NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F058430

Metagenome Family F058430

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F058430
Family Type Metagenome
Number of Sequences 135
Average Sequence Length 152 residues
Representative Sequence VPKDDEFTVLDTVNFTSTTFDVTIPSLGGTITGNVDISLPTDFCFYLVNTGTITNINQFFPLFVASIDSSQQYYSLTLNEILPLINHPTVQAGSNFGSANNEIAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY
Number of Associated Samples 80
Number of Associated Scaffolds 135

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.26 %
% of genes from short scaffolds (< 2000 bps) 93.33 %
Associated GOLD sequencing projects 74
AlphaFold2 3D model prediction Yes
3D model pTM-score0.19

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(42.222 % of family members)
Environment Ontology (ENVO) Unclassified
(86.667 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(91.852 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 5.33%    β-sheet: 1.18%    Coil/Unstructured: 93.49%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.19
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000949|BBAY94_10193049All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium549Open in IMG/M
3300001966|GOS2245_1021440All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium956Open in IMG/M
3300002231|KVRMV2_101566271All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium702Open in IMG/M
3300002482|JGI25127J35165_1008318All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2681Open in IMG/M
3300002482|JGI25127J35165_1031225All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1222Open in IMG/M
3300002482|JGI25127J35165_1071770All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium721Open in IMG/M
3300002482|JGI25127J35165_1078830All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium679Open in IMG/M
3300002482|JGI25127J35165_1103492All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium572Open in IMG/M
3300002482|JGI25127J35165_1125509All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium506Open in IMG/M
3300002483|JGI25132J35274_1047487All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium935Open in IMG/M
3300002483|JGI25132J35274_1050809All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium896Open in IMG/M
3300002483|JGI25132J35274_1119636All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium527Open in IMG/M
3300002483|JGI25132J35274_1127687All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium506Open in IMG/M
3300002488|JGI25128J35275_1014653All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1996Open in IMG/M
3300002488|JGI25128J35275_1078281All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium682Open in IMG/M
3300005074|Ga0070431_1186712All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium729Open in IMG/M
3300005097|Ga0072505_1448849All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium801Open in IMG/M
3300006166|Ga0066836_10628598All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium650Open in IMG/M
3300006738|Ga0098035_1106515All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium973Open in IMG/M
3300006789|Ga0098054_1005547All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium5524Open in IMG/M
3300006793|Ga0098055_1026967All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2403Open in IMG/M
3300006793|Ga0098055_1411408All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium500Open in IMG/M
3300006928|Ga0098041_1071755All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1117Open in IMG/M
3300006928|Ga0098041_1147077All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium758Open in IMG/M
3300007049|Ga0101554_1022623All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium572Open in IMG/M
3300007137|Ga0101673_1005638All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1784Open in IMG/M
3300009550|Ga0115013_10732011All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium675Open in IMG/M
3300009593|Ga0115011_10201591All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1470Open in IMG/M
3300009790|Ga0115012_11188779All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium640Open in IMG/M
3300009790|Ga0115012_11526088All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium575Open in IMG/M
3300009790|Ga0115012_12110348All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium502Open in IMG/M
3300010149|Ga0098049_1262039All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium524Open in IMG/M
3300010150|Ga0098056_1263007All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium571Open in IMG/M
3300012919|Ga0160422_10346633All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium919Open in IMG/M
3300012928|Ga0163110_10661843All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium811Open in IMG/M
3300012952|Ga0163180_10199356All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1366Open in IMG/M
3300012953|Ga0163179_12079003All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium524Open in IMG/M
3300017720|Ga0181383_1041399All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1238Open in IMG/M
3300017720|Ga0181383_1051818All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1102Open in IMG/M
3300017720|Ga0181383_1177057All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium569Open in IMG/M
3300017726|Ga0181381_1138887All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium505Open in IMG/M
3300017731|Ga0181416_1017158All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1700Open in IMG/M
3300017733|Ga0181426_1065857All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium720Open in IMG/M
3300017738|Ga0181428_1045525All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1022Open in IMG/M
3300017738|Ga0181428_1090827All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium713Open in IMG/M
3300017738|Ga0181428_1113155All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium636Open in IMG/M
3300017738|Ga0181428_1143977All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium557Open in IMG/M
