111	Freshwater	MRPNVRAKLPAEAGAVSLVRDDAPCAADQAYSACRS
Ga0335066_0193711_2_130	3300034112	Freshwater	MCVHVMPNVRGNLPAEARSVSLVRDDASRAADQAYAACRSGSG
Ga0335066_0491796_543_650	3300034112	Freshwater	MMPNVRAKLPAEARSVSLVRDDASRPADQAYAACRS
Ga0335054_0131811_1420_1530	3300034119	Freshwater	MVLLVLPNVRAKLPAEAGAVSLVRDDAPCAADQAYSA
Ga0335054_0343128_760_864	3300034119	Freshwater	MLPNVRAKLPTEAGAVSLVRDDAPSAADQAYSACR
Ga0335054_0424972_627_755	3300034119	Freshwater	VLLVLPNVRAKLPAEADGVSLVCEGAEGAAHQAYDDCRSGSA
Ga0335054_0584452_479_613	3300034119	Freshwater	MASRPRAFVMPNVRAKLPAEAGAVSLVRDDAPCAADQAYSACRSG
Ga0335054_0785578_387_503	3300034119	Freshwater	MLFGGPNVGAKLPAEAGAVSLVRDDAPSAADQAYSACRS
Ga0335056_0466424_2_118	3300034120	Freshwater	MDIASLVRPNVGAKLPAEARSVSLVRDDASRAADQAYAA
Ga0335049_0264254_745_870	3300034272	Freshwater	MNVMPNVRAKLPAEACSVSLVCEGAEGAAHQAYAACRSGSA
Ga0335049_0278262_1006_1140	3300034272	Freshwater	MSLKQYLILRPNVRAKLPAEAGAVSLVRDDAPCAADQAYSACRSG
Ga0335049_0337092_866_1006	3300034272	Freshwater	MEPALSGFMRPNVGAKLPAEAGAVSLVRDDAPSAADQAYSACRSGSA
Ga0335049_0525341_641_748	3300034272	Freshwater	MNVMPNVRAKLPAEAGAVSLVRDDAPSAADQAYSAC
Ga0335049_0601943_566_679	3300034272	Freshwater	MELALSGFMRPNVRAKLPAEACSVSLVCEGAEGAAHQA
Ga0335049_0624163_2_106	3300034272	Freshwater	MVLPNVRAKLPAKAGAVSLVRDDAPSAADQAYSAC
Ga0335007_0306588_885_1037	3300034283	Freshwater	SSVAMNIGGLFVMPNVRAKLPAEACGVSLVCDGAEGAAHQAYAACRSGSA
Ga0335007_0639114_498_605	3300034283	Freshwater	MLPNVRAKLPAEAGAVSLVRDDAPCAADQAYSACRS
Ga0335007_0699479_3_113	3300034283	Freshwater	NVRATLPAEACSVSLMCEGAEGAAHQAYAACRSGSA