| Basic Information | |
|---|---|
| Family ID | F057661 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 136 |
| Average Sequence Length | 43 residues |
| Representative Sequence | PAGPGINISKILLSIYDIDYYSQKKTTFIISERQYVSFFIVIYT |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 136 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.44 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (61.765 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (19.118 % of family members) |
| Environment Ontology (ENVO) | Unclassified (73.529 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (83.088 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 136 Family Scaffolds |
|---|---|---|
| PF02082 | Rrf2 | 84.56 |
| PF01458 | SUFBD | 12.50 |
| PF00005 | ABC_tran | 2.21 |
| PF09493 | DUF2389 | 0.74 |
| COG ID | Name | Functional Category | % Frequency in 136 Family Scaffolds |
|---|---|---|---|
| COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 84.56 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 84.56 |
| COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 84.56 |
| COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 84.56 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 84.56 |
| COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 84.56 |
| COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 84.56 |
| COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 84.56 |
| COG0719 | Fe-S cluster assembly scaffold protein SufB | Posttranslational modification, protein turnover, chaperones [O] | 12.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 61.76 % |
| Unclassified | root | N/A | 38.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559013|NCBI_BBAY_READ_1106105105549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 987 | Open in IMG/M |
| 3300000148|SI47jul10_100mDRAFT_c1008721 | Not Available | 2120 | Open in IMG/M |
| 3300000153|SI39nov09_135mDRAFT_c1008702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2545 | Open in IMG/M |
| 3300000167|SI39nov09_120mDRAFT_c1025793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1471 | Open in IMG/M |
| 3300000167|SI39nov09_120mDRAFT_c1033473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1193 | Open in IMG/M |
| 3300000167|SI39nov09_120mDRAFT_c1085152 | Not Available | 554 | Open in IMG/M |
| 3300000192|SI60aug11_100mDRAFT_c1008778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2554 | Open in IMG/M |
| 3300000192|SI60aug11_100mDRAFT_c1070530 | Not Available | 523 | Open in IMG/M |
| 3300000193|SI47jul10_135mDRAFT_c1010031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2549 | Open in IMG/M |
| 3300000224|SI34jun09_10mDRAFT_1025439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 919 | Open in IMG/M |
| 3300000225|SI34jun09_120mDRAFT_1021095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1780 | Open in IMG/M |
| 3300000237|SI34jun09_150mDRAFT_1005611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1888 | Open in IMG/M |
| 3300000265|LP_A_09_P04_10DRAFT_1056655 | Not Available | 574 | Open in IMG/M |
| 3300000324|SI48aug10_100mDRAFT_1055115 | Not Available | 598 | Open in IMG/M |
| 3300001353|JGI20159J14440_10075226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1150 | Open in IMG/M |
| 3300001353|JGI20159J14440_10101623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 909 | Open in IMG/M |
| 3300001353|JGI20159J14440_10189742 | Not Available | 571 | Open in IMG/M |
| 3300001354|JGI20155J14468_10076651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1264 | Open in IMG/M |
| 3300001354|JGI20155J14468_10132092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 824 | Open in IMG/M |
| 3300001954|GOS2235_1046488 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1634 | Open in IMG/M |
| 3300003477|nap3_10102303 | Not Available | 679 | Open in IMG/M |
| 3300003588|JGI26247J51722_1049638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 825 | Open in IMG/M |
| 3300004276|Ga0066610_10150749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 775 | Open in IMG/M |
| 3300005404|Ga0066856_10317955 | Not Available | 670 | Open in IMG/M |
| 3300005514|Ga0066866_10193007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 716 | Open in IMG/M |
| 3300005521|Ga0066862_10072779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1189 | Open in IMG/M |