3300017738|Ga0181428_1145832All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium553Open in IMG/M
3300017744|Ga0181397_1154894All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium584Open in IMG/M
3300017745|Ga0181427_1005274All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3245Open in IMG/M
3300017745|Ga0181427_1031692All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1316Open in IMG/M
3300017745|Ga0181427_1114321All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium659Open in IMG/M
3300017750|Ga0181405_1030213All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1475Open in IMG/M
3300017750|Ga0181405_1132999All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium618Open in IMG/M
3300017753|Ga0181407_1017828All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1975Open in IMG/M
3300017755|Ga0181411_1050925All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1276Open in IMG/M
3300017755|Ga0181411_1145285All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium684Open in IMG/M
3300017763|Ga0181410_1105461All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium814Open in IMG/M
3300017764|Ga0181385_1086680All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium962Open in IMG/M
3300017764|Ga0181385_1200624All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium603Open in IMG/M
3300017765|Ga0181413_1267936All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium501Open in IMG/M
3300017767|Ga0181406_1073541All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1044Open in IMG/M
3300017771|Ga0181425_1033152All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1700Open in IMG/M
3300017773|Ga0181386_1158246All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium691Open in IMG/M
3300017786|Ga0181424_10436268All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium529Open in IMG/M
3300020246|Ga0211707_1043667All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium606Open in IMG/M
3300020257|Ga0211704_1057735All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium579Open in IMG/M
3300020261|Ga0211534_1023251All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1079Open in IMG/M
3300020264|Ga0211526_1048550All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium716Open in IMG/M
3300020279|Ga0211634_1118366All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium570Open in IMG/M
3300020370|Ga0211672_10233259All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium569Open in IMG/M
3300020371|Ga0211500_1093128All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium900Open in IMG/M
3300020392|Ga0211666_10213123All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium739Open in IMG/M
3300020394|Ga0211497_10365612All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium529Open in IMG/M
3300020403|Ga0211532_10127867All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1060Open in IMG/M
3300020403|Ga0211532_10152630All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium947Open in IMG/M
3300020403|Ga0211532_10351349All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium560Open in IMG/M
3300020404|Ga0211659_10397767All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium598Open in IMG/M
3300020410|Ga0211699_10144826All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium894Open in IMG/M
3300020410|Ga0211699_10435857All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium520Open in IMG/M
3300020429|Ga0211581_10163661All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium900Open in IMG/M
3300020433|Ga0211565_10162923All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium968Open in IMG/M
3300020442|Ga0211559_10424240All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium613Open in IMG/M
3300020442|Ga0211559_10440282All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium600Open in IMG/M
3300020451|Ga0211473_10698428All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium508Open in IMG/M
3300020459|Ga0211514_10526262All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium581Open in IMG/M
3300020474|Ga0211547_10335713All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium765Open in IMG/M
3300020474|Ga0211547_10497509All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium610Open in IMG/M
3300020474|Ga0211547_10590430All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium551Open in IMG/M
3300020475|Ga0211541_10266448All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium838Open in IMG/M
3300021539|Ga0224716_1049136All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium572Open in IMG/M
3300025098|Ga0208434_1042562All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1021Open in IMG/M
3300025101|Ga0208159_1091742All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium556Open in IMG/M
3300025110|Ga0208158_1124193All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium597Open in IMG/M
3300025118|Ga0208790_1032369All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1721Open in IMG/M
3300025127|Ga0209348_1003764All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium6801Open in IMG/M
3300025127|Ga0209348_1005720All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium5342Open in IMG/M
3300025127|Ga0209348_1023566All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2274Open in IMG/M
3300025127|Ga0209348_1032843All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1850Open in IMG/M
3300025127|Ga0209348_1060290All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1252Open in IMG/M
3300025127|Ga0209348_1091399All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium957Open in IMG/M
3300025127|Ga0209348_1138679All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium723Open in IMG/M
3300025127|Ga0209348_1157003All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium664Open in IMG/M
3300025127|Ga0209348_1171618All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium625Open in IMG/M
3300025127|Ga0209348_1171766All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium624Open in IMG/M
3300025127|Ga0209348_1174490All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium617Open in IMG/M
3300025127|Ga0209348_1202790All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium552Open in IMG/M
3300025127|Ga0209348_1212363All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium534Open in IMG/M
3300025128|Ga0208919_1172935All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium659Open in IMG/M
3300025132|Ga0209232_1022434All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2474Open in IMG/M
3300025132|Ga0209232_1043807All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1662Open in IMG/M
3300025132|Ga0209232_1047998All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1571Open in IMG/M
3300025132|Ga0209232_1257448All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium500Open in IMG/M
3300025151|Ga0209645_1094481All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium977Open in IMG/M
3300025151|Ga0209645_1160117All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium688Open in IMG/M
3300025151|Ga0209645_1183458All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium627Open in IMG/M
3300025151|Ga0209645_1185441All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium623Open in IMG/M
3300025151|Ga0209645_1191050All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium610Open in IMG/M
3300025151|Ga0209645_1214849All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium558Open in IMG/M
3300027774|Ga0209433_10198342All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium754Open in IMG/M
3300027906|Ga0209404_10410876All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium883Open in IMG/M
3300028022|Ga0256382_1089459All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium736Open in IMG/M
3300029302|Ga0135227_1041628All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium543Open in IMG/M
3300029319|Ga0183748_1024262All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2078Open in IMG/M
3300029319|Ga0183748_1042802All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1345Open in IMG/M
3300029319|Ga0183748_1125674All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium546Open in IMG/M
3300029792|Ga0183826_1013354All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1351Open in IMG/M
3300029792|Ga0183826_1054216All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium614Open in IMG/M
3300031774|Ga0315331_11071055All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium544Open in IMG/M
3300031775|Ga0315326_10692508All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium642Open in IMG/M
3300031785|Ga0310343_10396651All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium999Open in IMG/M
3300031785|Ga0310343_11382996All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium532Open in IMG/M
3300032011|Ga0315316_10952129All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium701Open in IMG/M
3300032011|Ga0315316_11194701All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium611Open in IMG/M
3300032073|Ga0315315_10413487All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1254Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine42.22%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine22.22%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater20.74%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater3.70%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.48%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.48%
Marine Benthic Sponge Stylissa Massa AssociatedHost-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Benthic Sponge Stylissa Massa Associated1.48%
Stylissa Sp.Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Stylissa Sp.1.48%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.74%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater0.74%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.74%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment0.74%
Marine HarborEnvironmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor0.74%
Volcanic Co2 SeepsEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seeps0.74%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.74%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000949Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94Host-AssociatedOpen in IMG/M
3300001966Marine microbial communities from Roca Redonda, Equador - GS030EnvironmentalOpen in IMG/M
3300002231Marine sediment microbial communities from Santorini caldera mats, Greece - red matEnvironmentalOpen in IMG/M
3300002482Marine viral communities from the Pacific Ocean - ETNP_2_30EnvironmentalOpen in IMG/M
3300002483Marine viral communities from the Pacific Ocean - ETNP_6_30EnvironmentalOpen in IMG/M
3300002488Marine viral communities from the Pacific Ocean - ETNP_2_60EnvironmentalOpen in IMG/M
3300005074Marine benthic sponge Stylissa massa associated microbial communities from Guam, USAHost-AssociatedOpen in IMG/M
3300005097MiSeq S massa metagenomeHost-AssociatedOpen in IMG/M
3300006166Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91EnvironmentalOpen in IMG/M
3300006738Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006928Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaGEnvironmentalOpen in IMG/M
3300007049Marine sponge Stylissa sp. microbiome, Papua New Guinea CO2seep, Upa-Upasina 'control', st32icHost-AssociatedOpen in IMG/M
3300007137Seawater microbiome, Papua New Guinea CO2 seep, Dobu 'control', water-dcEnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300012919Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaGEnvironmentalOpen in IMG/M
3300012928Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaGEnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017733Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23EnvironmentalOpen in IMG/M
3300017738Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017745Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300020246Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX555934-ERR599105)EnvironmentalOpen in IMG/M