| 3300006026|Ga0075478_10047991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1401 | Open in IMG/M |
| 3300006166|Ga0066836_10596807 | Not Available | 668 | Open in IMG/M |
| 3300006191|Ga0075447_10190091 | Not Available | 678 | Open in IMG/M |
| 3300006191|Ga0075447_10217348 | Not Available | 625 | Open in IMG/M |
| 3300006193|Ga0075445_10195479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 708 | Open in IMG/M |
| 3300006345|Ga0099693_1088155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 1597 | Open in IMG/M |
| 3300006947|Ga0075444_10187721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 843 | Open in IMG/M |
| 3300007623|Ga0102948_1142887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 731 | Open in IMG/M |
| 3300008950|Ga0102891_1185874 | Not Available | 608 | Open in IMG/M |
| 3300009049|Ga0102911_1029048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1644 | Open in IMG/M |
| 3300009071|Ga0115566_10635484 | Not Available | 595 | Open in IMG/M |
| 3300009071|Ga0115566_10737507 | Not Available | 544 | Open in IMG/M |
| 3300009077|Ga0115552_1308062 | Not Available | 632 | Open in IMG/M |
| 3300009086|Ga0102812_10759045 | Not Available | 536 | Open in IMG/M |
| 3300009172|Ga0114995_10610578 | Not Available | 596 | Open in IMG/M |
| 3300009173|Ga0114996_10468128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 955 | Open in IMG/M |
| 3300009420|Ga0114994_10169552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1476 | Open in IMG/M |
| 3300009420|Ga0114994_10950541 | Not Available | 556 | Open in IMG/M |
| 3300009422|Ga0114998_10202939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 942 | Open in IMG/M |
| 3300009425|Ga0114997_10297215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 895 | Open in IMG/M |
| 3300009425|Ga0114997_10408375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 733 | Open in IMG/M |
| 3300009425|Ga0114997_10590626 | Not Available | 586 | Open in IMG/M |
| 3300009443|Ga0115557_1043784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2054 | Open in IMG/M |
| 3300009481|Ga0114932_10918510 | Not Available | 504 | Open in IMG/M |
| 3300009495|Ga0115571_1233071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 744 | Open in IMG/M |
| 3300009497|Ga0115569_10267762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 763 | Open in IMG/M |
| 3300009508|Ga0115567_10229656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1187 | Open in IMG/M |
| 3300009512|Ga0115003_10071165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2172 | Open in IMG/M |
| 3300009526|Ga0115004_10030982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3575 | Open in IMG/M |
| 3300009526|Ga0115004_10715927 | Not Available | 594 | Open in IMG/M |
| 3300009705|Ga0115000_10715980 | Not Available | 617 | Open in IMG/M |
| 3300009705|Ga0115000_10993554 | Not Available | 511 | Open in IMG/M |
| 3300009785|Ga0115001_10288350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1043 | Open in IMG/M |
| 3300009785|Ga0115001_10409966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 846 | Open in IMG/M |
| 3300012928|Ga0163110_10671399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 806 | Open in IMG/M |
| 3300016745|Ga0182093_1072875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 814 | Open in IMG/M |
| 3300017724|Ga0181388_1052701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 981 | Open in IMG/M |
| 3300017735|Ga0181431_1108796 | Not Available | 620 | Open in IMG/M |
| 3300017741|Ga0181421_1033761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1380 | Open in IMG/M |
| 3300017743|Ga0181402_1069053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 935 | Open in IMG/M |
| 3300017769|Ga0187221_1241983 | Not Available | 512 | Open in IMG/M |
| 3300017964|Ga0181589_10365346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 958 | Open in IMG/M |
| 3300018420|Ga0181563_10610079 | Not Available | 606 | Open in IMG/M |
| 3300019459|Ga0181562_10536401 | Not Available | 553 | Open in IMG/M |
| 3300019708|Ga0194016_1002547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1727 | Open in IMG/M |
| 3300019765|Ga0194024_1017740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1509 | Open in IMG/M |