3300020257Marine microbial communities from Tara Oceans - TARA_B100000508 (ERX555911-ERR599048)EnvironmentalOpen in IMG/M
3300020261Marine microbial communities from Tara Oceans - TARA_B100000401 (ERX556096-ERR598970)EnvironmentalOpen in IMG/M
3300020264Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556116-ERR599158)EnvironmentalOpen in IMG/M
3300020279Marine microbial communities from Tara Oceans - TARA_B100000482 (ERX555939-ERR599017)EnvironmentalOpen in IMG/M
3300020370Marine microbial communities from Tara Oceans - TARA_B100001029 (ERX556065-ERR599079)EnvironmentalOpen in IMG/M
3300020371Marine microbial communities from Tara Oceans - TARA_B100000003 (ERX555978-ERR598991)EnvironmentalOpen in IMG/M
3300020392Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX555916-ERR599163)EnvironmentalOpen in IMG/M
3300020394Marine microbial communities from Tara Oceans - TARA_B000000557 (ERX556068-ERR599026)EnvironmentalOpen in IMG/M
3300020403Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145)EnvironmentalOpen in IMG/M
3300020404Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978)EnvironmentalOpen in IMG/M
3300020410Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148)EnvironmentalOpen in IMG/M
3300020429Marine microbial communities from Tara Oceans - TARA_B100000614 (ERX556134-ERR599032)EnvironmentalOpen in IMG/M
3300020433Marine microbial communities from Tara Oceans - TARA_B100001989 (ERX556106-ERR599030)EnvironmentalOpen in IMG/M
3300020442Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162)EnvironmentalOpen in IMG/M
3300020451Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996)EnvironmentalOpen in IMG/M
3300020459Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095)EnvironmentalOpen in IMG/M
3300020474Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976)EnvironmentalOpen in IMG/M
3300020475Marine microbial communities from Tara Oceans - TARA_B100002029 (ERX555951-ERR599001)EnvironmentalOpen in IMG/M
3300021539Marine sponge Stylissa sp. microbiome, Papua New Guinea CO2seep, Upa-Upasina 'control', st32ic 200bp no Eukaryotes lastHost-AssociatedOpen in IMG/M
3300025098Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025101Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025110Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025118Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025127Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025128Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025132Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027774Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_5_50m (SPAdes)EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028022Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750mEnvironmentalOpen in IMG/M
3300029302Marine harbor viral communities from the Indian Ocean - SRB3EnvironmentalOpen in IMG/M
3300029319Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516EnvironmentalOpen in IMG/M
3300029792Marine giant viral communities collected during Tara Oceans survey from station TARA_041 - TARA_Y100000052EnvironmentalOpen in IMG/M
3300031774Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915EnvironmentalOpen in IMG/M
3300031775Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315EnvironmentalOpen in IMG/M
3300031785Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MGEnvironmentalOpen in IMG/M
3300032011Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
BBAY94_1019304913300000949Macroalgal SurfaceLEIGQKVFLDFKTYSAGTFPTDDTFTVQDTANFTATTFDVTVPAIGGGATITGNVDASLPIDFCVYLVNTGTITNINQFFPLFVQSIPQVAENQILSTTLTEKLPLINHPVVQSGAANFAGANNEIAPKQRGLMLKRGQALYVAASGATALTNGFFCNLQGGFY*
GOS2245_102144023300001966MarineKLFCDFLTYNSGTVPTDDTFEVIDTSNFTPTTFDITIPTIGGGATITGNVALSLPIDFCFYLVSTGTITNINQFFPLFTQSIPQVAENQILSTTLTEKLPLINHPTVQSGALNFAGSNNEIAPKQRGLMLRRGQALYVAASGSTALTNGFYCNVQGGFY*
KVRMV2_10156627123300002231Marine SedimentSAGTFPTDDTFTVQDTANFTATTFDVTVPAIGGGATITGNVDASLPIDFCVYLVNTGTITNINQFFPLFVQSIPQVAENQILSTTLTEKLPLINHPVVQSGAANFAGANNEIAPKQRGLMLKRGQALYVAASGATALTNGFFCNLQGGFY*
JGI25127J35165_100831813300002482MarineEIGQNVFLDFKTYSSGTVPKDDTFTVLDTVNFTSTTFDVTIPSLGGTITGNVDISLPTDFCFYLVNTGTVTNVNQFXPLFVASIDSSQQSYSLTLNEILPFINHPTVQAGANFASANNEVAPKQRGLMLKRGQALYVAASGATALTNGFFCNVQGGFY*
JGI25127J35165_103122523300002482MarineGQNVFLDFKTYSSGTVPKDDTFTVLDTVNFTSTTFDVTVPSVGGSAITGNVDISLPTDFCFYLVNTGTITNINQFFPLFVASIDCSQQSYSLSEQKILPFINHPTVQAGSNFGSANNAFAPKQRGLMLKRGQALYVAASGANALTNGFYCNVQGGFY*
JGI25127J35165_107177013300002482MarineAVTPTQGTYSATGTVCTVTLSGGHNLEIGQKVFLDFLTYNTGVVPKDDTFEVKDTLNFTSTTFDVDVPSQSAANGNVNVSLPXDFCFYLVSTGTITNINQFFPLFTQSIPQVSENQILSTTLTEKLPLINHPTVQSGALNFAGSNNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNVQGGFY*
JGI25127J35165_107883023300002482MarineQKVFLDFASYSSGTVPKDDTFEVKNTTNYTSTTFDVDIPSLGGTITGNVNVTLPTDFCFYLVNTGTVTNVNQFFPLFVASVDSSQQTYSLTLNEILPFINHPTVQAGSNFVSANNEVAPKQRGLMLKRGQALYAAASGATALTNGFFCNVQGGFY*
JGI25127J35165_110349213300002482MarineGHNLEIGQNVFLDFKTYSSGTVPKDDTFTVLDTVNFTSTTFDVTIPSVGGTITGNVDISLPTDFCFYLVNTGTVTNINQFFPLFVASIDCSQQSYSLSEQKILPFINHPTVQAGANFGSANNALAPKQRGLMLKRGQALYVAASGANALTNGFYCNVQGGFY*
JGI25127J35165_112550913300002482MarineSYSSGTVPKDDIFEVQDTVNFTSTTFDVTVPTVGGSAITGNVNVSLPTDFCFYLVNAGTVTNITQFLPLFVASIDCSQQYYSLTEEKILPLINHPTVQAGANFGSANNTVAPKQRGLMLKRGQALYVAASGANALTNGFYCNVQGGFY*
JGI25132J35274_104748723300002483MarineTLNFTSTTFDVDVPSQSAANGNVNVSLPVDFCFYLVSTGTITNINQFFPLFTQSIPQVSENQILSTTLTEKLPLINHPTVQSGALNFAGSNNEIAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY*
JGI25132J35274_105080913300002483MarineSGVVPKDDTFTVLDTVNFTSTTFDVTIPSLSGTITGNVDISLPTDFCFYLVNTGTVTNINQFFPLFVASIDCDQQAYSLTQQKILPLINHPTVQAGANFNSANNQVAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY*
JGI25132J35274_111963613300002483MarineVVPKDDTFEVKDTLNFTSTTFDVDVPSQSAANGNVNVSLPIDFCFYLVSTGTITNINQFFPLFTQSIPQVSENQILSTTLTEKLPLINHPTVQSGALNFAGSNNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNIQGGFY*
JGI25132J35274_112768713300002483MarineIDNEFTALATGHTATTFEVTIPSLGGTITGNVSVYRPTDFCFYLVSVGTVTNVNQFFPLFVANLPSTPAYETCSLSMKGVLPFINHPTIQAGTNVSTANSNIALKNRGLMLKRGQALYCAASGATALTNGFYCNVQGGYY*
JGI25128J35275_101465323300002488MarineTYSSGTVPVDGEFTALVTGHTATTFDVTIPSLGGTITGNVSVYLPTDFCFYLVGTGTVTNINQFFPLFVANLPSTPTYENCSLSMKGVLPFINHPSVQAGANVTSANSNVSPKNRGLMLKRGQALYCATSGSTALTNGFYCNVQGGFY*
JGI25128J35275_107828123300002488MarineEVQDTVNFTSTTFDVTVPTVGGSAITGNVNVSLPTDFCFYLVNTGTVTNINQFXPLFVASIDCSQQYYSLTLNEILPLINHPTVQAGSNFISANNEVAPKQRGLMLKRGQALYVAASGANALTNGFYCNVQGGFY*
Ga0070431_118671213300005074Marine Benthic Sponge Stylissa Massa AssociatedTLSGGHNLEIGQKVFLDFLTYNTGVVPKDDTFEVKDTLNFTSTTFDVDVPSQSAANGNVNVSLPIDFCFYLVSTGTITNINQFFPLFTQSIPQVSENQILSTTLTEKLPLINHPTVQSGALNFAGSNNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNIQGGFY*
Ga0072505_144884913300005097Marine Benthic Sponge Stylissa Massa AssociatedTCTVTLSAGHNLEPGQNVFLDFKTYSSGTVPKDDTFEVLDSVNFTSTTFDVTIPSFGGTITGNVDISLPTDFCFYLVNTGTVTNINQFFPLFVASVDSSQQSYSLSEQKILPFINHPTVQAGANFGSANNALAPKQRGLMLKRGEALYVAASGATALTNGFYCNVQGGFY*
Ga0066836_1062859823300006166MarineVFLNFTSYNSGTVPIDGKFTVLTITPTTFTATIPNIPSGTITGNVSVSVPIDFCFYLVSAGTVTNINQFFPLFVASIESVASKQSCSLTMKEILPLINHPTVQSGAANWGSANNEIAPKQRGLMLKRGQALYVSASGTAALTNGFYCNVQGGYY*
Ga0098035_110651513300006738MarineHNLEVGQQTFLNFTSHSGGSSVPIDGTFTIVTVTPTTFTVTIPNIASGTITGNVDVYDPIDFCFYLVSTGTVTNINQFFPLFVASIDAVAATQYCSLTLKEVLPLINHPVVQAGSNFGSANNEIAPKQRGLMLKRGQALYVSVSGTAALTNGFYCNIQGGYY*
Ga0098054_100554713300006789MarineTPTTFTATIPNIPSGTITGNVEVSVPIDFCFYLVSTGTVTNINQFFPLFVASIESVASKQSCSLTMKEILPLINHPTVQSGAANWGSANNEIAPKQRGLMLKRGQALYVSASGTAALTNGFYCNVQGGYY*
Ga0098055_102696713300006793MarineFTVLTITPTTFTATIPNIPSGTITGNVDVSVPIDFCFYLVSTGTVTNINQFFPLFVASIESVASKQSCSLTMKEILPLINHPTVQSGAANWGSANNEIAPKQRGLMLKRGQALYVSASGTAALTNGFYCNVQGGYY*
Ga0098055_141140823300006793MarineDGTFTIVTITPTTFTVTIPNIASGTITGNVDVYDPIDFCFYLVSTGTVTNINQFFPLFVASIDAINTAQSCSLTLKEILPLINHPVVQAGSNFGSANNEVAPKQRGLMLKRGQALYVSVSGTAALTNGFYCNIQGGYY*
Ga0098041_107175513300006928MarineNEFTALATGHTATTFEVTIPSLGGTITGNVSVYRPTDFCFYLVSVGTVTNVNQFFPLFVANLPSTPAYETCSLSMKGVLPFINHPTIQAGTNVSTANSNIALKNRGLMLKRGQALYCAASGATALTNGFYCNVQGGYY*
Ga0098041_114707723300006928MarineDVFLDFTSYSSGVVPIDDKFTVTAATSTTFTCTIPSVGGTITGNVNVYLPTDFAFYLVNAGTVTNINQFFPLFVASIPSTFAHQNYSLTLNEILPFINHPTVQAGSNFTSANNEVAPKHRGLMLKRGQALYVSASGATALTNGFYCNIQGGYY*
Ga0101554_102262323300007049Stylissa Sp.VKDTLNFTSTTFDVDVPSQSAANGNANVSLPVDFCFYLVSTGTITNINQFFPLFTQSIPQVSENQILSTTLTEKLPLINHPTVQSGALNFAGANNETAPKQRGLMLRRGQALYVAASGATALTNGFYCNIQGGFY*
Ga0101673_100563823300007137Volcanic Co2 SeepsVQASVGQKVFLDFLTYNTGTVPKDDTFTVSDTVNFSSTEFDVTIPNIPSGTITGNVNVSLPIDFCFYLVSTGTITNINQFFPLFTQSIPQVAENQILSTTLTEKLPLINHPTVQSGALNFAGSNNEIAPKQRGLMLRRGQALYVAASGSTALTNGFYCNVQGGFY*
Ga0115013_1073201113300009550MarineKVFLDFKTYSAGTFPTDDTFTVQDTANFTATTFDVTVPAIGGGATITGNVDASLPIDFCVYLVNTGTVTNINKFFPLFVQSIPQVAENQILSTTLTEKLPLINHPVVQSGAANFAGANNEIAPKQRGLMLKRGQALYVAASGATALTNGFFCNLQGGFY*
Ga0115011_1020159113300009593MarineLEVGQVVFLDFTSYNSGAVPIDGKFEVVTITPTTFTVTIPNIASGTITGNVSVYDPIDFCFYLVSTGTVTNINQFFPLFVASIDAVAATQSCSLTLKEILPLINHPVVQAGSNFGSANNEVAPKQRGLMLKRGQALYVSVSGTAALTNGFYCNIQGGYY*
Ga0115012_1118877913300009790MarineSSGSVPVDGTFTVTKVTPTTFDVTIPSQGSITGNVSAYLPTLFCFYLVNSSTVTNINQFFPLFVASVDAVATKQNFSLTLNEVLPFINHPVVQAGSNFTTANNEVSPKTRGLMLKRGQALYAAASGTTALTNGFYCNVQGGYY*
Ga0115012_1152608813300009790MarineVTLSGGHNLEIGQKVFLDFLTYNTGVVPKDDTFTVADTLNFTSTTFDVDVPSQSAANGNVNVSLPIDFCFYLVSTGTITNINQFFPLFTQSIPQVSENQILSTTLTEKLPLINHPTVQSGALNFAGSNNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNIQGGFY*
Ga0115012_1211034813300009790MarineKDDTFEVLDSVNFTSTTFDVTIPSLGGTITGNVDISLPTDFCFYLVNTGTVTNINQFFPLFVASIDCSQQSYSLSEQKILPFINHPTVPAGANFGSANNALAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY*
Ga0098049_126203923300010149MarineTITPTTFTVTIPNIASGTITGNVDVYDPIDFCFYLVSTGTVTNINQFFPLFVASIDAVAATQYCSLTLKEVLPLINHPVVQAGSNFGSANNEIAPKQRGLMLKRGQALYVSVSGTAALTNGFYCNIQGGYY*
Ga0098056_126300723300010150MarineTITPTTFTATIPNIASGTITGNVDVYVPIDFCFYLVSTGILTNINQFFPLFVASIESVASKQSCSLTMKEVLPLINHPTVQSGAANWGSANNEIAPKQRGLMLKRGQALYVSASGTAALTNGFYCNVQGGYY*
Ga0160422_1034663323300012919SeawaterLTSTTFDVTIPNIASGTITGSVNVSLPTDFCFYLVNTGTVTNVNQFFPLFVASIDSSQQYYSLTLNEILPLINHPTVQAGANFGSTNTLETKIAPKQRGLMLKRGQALYVAASGATALSNGFFCNVQGGFY*
Ga0163110_1066184323300012928Surface SeawaterEIGQKVFLDFLTYNTGVVPKDDTFEVKDTLNFTSTTFDVDVPSQSASNGNVNVSLPIDFCFYLVSTGTVTNINQFFPLFTQSIPQVSENQILSTTLTEKLPLINHPTVQSGALNFAGSNNEIAPKQRGLMLRRGQALFVAASGSTALTNGFYCNVQGGFY*
Ga0163180_1019935613300012952SeawaterGQEVKLDFTTWSSGTVPADLVATVTKVGPVANTFQVTIPSQGGPITGAVTVFQPTLFCFYLVSTGTVTNTNQFFPLFTSSIDSVAGKQNYSTTLHEDLPLINHPVVQAGSNFTSANNEVAPKQRGIMLKRGQALYVASTGSTALTTGFYCNVQGGYY*
Ga0163179_1207900313300012953SeawaterFLNFTSYNSGTVPIDGTFTIVTITPTTFTVTIPSLGGTITGNVDVYDPIDFCFYLVSTGTVTNINQFFPLFVASIDAVAATQYCSLTLKEVLPLINHPVVQAGSNFGSANNEIAPKQRGLMLKRGQALYVSVSGTAALTNGFYCNIQGGYY*
Ga0181383_104139913300017720SeawaterIDAVTASAGTYSANSTTCTVTLSGGHNLEIGQKVFLDFTSYNSGVVPKDDEFTVLDTVNFTSTTFDVTVPSQSASNGNVNISLPTDFCFYLVNTGTITNINQFFPLFVASIDSSQQSYSCTLNEVLPFINHPTVQAGSNFGSANNEIAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY
Ga0181383_105181813300017720SeawaterVFLDFTSYNSGVVPKDDEFTVLDTVNFTSTTFDVTVPSQSASNGNVNISLPTDFCFYLVNTGTVTNINQFFPLFVASIDSSQQNYSLTLEEILPFINHPTVQAGSNFVSANNEVAPKQRGLMLKRGQALYVAASGANALTNGFYCNIQGGFY
Ga0181383_117705713300017720SeawaterDGKFSVVTITPTTFTVTIPNIASGTITGNVSVYDPIDFCFYLVSTGTVTNINQFFPLFVASIDSVASTQSCSLTLKEILPLINHPVVQAGSNFGSANNEIAPKQRGLMLKRGQALYVSVSGTAALTNGFYCNIQGGYY
Ga0181381_113888723300017726SeawaterSNFTATKFDVTIPTIGGGATITGNVAISLPIDFCFYLVSTGTITNINQFFPLFTQSIPQVSENQILSTTLTEKLPLINHPVVQSGAANFGASNNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNLQGGFY
Ga0181416_101715823300017731SeawaterTSYNSGTVPIDGKFEVVTITPTTFTVTIPSLGGTITGNVSVYDPIDFCFYLVSTGTVTNINQFFPLFVASIDAVAATQSCSLTLKEVLPLINHPVVQAGSNFGSANNEVAPKQRGLMLKRGQALYVSVSGTAALTNGFYCNIQGGYY
Ga0181426_106585723300017733SeawaterYSANSTTCTVTLSTGHNLEIGQKVFLDFKTYSSGVVPKDDEFTVLDTVNFTSTTFDVTIPSLSGTITGNVDISLPTDFCFYLVNTGTITNINQFFPLFVASIDSSQQSYSCTLNEVLPFINHPTVQAGSNFVSANNEVAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY
Ga0181428_104552513300017738SeawaterKVFLDFKTYSSGTVPKDDEFTVLDTVNFTSTTFDVTVPSVGGSAITGNVDISLPTDFCFYLVNSGTVTNINQFFPLFVASIDSSQQTYSLTLNEILPFINHPTVQAGSNFGSANNEIAPKQRGLMLKRGQALYVAASGANALTNGFYCNVQGGFY
Ga0181428_109082713300017738SeawaterTVQDTANFTATTFDVTVPTIGGGATITGNVDASLPIDFCVYLVNTGTVTNINQFFPLFVQSIPQVAENQILSTTLTEKLPLINHPVVQSGAANFAGANNEIAPKQRGLMLKRGQALYVAASGATALTNGFFCNLQGGFY
Ga0181428_111315513300017738SeawaterTAPTGTYSATNAVCTVTLGTGHNLEIGQKVFLDFKTYSSGVVPKDDEFTVLDTVNFTSTTFDVTIPSLSGTITGNVDISLPTDFCFYLVNTGTITNINQFFPLFVASIDSSQQSYSCTLNEVLPFINHPTVQAGSNFVSANNEVAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY
Ga0181428_114397713300017738SeawaterGTVPVDGEFTALVTGHTATTFDVTIPSLGGTITGNVSVYLPTDFCFYLVGTGTVTNINQFFPLFVANLPSTPTYENCSLSMKGVLPFINHPSVQAGANVTSANSNVSPKNRGLMLKRGQALYCATSGSTALTNGFYCNVQGGFY
Ga0181428_114583213300017738SeawaterEFTVLDTVNFTSTTFDVTVPSQSASNGNVNISLPTDFCFYLVNTGTITNINQFFPLFVASVDSSQQSYSCTLNEVLPFINHPTVQAGSNFVTANNEVAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY
Ga0181397_115489423300017744SeawaterFTSYNSGAVPIDGTFTIVTITPTTFTVTIPNIASGTITGNVDVYDPIDFCFYLVSTGTVTNINQFFPLFVASIDAVAATQYCSLTLKEVLPLINHPVVQAGSNFGSANNEIAPKQRGLMLKRGQALYVSVSGTAALTNGFYCNIQGGYY
Ga0181427_100527413300017745SeawaterTYSSGTVPKDDEFTVLDTVNFTSTTFDVTVPSVGGSAITGNVDISLPTDFCFYLVNSGTVTNINQFFPLFVASIDSSQQTYSLTLNEILPFINHPTVQAGSNFGSANNEIAPKQRGLMLKRGQALYVAASGANALTNGFYCNVQGGFY
Ga0181427_103169213300017745SeawaterAVFLNFTSYNSGTVPIDGTFTIVTITPTTFTVTIPSLGGTITGNVDVYDPIDFCFYLVSTSTVTNINQFFPLFVASIDSVAATQSCSLTLKEILPLINHPVVQAGSNFGSANNEVAPKQRGLMLKRGQALYVSVSGTAALTNGFYCNIQGGYY
Ga0181427_111432113300017745SeawaterDTVNFTSTTFDVTVPSVGGSAITGAVNISLPTDFCFYLVNSGTVTNINQFFPLFVASIDSSQQYYSLTEEKILPLINHPTVQAGANFGSANNTVAPKQRGLMLKRGQALYVAASGANALTNGFYCNIQGGFY
Ga0181405_103021323300017750SeawaterSAGTFPTDDTFTVQDTANFTATTFDVTVPTIGGGATITGNVDASLPIDFCIYLVNTGTITNINQFFPLFVQSIPQVAENQILSTTLTEKLPLINHPVVQSGAANFAGANNEIAPKQRGLMLKRGQALYVAASGATALTNGFFCNLQGGFY
Ga0181405_113299913300017750SeawaterTGHNLEIGQKVFLDFKTYSSGTVPKDDEFTVLDTVNFTSTTFDVTIPSLGGTITGNVDISLPTDFCFYLVNSGTVTNINQFFPLFVASIDSSQQSYSCTLNEVLPFINHPTVQAGSNFGSANNEIAPKQRGLMLNRGQALYVAASGATALTNGFYCNVQGGFY
Ga0181407_101782813300017753SeawaterDTANFTATTFDVTVPTIGGGATITGNVDASLPIDFCIYLVNTGTITNINQFFPLFVQSIPQVAENQILSTTLTEKLPLINHPVVQSGAANFAGANNEIAPKQRGLMLKRGQALYVAASGATALTNGFFCNLQGGFY
Ga0181411_105092523300017755SeawaterFTSTTFDVTIPSLGGTITGNVDISLPTDFCFYLVNTGTITNINQFFPLFVASIDSSQQSYSCTLNEVLPFINHPTVQAGSNFVTANNEVAPKQRGLMLKRGQALYVAASGATALTNGFYCNIQGGFY
Ga0181411_114528513300017755SeawaterTFPPDDTFTVQDTANFTATTFDVTVPAIGGGATITGNVDASLPVDFCVYLVNTGTITNINQFFPLFVQSIPQVAENQILSTTLTEKLPLINHPVVQSGAANFAGANNEIAPKQRGLMLKRGQALYVAASGATALTNGFFCNLQGGFY
Ga0181410_110546113300017763SeawaterFTSYNSGTVPIDGTFTIVTITPTTFTVTIPSLGGTITGNVDVYDPIDFCFYLVSTGTVTNINQFFPLFVASIESVASKQSCSLTMKEILPLINHPVVQAGSNFGSANNEIAPKQRGLMLKRGQALYVSVSGTAALTNGFYCNIQGGYY
Ga0181385_108668023300017764SeawaterALPIWEKFTATTFDITIPNIPSGTITGNVSISLPVDFCFYLVSTGTITNINQFFPLFTQSIPQVSENQILSTTLTEKLPLINHPVVQSGAANFGASNNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNLQGGFY
Ga0181385_120062423300017764SeawaterTVTLSTGHNLEIGQKVFLDFTSYNSGVVPKDDEFTVLDTVNFTSTTFDVTVPSQSASNGNVNISLPTDFCFYLVNTGTITNINQFFPLFVASVDSSQQSYSCTLNEVLPFINHPTVQAGSNFVTANNEVAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY
Ga0181413_126793613300017765SeawaterATGTVCTVTAVSGHNLEIGQKVFLDFKTYSAGTFPTDDTFTVQDTANFTATTFDVTVPAIGGGATITGNVDASLPIDFCLYLVNTGTITNINQFFPLFVQSIPQVAENQILSTTLTEKLPLINHPVVQSGAANFAGANNEIAPKQRGLMLKRGQALYVAASGATAL
Ga0181406_107354123300017767SeawaterVTITPTTFTVTIPSLGGTITGNVDVYDPIDFCFYLVSTGTVTNINQFFPLFVASIDAVAATQYCSLTLKEVLPLINHPVVQAGSNFGSANNEIAPKQRGLMLKRGQALYVSVSGTAALTNGFYCNIQGGYY
Ga0181425_103315213300017771SeawaterIGQKVFLDFKTYSSGVVPKDDEFTVLDTVNFTSTTFDVTIPSLSGTITGNVDISLPTDFCFYLVNTGTITNINQFFPLFVASIDSSQQSYSCTLNEVLPFINHPTVQAGSNFVSANNEVAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY
Ga0181386_115824613300017773SeawaterTGHNLEIGQKVFLDFKTYSSGVVPKDDEFTVLDTVNFTSTTFDVTIPSLSGTITGNVDISLPTDFCFYLVNTGTITNINQFFPLFVASIDSSQQSYSCTLNEVLPFINHPTVQAGSNFVSANNEVAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY
Ga0181424_1043626813300017786SeawaterSANSTTCTVTLGAGHNLEIGQKVFLDFKTYSSGTVPKDDEFTVLDTVNFTSTTFDVTVPSVGGSAITGNVDISLPTDFCFYLVNTGTITNINQFFPLFVASIDSSQQSYSCTLNEVLPFINHPTVQAGSNFVSANNEVAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY
Ga0211707_104366713300020246MarineFTSTTFDVTIPSLGGTITGNVDISLPTDFCFYLVNTGTVTNINQFFPLFVASVDSSQQSYSLSEQKILPFINHPTVQAGANFGSANNALAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY
Ga0211704_105773523300020257MarineSTGHNLEPGQNVFLDFKTYSSGTVPKDDEFEVLDTVNFTSTTFDVTIPSLGGTITGNVDISLPTDFCFYLVNTGTVTNINQFFPLFVASIDSSQQYYSLTLNEILPLINHPTVQAGSNFGSGNNEIAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY
Ga0211534_102325123300020261MarineVTIANGHNLEIGQNVFLDFSTYSSGTVPKDDTFEVKDTTNFTSTTFDVDIPSLSGPITGNVNASLPTDFCFYLVSTGTVTNVNQFFPLFVASIDSSQQYYSLTLNEILPLINHPTVQAGSNFGSGNNEIAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY
Ga0211526_104855013300020264MarineVTLSGGHNLEIGQKVFLDFLTYNTGVVPKDDTFEVKDTLNFTSTTFDVDVPSQSAANGNVNVSLPVDFCFYLVSTGTITNINQFFPLFTQSIPQVSENQILSTTLTEKLPLINHPTVQSGALNFAGSNNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNIQGGFY
Ga0211634_111836613300020279MarineAAGHNLEIGQNVFLDFSTYSSGTVPKDDTFEVKNTTNFTSTTFDVDVPSVSGTITGNVNISLPTDFCFYLVNTGTITNINQFFPLFVASIDSSQQSYSCTLNEVLPLINHPVVQAGNNFGSANNEVAPKQRGLMLKRGQALYVAASGTTALTTGFYCNVQGGYY
Ga0211672_1023325913300020370MarinePKDDTFTVADTLNFTSTTFDVTIPSQSAANGNVNVSLPIDFCFYLVSTGTITNINQFFPLFTQSIPQVSENQILSTTLTEKLPLINHPTVQSGALNFAGSNNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNLQGGFY
Ga0211500_109312813300020371MarineSATNATCTITVSGGHNLEIGQKLFCDFLTYNSGTVPTDDTFEVIDSSNFTATTFDITIPTIAGGATITGNVALSLPIDFCFYLVSTGTITNINQFFPLFTQSIPQVAENQILSTTLTEKLPLINHPVVQSGAANFGASNNEIAPKQRGLMLRRGQALYVAASGSTALTNGFYCNVQGGFY
Ga0211666_1021312323300020392MarineFTSTTFDVDVPSQSASNGNVNVSLPIDFCFYLVGTGTITNINQFFPLFVQSIPQVSENQILSTTLTEKLPLINHPTVQSGAANFAGSNNEIAPKQRGLMLQRGQALYVAASGATALTNGFYCNVQGGFY
Ga0211497_1036561213300020394MarineKDDTFTVADTVNFTATTFDVTIPSLGGTITGNVAVTLPIDFCFYLVSTGTVTNINQFFPLFTQSIPQVSENQILSTTLTEKLPLINHPTVQSGALNFAGSNNEIAPKQRGLMLRRGQALYVAASGSTALTNGFYCNVQGGFY