| 3300020317|Ga0211688_1071642 | Not Available | 668 | Open in IMG/M |
| 3300020372|Ga0211683_10064013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1201 | Open in IMG/M |
| 3300020372|Ga0211683_10164860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 710 | Open in IMG/M |
| 3300020376|Ga0211682_10248196 | Not Available | 680 | Open in IMG/M |
| 3300020379|Ga0211652_10172380 | Not Available | 659 | Open in IMG/M |
| 3300020385|Ga0211677_10256642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 709 | Open in IMG/M |
| 3300020388|Ga0211678_10134699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1070 | Open in IMG/M |
| 3300020396|Ga0211687_10341358 | Not Available | 585 | Open in IMG/M |
| 3300021185|Ga0206682_10165050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1033 | Open in IMG/M |
| 3300021368|Ga0213860_10504608 | Not Available | 517 | Open in IMG/M |
| 3300021375|Ga0213869_10402748 | Not Available | 559 | Open in IMG/M |
| 3300021959|Ga0222716_10455744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 729 | Open in IMG/M |
| 3300022907|Ga0255775_1038577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2510 | Open in IMG/M |
| 3300022907|Ga0255775_1054050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1975 | Open in IMG/M |
| (restricted) 3300022920|Ga0233426_10024728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3209 | Open in IMG/M |
| (restricted) 3300022920|Ga0233426_10060800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1769 | Open in IMG/M |
| (restricted) 3300022920|Ga0233426_10201482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 816 | Open in IMG/M |
| (restricted) 3300023109|Ga0233432_10220100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 931 | Open in IMG/M |
| 3300023180|Ga0255768_10112704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1795 | Open in IMG/M |
| 3300024185|Ga0228669_1032103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1148 | Open in IMG/M |
| 3300024188|Ga0228602_1007482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1255 | Open in IMG/M |
| 3300024231|Ga0233399_1035995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1385 | Open in IMG/M |
| 3300024236|Ga0228655_1090603 | Not Available | 658 | Open in IMG/M |
| (restricted) 3300024299|Ga0233448_1154252 | Not Available | 590 | Open in IMG/M |
| 3300024301|Ga0233451_10216815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 800 | Open in IMG/M |
| 3300024314|Ga0228657_1040438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1031 | Open in IMG/M |
| 3300024346|Ga0244775_11153646 | Not Available | 606 | Open in IMG/M |
| 3300024413|Ga0233393_1035393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1233 | Open in IMG/M |
| 3300024508|Ga0228663_1101348 | Not Available | 521 | Open in IMG/M |
| 3300025425|Ga0208646_1067503 | Not Available | 613 | Open in IMG/M |
| 3300025658|Ga0209659_1054070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1459 | Open in IMG/M |
| 3300025662|Ga0209664_1113295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 768 | Open in IMG/M |
| 3300025666|Ga0209601_1119638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 762 | Open in IMG/M |
| 3300025681|Ga0209263_1028121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2056 | Open in IMG/M |
| 3300025695|Ga0209653_1143256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 712 | Open in IMG/M |
| 3300025707|Ga0209667_1191041 | Not Available | 580 | Open in IMG/M |
| 3300025722|Ga0209660_1167312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 720 | Open in IMG/M |
| 3300025822|Ga0209714_1144883 | Not Available | 611 | Open in IMG/M |
| 3300026517|Ga0228607_1024173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1540 | Open in IMG/M |
| 3300026517|Ga0228607_1084483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 800 | Open in IMG/M |
| 3300027251|Ga0208809_1019546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1280 | Open in IMG/M |
| 3300027779|Ga0209709_10240764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 810 | Open in IMG/M |
| 3300027779|Ga0209709_10321235 | Not Available | 649 | Open in IMG/M |
| 3300027779|Ga0209709_10332982 | Not Available | 631 | Open in IMG/M |
| 3300027779|Ga0209709_10422551 | Not Available | 519 | Open in IMG/M |