Ga0211532_1012786723300020403MarineTFEVKNTTNFTSTTFDVDIPSLGGTITGNVNVSLPTDFCFYLVNTGTVTNINQFFPLFVASIDSSQQSYSLSEQKILPFINHPTVQAGANFGSANNALAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY
Ga0211532_1015263013300020403MarineDTFTVLDTVNFSSTEFDVTIPNIPSGTITGNVNVSLPIDFCFYLVSTGTVTNINQFFPLFTQSIPQVAENQILSTTLTEKLPLINHPVVQSGAANFGASNNEIAPKQRGLMLRRGQALYVAASGSTALTNGFYCNVQGGFY
Ga0211532_1035134923300020403MarineDTFTVLDTVNFSSTEFDVTIPNIPSGTITGNVNVSLPIDFCFYLVSTGTITNINQFFPLFTQSIPQVAENQILSTTLTEKLPLINHPTVQSGALNFAGSNNEIAPKQRGLMLRRGQALYVAASGSTALTNGFYCNVQGGFY
Ga0211659_1039776713300020404MarineSSGHNLEIGQNVFLDFKTYSSGVVPKDDVFEVKDTVNFTSTTFDVDIPSLSGTITGNVDISLPTDFCFYLVNTGTVTNINQFFPLFVASIDCSQQTYSLTLNEILPFINHPTVQAGSNFGSANNEIAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY
Ga0211699_1014482613300020410MarineSTTFDVTIPSQSAANGNVNVSLPVDFCFYLVSTGTITNINQFFPLFTQSIPQVSENQILSTTLTEKLPLINHPTVQSGALNFAGSNNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNLQGGFY
Ga0211699_1043585713300020410MarineLDFTSYSSGTVPKDDTFEVQDTVNFTSTTFDVTVPTVGGSAITGNVNVSLPTDFCFYLVNTGTVTNINQFFPLFVASIDCSQQYYSLTLNEILPLINHPTVQAGSNFISANNEVAPKQRGLMLKRGQALYVAASGANALTNGFYCNVQGGFY
Ga0211581_1016366113300020429MarineGHNLEVGQKVFLDFKTYSAGAFPKDNIFTVQDTLNFSSTSFDVTVPAIGGGATITGNVDISLPIDFCFYLVSTGTVTNINQFFPLFVQSIPQVAENQVISTTLQKTLPLINHPTVQAGANFTGANNEVAPKQRGLMLRRGQALFVAASGATALTNGFFCNVQGGFY
Ga0211565_1016292323300020433MarineEVGQKVFLDFKTYSAGAFPKDNIFTVQDTLNFTSTTFDVTVPAIGGGATITGNVDISLPIDFCFYLVSTGTVTNINQFFPLFVQSIPQVAENQVISTTLQKTLPLINHPTVQAGANFTGANNEVAPKQRGLMLRRGQALFVAASGATALTNGFFCNVQGGFY
Ga0211559_1042424023300020442MarineFTSTTFDVDVPSQSAANGNVNVSLPVDFCFYLVSTGTITNINQFFPLFTQSIPQVSANQILSTTLTEKLPLINHPTVQSGALNFAGSNNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNIQGGFY
Ga0211559_1044028223300020442MarineGHNLEIGQNVFLDFKTYSSGTVPKDDTFTVLDTVNFTSTTFDVTIPSLGGTITGNVDISLPTDFCFYLVNTGTVTNINQFFPLFVASIDCSQQSYSLSEQKILPFINHPTVQAGANFGSANNALAPKQRGLMLKRGQALYVAASGANALTNGFYCNVQGGFY
Ga0211473_1069842813300020451MarineQKVFLDFKTYSSGVVPKDDEFTVLDTVNFTSTTFDVTIPSLSGTITGNVDISLPTDFCFYLVNTGTITNINQFFPLFVASVDSSQQSYSCTLNEVLPFINHPTVQAGANFVTANNEVAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY
Ga0211514_1052626213300020459MarineITAGHTLEVGQSVFLNFTTYSGGAVPIDDAFVVTATTPTTFTCTIPSLSGPITGNVDVYLPTDFCFYLVSAGTLTNINQFFPLFVASIDSVSTTQECSLTLKEILPLINHPVVQAGSNFGSANNEVAPKQRGLMLKRGQALYVSVSGTSALTNGFYCNIQGGFY
Ga0211547_1033571313300020474MarineDTVNFTSTTFDVTVPSQSASNGNVNISLPTDFCFYLVNTGTITNINQFFPLFVASVDSSQQSYSCTLNEVLPFINHPTVQAGANFVTANNEVAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY
Ga0211547_1049750913300020474MarineSATGAVCTVTAAGGHNLEIGQKVFLDFKTYSAGTFPTDDTFTVQDTANFTATTFDVTVPAIGGGATITGNVDASLPIDFCVYLVNTGTITNINQFFPLFVQSIPQVAENQILSTTLTEKLPLINHPVVQSGAANFAGANNEIAPKQRGLMLKRGQALYVAASGATALTNGFFCNLQGGFY
Ga0211547_1059043023300020474MarineDTFTVADTLNFTSTTFDVTIPSQSAANGNVNVSLPVDFCFYLVSTGTITNINQFFPLFTQSIPQVSENQILSTTLTEKLPLINHPTVQSGALNFAGSNNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNLQGGFY
Ga0211541_1026644823300020475MarineQKVFLNFKTYSAGTFPTDDTFTVQDTANFTATTFDVTVPTIGGGATITGNVDASLPIDFCVYLVNTGTITNINQFFPLFVQSIPQVAENQILSTTLTEKLPLINHPVVQSGAANFAGANNEIAPKQRGLMLKRGQALYVAASGATALTNGFFCNLQGGFY
Ga0224716_104913623300021539Stylissa Sp.VKDTLNFTSTTFDVDVPSQSAANGNANVSLPVDFCFYLVSTGTITNINQFFPLFTQSIPQVSENQILSTTLTEKLPLINHPTVQSGALNFAGANNETAPKQRGLMLRRGQALYVAASGATALTNGFYCNIQGGFY
Ga0208434_104256213300025098MarineVFLNFTSYNSGTVPIDGKFTVLTITPTTFTATIPNIPSGTITGNVDVSVPIDFCFYLVSTGTVTNINQFFPLFVASIESVASKQSCSLTMKEILPLINHPTVQSGAANWGSANNEIAPKQRGLMLKRGQALYVSASGTAALTNGFYCNVQGGYY
Ga0208159_109174223300025101MarineSAGTFPTDDTFTVQDTANFTPTTFDVTVPAIGGGATITGNVDASLPIDFCIYLVNTGTITNINQFFPLFVQSIPQVAENQILSTTLTEKLPLINHPVVQSGAANFAGANNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNLQGGFY
Ga0208158_112419323300025110MarineGVVPIDDKFTVTAATSTTFTCTIPSVGGTITGNVNVYLPTDFAFYLVNAGTVTNINQFFPLFVASIPSTFAHQNYSLTLNEILPFINHPTVQAGSNFTSANNEVAPKHRGLMLKRGQALYVSASGATALTNGFYCNIQGGYY
Ga0208790_103236913300025118MarineSYNTGAVPIDGTFTVVTITPTTFTVTIPNIASGTITGNVDIYDPIDFCFYLVSTGTVTNINQFFPLFVASIDAVSAKQYCSLTLKEILPLINHPVVQAGSNFGSANNEIAPKQRGLMLKRGQALYVSVSGTAALTNGFYCNIQGGYY
Ga0209348_1003764103300025127MarineTCTVTLSSGHNLEIGQNVFLDFKTYSSGTVPKDDTFTVLDTVNFTSTTFDVTIPSLGGTITGNVDISLPTDFCFYLVNTGTVTNVNQFFPLFVASIDSSQQSYSLTLNEILPFINHPTVQAGANFASANNEVAPKQRGLMLKRGQALYVAASGATALTNGFFCNVQGGFY
Ga0209348_100572013300025127MarineTDDTFTVIDSSNFTATKFDVTIPTIGGGATITGNVAISLPIDFCFYLVSTGTITNINQFFPLFTQSIPQVSENQILSTTLTEKLPLINHPVVQSGAANFGASNNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNVQGGFY
Ga0209348_102356613300025127MarineTTCTVTISGGHNVEIGQKVFLDFASYSSGTVPKDDTFEVKNTTNYTSTTFDVDIPSLSGTITGNVNVTLPTDFCFYLVNTGTVTNVNQFFPLFVASVDSSQQSYSLTLNEILPLINHPTVQAGSNFVSANNEVAPKQRGLMLKRGQALYAAASGATALTNGFYCNIQGGFY
Ga0209348_103284323300025127MarineSTTCTVTLSGGHNLEIGQKVFLDFLTYSSGVVPKDDTFTVADTVNFTATTFDVTIPSLGGTITGNVNVTLPIDFCFYLVSTGTITNINQFFPLFTQSIPQVSENQILSTTLTEKLPLINHPTVQSGALNFAGSNNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNIQGGFY
Ga0209348_106029013300025127MarineDTTFDVTIPSLGGTITGNVNVSLPIDFCFYLVSTGTITNINQFFPLFTQSIPQVSENQILSTTLTEKLPLINHPTVQSGALNFAGSNNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNVQGGFY
Ga0209348_109139913300025127MarineTVTGGHNLQVGQKVNIDFTTYSSGAVPVDNTFEVLDTANLTSTTFDVTIPNIASGTITGAVNLSLPTDFCFYLVSTGTVTNINQFFPLFVASIDSSEQYYSLTESKILPFINHPTVQAGSNFGAANNSIAPKQRGLMLRRGQALYVAASGATALTNGFFCNVQGGFY
Ga0209348_113867913300025127MarineTYNTGVVPKDDTFEVKDTLNFTSTTFDVDVPSQSAANGNVNVSLPIDFCFYLVSTGTITNINQFFPLFTQSIPQVSENQILSTTLTEKLPLINHPTVQSGALNFAGSNNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNVQGGFY
Ga0209348_115700323300025127MarineSANSTTCTVTLSSGHNLEIGQNVFLDFKTYSSGTVPKDDVFEVKDTVNFTSTTFDVDIPSLGGTITGNVDISLPTDFCFYLVNTGTVTNINQFFPLFVASIDCSQQSYSLSEQKILPFINHPTVQAGANFGSANNALAPKQRGLMLKRGQALYVAASGANALTNGFYCNVQGGFY
Ga0209348_117161813300025127MarineGQNVFLDFKTYSSGTVPKDDTFTVLDTVNFTSTTFDVTIPSVGGTITGNVDISLPTDFCFYLVNTGTVTNINQFFPLFVASIDCSQQSYSLSEQKILPFINHPTVQAGANFGSANNALAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY
Ga0209348_117176623300025127MarineTCTVTLSSGHNLEIGQNVFLDFKTYSSGTVPKDDTFTVLDTVNFTSTTFDVTIPSVGGTITGNVDISLPTDFCFYLVNTGTVTNINQFFPLFVASIDCSQQSYSLSEQKILPFINHPTVQAGANFGSANNALAPKQRGLMLKRGQALYVAASGANALTNGFYCNVQGGFY