| 3300027779|Ga0209709_10426784 | Not Available | 515 | Open in IMG/M |
| 3300027788|Ga0209711_10260418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 768 | Open in IMG/M |
| 3300028194|Ga0257106_1021794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2562 | Open in IMG/M |
| 3300028273|Ga0228640_1115373 | Not Available | 517 | Open in IMG/M |
| 3300028297|Ga0228617_1056068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1088 | Open in IMG/M |
| 3300028414|Ga0228627_1021142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2077 | Open in IMG/M |
| 3300028419|Ga0228625_1082753 | Not Available | 659 | Open in IMG/M |
| 3300031510|Ga0308010_1132667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 942 | Open in IMG/M |
| 3300031612|Ga0308009_10377401 | Not Available | 518 | Open in IMG/M |
| 3300031625|Ga0302135_10008064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 6006 | Open in IMG/M |
| 3300031630|Ga0308004_10297453 | Not Available | 625 | Open in IMG/M |
| 3300031656|Ga0308005_10182436 | Not Available | 561 | Open in IMG/M |
| 3300031659|Ga0307986_10415261 | Not Available | 534 | Open in IMG/M |
| 3300031695|Ga0308016_10259493 | Not Available | 650 | Open in IMG/M |
| 3300031757|Ga0315328_10408855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 787 | Open in IMG/M |
| 3300031774|Ga0315331_10644576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 754 | Open in IMG/M |
| 3300032011|Ga0315316_11557360 | Not Available | 518 | Open in IMG/M |
| 3300032047|Ga0315330_10361707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 902 | Open in IMG/M |
| 3300032088|Ga0315321_10381489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 879 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 19.12% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 13.97% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 11.03% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 10.29% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 6.62% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 5.88% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 4.41% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.41% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 3.68% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 3.68% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 3.68% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.94% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 1.47% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.74% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.74% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.74% |
| Environmental And Host-Associated | Environmental → Aquatic → Marine → Oceanic → Unclassified → Environmental And Host-Associated | 0.74% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.74% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.74% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.74% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.74% |
| Estuarine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine | 0.74% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.74% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.74% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.74% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559013 | Marine microbial communities from the Atlantic Ocean, for comparison studies - Ocean1 (Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY01 3688) | Environmental | Open in IMG/M |
| 3300000148 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 47 07/07/10 100m | Environmental | Open in IMG/M |
| 3300000153 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 135m | Environmental | Open in IMG/M |
| 3300000167 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 120m | Environmental | Open in IMG/M |
| 3300000192 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 60 08/10/11 100m | Environmental | Open in IMG/M |
| 3300000193 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 47 07/07/10 135m | Environmental | Open in IMG/M |
| 3300000224 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 10m | Environmental | Open in IMG/M |
| 3300000225 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 120m | Environmental | Open in IMG/M |
| 3300000237 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 150m | Environmental | Open in IMG/M |
| 3300000265 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_10 | Environmental | Open in IMG/M |
| 3300000324 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 48 08/11/10 100m | Environmental | Open in IMG/M |
| 3300001353 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 | Environmental | Open in IMG/M |
| 3300001354 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 | Environmental | Open in IMG/M |
| 3300001954 | Marine microbial communities from Colon, Panama - GS019 | Environmental | Open in IMG/M |
| 3300003477 | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 3 | Environmental | Open in IMG/M |
| 3300003588 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_100m_DNA | Environmental | Open in IMG/M |
| 3300004276 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_165m | Environmental | Open in IMG/M |
| 3300005404 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 | Environmental | Open in IMG/M |
| 3300005514 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263 | Environmental | Open in IMG/M |
| 3300005521 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255 | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
| 3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
| 3300006345 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0075m | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007623 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG | Environmental | Open in IMG/M |
| 3300008950 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 | Environmental | Open in IMG/M |
| 3300009049 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009443 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009497 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300016745 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041411BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017964 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019708 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_2-3_MG | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300020317 | Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555998-ERR599027) | Environmental | Open in IMG/M |
| 3300020372 | Marine microbial communities from Tara Oceans - TARA_B100000787 (ERX556133-ERR599090) | Environmental | Open in IMG/M |
| 3300020376 | Marine microbial communities from Tara Oceans - TARA_B100000795 (ERX555997-ERR599121) | Environmental | Open in IMG/M |
| 3300020379 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168) | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
| 3300020396 | Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122) | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022907 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG | Environmental | Open in IMG/M |
| 3300022920 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MG | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300023180 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG | Environmental | Open in IMG/M |
| 3300024185 | Seawater microbial communities from Monterey Bay, California, United States - 84D | Environmental | Open in IMG/M |
| 3300024188 | Seawater microbial communities from Monterey Bay, California, United States - 2D | Environmental | Open in IMG/M |
| 3300024231 | Seawater microbial communities from Monterey Bay, California, United States - 43D | Environmental | Open in IMG/M |
| 3300024236 | Seawater microbial communities from Monterey Bay, California, United States - 67D | Environmental | Open in IMG/M |
| 3300024299 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_150_MG | Environmental | Open in IMG/M |
| 3300024301 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504CT (spades assembly) | Environmental | Open in IMG/M |
| 3300024314 | Seawater microbial communities from Monterey Bay, California, United States - 70D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024413 | Seawater microbial communities from Monterey Bay, California, United States - 21D | Environmental | Open in IMG/M |
| 3300024508 | Seawater microbial communities from Monterey Bay, California, United States - 77D | Environmental | Open in IMG/M |
| 3300025425 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8 (SPAdes) | Environmental | Open in IMG/M |