Ga0209348_117449013300025127MarineTYSANSTTCTVTLSGGHNLEIGQKVFLDFLTYNSGVVPKDDTFTVADTLNFTSTTFDVTIPSQSAANGNVNVSLPVDFCFYLVSTGTITNINQFFPLFTQSIPQVSENQILSTTLTEKLPLINHPTVQSGALNFAGSNNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNLQGGFY
Ga0209348_120279013300025127MarineYSSGTVPKDDVFEVKDTVNFTSTTFDVDIPSLGGTITGNVDISLPTDFCFYLVNTGTVTNINQFFPLFVASIDCSQQSYSLSEQKILPFINHPTVQAGSNFGSANNSFAPKQRGLMLKRGQALYVAASGANALTNGFYCNVQGGFY
Ga0209348_121236313300025127MarineLEPGQNVFLDFKTYSSGTVPKDDTFEVLDTVNFTSTTFDVTIPSLGGTITGNVDISLPTDFCFYLVNTGTVTNINQFFPLFVASVDCSQQSYSLSEQKILPFINHPTVQAGANFGSANNALAPKQRGLMLKRGQALYVAASGANALTNGFYCNVQGGFY
Ga0208919_117293523300025128MarineTAPTGTYSANSTTCTVTLSSGHNLEIGQNVFLDFKTYSSGTVPKDDVFEVKDTVNFTSTTFDVDIPSLGGTITGNVDISLPTDFCFYLVNTGTVTNINQFFPLFVASIDCSQQSYSLSEQKILPFINHPTVQAGANFGSANNALAPKQRGLMLKRGQALYVAASGANALTNGFYCNVQGGFY
Ga0209232_102243413300025132MarineDTFEVKDTLNFTSTTFDVDVPSQSASNGNVNVSLPIDFCFYLVSTGTITNINQFFPLFTQSIPQVSENQILSTTLTEKLPLINHPTVQSGALNFAGSNNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNIQGGFY
Ga0209232_104380713300025132MarineVTVSGGHNLEIGQKVFLDFLTYNTGSVPKDDTFTVADTLNFTSTTFDVTVPSQSASNGNVAVSLPIDFCFYLVSTGTITNINQFFPLFTQSIPQVAENQILSTTLTEKLPLINHPVVQSGALNFAGANNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNVQGGFY
Ga0209232_104799813300025132MarineDTFEVKDTLNFTSTTFDVDVPSQSASNGNVNVSLPIDFCFYLVSTGTITNINQFFPLFTQSIPQVSENQILSTTLTEKLPLINHPTVQSGALNFAGSNNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNVQGGFY
Ga0209232_125744813300025132MarineGQAVFLNFTSYNSGAVPIDGTFTIVTITPTTFTVTIPNIASGTITGNVDVYDPIDFCFYLVNTGTVTNINQFFPLFVASIDAVAATQYCSLTLKEILPLINHPVVQAGSNFGSANNEIAPKQRGLMLKRGQALYVSVSGTAALTNGFYCNIQGGYY
Ga0209645_109448113300025151MarineGQNVFLDFKTYSSGTVPKDDTFEVLDSVNFTSTTFDVTIPSLGGTITGNVDISLPTDFCFYLVNTGTVTNINQFFPLFVASVDSSQQSYSLSEQKILPFINHPTVQAGANFGSANNALAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY
Ga0209645_116011723300025151MarineVPKDDEFTVLDTVNFTSTTFDVTIPSLGGTITGNVDISLPTDFCFYLVNTGTITNINQFFPLFVASIDSSQQYYSLTLNEILPLINHPTVQAGSNFGSANNEIAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY
Ga0209645_118345823300025151MarineGHNLEIGQNVFLDFKTYSSGTVPKDDTFTVLDTVNFTSTTFDVTVPSVGGSAITGNVDISLPTDFCFYLVNTGTITNINQFFPLFVASIDCSQQSYSLSEQKILPFINHPTVQAGSNFGSANNAFAPKQRGLMLKRGQALYVAASGANALTNGFYCNVQGGFY
Ga0209645_118544123300025151MarineNTGTVPKDDEFTVLDTVNFTSTTFDVTVPSQSASNGNVNISLPVDFCFYLVNTGTITNINQFFPLFVASIDSSQQSYSLTLNEVLPLINHPTVQAGSNFVTANNEVAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY
Ga0209645_119105023300025151MarineEIGQNVFLDFKTYSSGTVPKDDTFEVQDTVNFTSTTFDVTVPSVGGSAITGNVDISLPTDFCFYLVNTGTVTNINQFFPLFVASIDSSQQSYSLSEQKILPFINHPTVQAGANFGSANNALAPKQRGLMLKRGQALYVAASGANALTNGFYCNVQGGFY
Ga0209645_121484923300025151MarineGTVPKDDTFTVLDTVNFTSTTFDVTIPSLGGTITGNVDISLPTDFCFYLVNTGTVTNVNQFFPLFVASIDSSQQSYSLTLNEILPFINHPTVQAGANFASANNEVAPKQRGLMLKRGQALYVAASGATALTNGFFCNVQGGFY
Ga0209433_1019834223300027774MarineDNIFTVQDTLNFSSTSFDVTVPAIGGGATITGNVDISLPIDFCFYLVSTGTVTNINQFFPLFVQSIPQVAENQVISTTLQKTLPLINHPTVQAGANFTGANNEVAPKQRGLMLRRGQALFVAASGATALTNGFFCNVQGGFY
Ga0209404_1041087613300027906MarineAAGHNVKKGHEVWLDFTTYSSGTVPVDGEFTALVTGHTATTFDVTIPSLGGTITGNVSVYLPTDFCFYLVGTGTVTNINQFFPLFVANLPSTPTYENCSLSMKGVLPFINHPSVQAGANVTSANSNVSPKNRGLMLKRGQALYCATSGSTALTNGFYCNVQGGFY
Ga0256382_108945923300028022SeawaterPTDDTFTVQDTANFTATTFDVTVPAIGGGATITGNVDASLPIDFCVYLVNTGTITNINQFFPLFVQSIPQVAENQILSTTLTEKLPLINHPVVQSGAANFAGANNEIAPKQRGLMLKRGQALYVAASGATALTNGFFCNLQGGFY
Ga0135227_104162813300029302Marine HarborFPSHDHTATTFDVTIPSLGGTITGNVAVTLPIDFCFYLVSTGTVTNINQFFPLFTQSIPQVSENQILSTTLTEKLPLINHPTVQSGALNFAGSNNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNIQGGFY
Ga0183748_102426233300029319MarineDFKTYSSGTVPKDDTFTVLDTVNFTSTTFDVTIPSVGGTITGNVDISLPTDFCFYLVNTGTITNINQFFPLFVASIDCSQQSYSLSEQKILPFINHPTVQAGSNFGSANNALAPKQRGLMLKRGQALYVAASGANALTNGFYCNVQGGFY
Ga0183748_104280223300029319MarineGHNLEIGQNVFLDFKTYSSGTVPKDDTFEVQDTVNFTSTTFDVTVPSVGGSAITGNVDLSLPTDFCFYLVNTGTVTNINQFFPLFVASIDCSQQSYSLSEQKILPFINHPTVQAGTNFGSANNAFAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY
Ga0183748_112567413300029319MarineQNVFLDFKTYSSGTVPKDDTFTVLDTVNFTSTTFDVTIPSVGGTITGNVDISLPTDFCFYLVNTGTVTNINQFFPLFVASIDCSQQSYSLSEQKILPFINHPTVQAGANFGSANNALAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY
Ga0183826_101335413300029792MarineQGTYSATGTVCTVTLSGGHNLEIGQKVFLDFLTYNTGVVPKDDTFEVQDTLNFTSTTFDVTVPSQSASNGNVNVSLPIDFCFYLVSTGTITNINQFFPLFTQSIPQVSENQILSTTLTEKLPLINHPTVQSGALNFAGSNNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNIQGGF
Ga0183826_105421613300029792MarineSVSAPTGTYSANSTTCTVTLPAGHNLEIGQNVFLDFKTYSSGVVPKDDTFEVQDTVNFTSTTFDVTIPSLGGTITGNVDISLPTDFCFYLVNTGTVTNINQFFPLFVASVDCSQQYYSLTLNEILPLINHPTVQAGSNFISANNEVAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY
Ga0315331_1107105513300031774SeawaterTVVSVTATTFVVTIPSQGAITGNVTVYQPTLFCFYLVSTGTVTNTNQFFPLFNASIDSVASKQVFSLTLNEILPLINHPVVQAGTNFTSANNEVAPKQRGLMLKRGQALYVAASGATALTTGFYCNIQGGFY
Ga0315326_1069250813300031775SeawaterVGQEVFLNFTSYNSGTVPIDGKFTVLTITPTTFTATIPNIPSGTITGNVDVSVPIDFCFYLVSTGTVTNINQFFPLFVASIESVASKQSCSLTMKEILPLINHPTVQSGAANWGSANNEIAPKQRGLMLKRGQALYVSASGTAALTNGFYCNVQGGYY
Ga0310343_1039665123300031785SeawaterDTLNFTSTTFDVTIPSQSAANGNVNVSLPVDFCFYLVSTGTITNINQFFPLFTQSIPQVSENQILSTTLTEKLPLINHPTVQSGALNFAGSNNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNLQGGFY
Ga0310343_1138299623300031785SeawaterKTYSSGTVPKDDEFEVLDTVNFTSTTFDVTIPSLSGTITGNVDISLPTDFCFYLVNTGTITNINQFFPLFVASIDSSQQSYSLTLNEILPLINHPTVQAGSNFGSANNEIAPKQRGLMLKRGQALYVAASGANALTNGFYCNVQGGFY
Ga0315316_1095212923300032011SeawaterTITPTTFTATIPNIPSGTITGNVDVSVPIDFCFYLVSTGTVTNINQFFPLFVASIESVASKQSCSLTMKEILPLINHPTVQSGAANWGSANNEIAPKQRGLMLKRGQALYVSASGTAALTNGFYCNVQGGYY
Ga0315316_1119470113300032011SeawaterVPIDGTFTIVTITPTTFTVTIPNIASGTITGNVDVYDPIDFCFYLVSTGTVTNINQFFPLFVASIDAVAATQYCSLTLKEILPLINHPVVQAGSNFGSANNEIAPKQRGLMLKRGQALYVSVSGTAALTNGFYCNIQGGYY
Ga0315315_1041348723300032073SeawaterTATTFDITIPNIPSGTITGNVSISLPVDFCFYLVSTGTITNINQFFPLFTQSIPQVSENQILSTTLTEKLPLINHPVVQSGAANFGASNNEIAPKQRGLMLRRGQALYVAASGATALTNGFYCNVQGGFY

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.