| 3300025658 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_10m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025662 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_150m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025666 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 (SPAdes) | Environmental | Open in IMG/M |
| 3300025681 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_100m (SPAdes) | Environmental | Open in IMG/M |
| 3300025695 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025707 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_165m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025722 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025822 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 (SPAdes) | Environmental | Open in IMG/M |
| 3300026517 | Seawater microbial communities from Monterey Bay, California, United States - 8D | Environmental | Open in IMG/M |
| 3300027251 | Estuarine microbial communities from the Columbia River estuary - metaG 1556B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
| 3300028273 | Seawater microbial communities from Monterey Bay, California, United States - 51D | Environmental | Open in IMG/M |
| 3300028297 | Seawater microbial communities from Monterey Bay, California, United States - 18D | Environmental | Open in IMG/M |
| 3300028414 | Seawater microbial communities from Monterey Bay, California, United States - 33D | Environmental | Open in IMG/M |
| 3300028419 | Seawater microbial communities from Monterey Bay, California, United States - 30D | Environmental | Open in IMG/M |
| 3300031510 | Marine microbial communities from water near the shore, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
| 3300031612 | Marine microbial communities from water near the shore, Antarctic Ocean - #127 | Environmental | Open in IMG/M |
| 3300031625 | Marine microbial communities from Western Arctic Ocean, Canada - CBN3_surface | Environmental | Open in IMG/M |
| 3300031630 | Marine microbial communities from water near the shore, Antarctic Ocean - #38 | Environmental | Open in IMG/M |
| 3300031656 | Marine microbial communities from water near the shore, Antarctic Ocean - #67 | Environmental | Open in IMG/M |
| 3300031659 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 | Environmental | Open in IMG/M |
| 3300031695 | Marine microbial communities from water near the shore, Antarctic Ocean - #233 | Environmental | Open in IMG/M |
| 3300031757 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315 | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
| 3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ocean1-_00051050 | 2166559013 | Environmental And Host-Associated | YREQLVRENISKILLSIYDIDYYSQKKTTFIISERQYVSFFIAIYT |
| SI47jul10_100mDRAFT_10087214 | 3300000148 | Marine | ISKILLSICDIDYYSQKKTTFIISERQYVSFFIINYT* |
| SI39nov09_135mDRAFT_10087024 | 3300000153 | Marine | ILLSICDIDYYSQKKTTFIISERQYVSFFIINYT* |
| SI39nov09_120mDRAFT_10257931 | 3300000167 | Marine | KILLSICDIDYYSQKKTTFIISERQYVSFFIINYT* |
| SI39nov09_120mDRAFT_10334731 | 3300000167 | Marine | GPGINISKILLSICDIDYYSQKKTTFIISERQYVSFFKIIYT* |
| SI39nov09_120mDRAFT_10851522 | 3300000167 | Marine | NTSTILLSISVIDYYSQKKITFIITERQYVNFFN* |
| SI60aug11_100mDRAFT_10087784 | 3300000192 | Marine | NISKILLSICDIDYYSQKKTTFIISERQYVSFFIINYT* |
| SI60aug11_100mDRAFT_10705301 | 3300000192 | Marine | PGINISKILLSICDIDYYSQKKTTFIISERQYVSFFKIIYT* |
| SI47jul10_135mDRAFT_10100314 | 3300000193 | Marine | NISKILLSICDIDYYSQKKTTFIISERQYVSFFKIIYT* |
| SI34jun09_10mDRAFT_10254391 | 3300000224 | Marine | SSLPAGPGINTSTILLSISVIDYYSQKKITFIITERQYVNFFN* |
| SI34jun09_120mDRAFT_10210953 | 3300000225 | Marine | GPGINISKILLSICDIDYYSQKKTTFIISERQYVSFFIINYT* |
| SI34jun09_150mDRAFT_10056111 | 3300000237 | Marine | SLPAGPGINISKILLSICDIDYYSQKKTTFIISERQYVSFFKIIYT* |
| LP_A_09_P04_10DRAFT_10566551 | 3300000265 | Marine | AGPGINISKILLSINDIDYCSQKKTTFIISERQYVSFFITIYT* |
| SI48aug10_100mDRAFT_10551152 | 3300000324 | Marine | ILLSICDIDYYSQKKTRSIISERQYVNFFIIIYT* |
| JGI20159J14440_100752263 | 3300001353 | Pelagic Marine | LLSISVIDYYSQKKITFIITKRQYVNYFIYCILD* |
| JGI20159J14440_101016233 | 3300001353 | Pelagic Marine | PAGPGINISKILLSIYDIDYYSQKKTTFITSERQNVSYFIINYT* |
| JGI20159J14440_101897421 | 3300001353 | Pelagic Marine | ISKILLSICDIDYYSQKKTTFIISERQYVSYFIINYT* |
| JGI20155J14468_100766513 | 3300001354 | Pelagic Marine | SLPAGPGIKISKILLSICDIDYYSQKKTRFITSERQYVSFFIIIYT* |
| JGI20155J14468_101320921 | 3300001354 | Pelagic Marine | ISKILLSICDIDYYSQKKTTFITSERQYVSFFILMYT* |
| GOS2235_10464884 | 3300001954 | Marine | FLLLKYFASSLPAGPGINISLILLSIKAIDYYSQKKCTFIISERQYVKFFF* |
| nap3_101023031 | 3300003477 | Estuarine | SSLPAGPGMNISKILLSICAIDYCSQKKTRFITSERQYVSFFIIIYT* |
| JGI26247J51722_10496381 | 3300003588 | Marine | PGMNISKILLSICAIDYCSQKKTRFITSERQYVSFFIIIYT* |
| Ga0066610_101507491 | 3300004276 | Marine | ASSLPAGPGIKISKILLSICDIDYYSQKKTTFITSERQYVSFFILMYT* |
| Ga0066856_103179552 | 3300005404 | Marine | PGINISKILLSICDIDYYSQKKTTFITSERQYVSFFIINYT* |
| Ga0066866_101930071 | 3300005514 | Marine | PAGPGINISKILLSIIVIDYYSQKKITFIISTLQNVNFFICET* |
| Ga0066862_100727791 | 3300005521 | Marine | YFASSLPAGPGINISKILLSIIVIDYYSQKKITFIISTLQNVNFFICET* |
| Ga0075478_100479913 | 3300006026 | Aqueous | AGPGINISKILLSIYDIDYYSQKKTTFIISERQYVSFFIVIYT* |
| Ga0066836_105968072 | 3300006166 | Marine | LLLKYFASSLPAGPGINISKILLSIIVIDYYSQKKITFIISTLQNVNFFICET* |
| Ga0075447_101900912 | 3300006191 | Marine | PAGPGIKTSTILLSINDIDYYSQKKVTSIISERQYVNFFI* |
| Ga0075447_102173482 | 3300006191 | Marine | TSTILLSINDIDYYSQKKVTSIISERQYVNFFYAINT* |
| Ga0075445_101954793 | 3300006193 | Marine | GPGIKTSTILLSINVIDYYSQKKITSIISKRQYVNFFT* |
| Ga0099693_10881556 | 3300006345 | Marine | AGPGINISKILLSIFVNDNYSQKKIRHIITVRQYDSFFLL* |
| Ga0075444_101877213 | 3300006947 | Marine | LLSINDIDYYSQKKNTHIITKRHYVIFFAYCILD* |
| Ga0102948_11428873 | 3300007623 | Water | PAGPGINISKILLSIYDIDYYSQKKTTFIISERQYVSFFIAMYT* |
| Ga0102891_11858742 | 3300008950 | Estuarine | FASSLPTGPGINISKILLSICDIDYYSQKKTTFITSERQYVSFFILMYT* |
| Ga0102911_10290483 | 3300009049 | Estuarine | LASNLPAGPGMNISKILLSICAIDYCSQKKTRFITSERQYVSFFIIIYT* |
| Ga0115566_106354842 | 3300009071 | Pelagic Marine | PAGPGINISKILLSICDIDYYSQKKTTFITSERQYVSYFIINYT* |
| Ga0115566_107375072 | 3300009071 | Pelagic Marine | LPAGPGIKISKILLSICDIDYYSQKKTTFITSERQYVSFFITLYT* |
| Ga0115552_13080622 | 3300009077 | Pelagic Marine | SSLPAGPGIKISKILLSICDIDYYSQKKTTFITSERQYVSYFIINYT* |
| Ga0102812_107590452 | 3300009086 | Estuarine | PAGPGMKISKILLSISAIDYYSQKKITFIISERQYVSYFIINYT* |
| Ga0114995_106105781 | 3300009172 | Marine | GPGIKTSTILLSINDIDYYSQKKNTLIITKRQYVIFFTYCILD* |
| Ga0114996_104681283 | 3300009173 | Marine | LASILPAGPGIKTSTILLSINDIDYYSQKKNTLIITKRQYVIFFTYCILD* |
| Ga0114994_101695523 | 3300009420 | Marine | ASILPAGPGMKTSTILLSISVIDYYSQKKIRLIITKRQYVNFFRQSILD* |
| Ga0114994_109505411 | 3300009420 | Marine | TILLSINVIDYYSQKKITIITPKRQYVNFFTESILD* |
| Ga0114998_102029393 | 3300009422 | Marine | PGIKTSTILLSINVIDYYSQKKITFITTKRQYVNFFMQSKLD* |
| Ga0114997_102972151 | 3300009425 | Marine | GPGIKTSTILLSINVIDYYSQKKITFITTKRQYVNFFMQSKLD* |
| Ga0114997_104083753 | 3300009425 | Marine | PGIKTSTILLSINVIDYYSQKKITSIISERQYVNFFYVIYT* |
| Ga0114997_105906261 | 3300009425 | Marine | SLPAGPGIKISTILLSINVIDYYSQKKNITIITKRQYVNFFTQSILD* |
| Ga0115557_10437843 | 3300009443 | Pelagic Marine | GPGINISKILLSIYDIDYYSQKKTTFIISERQYVSFFIAMYT* |
| Ga0114932_109185102 | 3300009481 | Deep Subsurface | AGPGINISKILLSICDIDYYSQKKTTFITSERQYVSFFIINYT* |
| Ga0115571_12330711 | 3300009495 | Pelagic Marine | GPGINTSTILLSISVIDYYSQKKITFITTERQYVNFFK* |
| Ga0115569_102677621 | 3300009497 | Pelagic Marine | GPGMNISKILLSISAIDYYSQKKITFIISERQYVSYFIINYT* |
| Ga0115567_102296561 | 3300009508 | Pelagic Marine | ASSLPAGPGIKTSTILLSISVIDYYSQKKITFITSKRQYVNFFSILNLTKLVKFV* |
| Ga0115003_100711651 | 3300009512 | Marine | AGPGMKISKILLSISAIDYYSQKKITFIISERQYVSFFIAIYT* |
| Ga0115004_100309821 | 3300009526 | Marine | PGIKTSTILLSISVIDYYSQKKNTSIISERQYVNFFSYSILD* |
| Ga0115004_107159271 | 3300009526 | Marine | ILPAGPGIKTSTILLSISVIDYYLQKKITSIITKRQYVNFFTISKLD* |
| Ga0115000_107159802 | 3300009705 | Marine | LASILPAGPGIKISTILLSISVIDYYSQKKITSIITKRQYVNFFKQSILD* |
| Ga0115000_109935541 | 3300009705 | Marine | ILLSISVIDYYSQKKITSIITKRQYVNFFTQSILD* |
| Ga0115001_102883503 | 3300009785 | Marine | SILPAGPGIKTSTILLSISVIDYYSQKKITSIITKRQYVNFFTQSILD* |
| Ga0115001_104099661 | 3300009785 | Marine | PGIKTSTILLSINDIDYYSQKKVTSIISERQYVNFFM* |
| Ga0163110_106713991 | 3300012928 | Surface Seawater | AGPGMKISKILLSISAIDYYSQKKITFITCQRQYVVFFLIFYT* |
| Ga0182093_10728753 | 3300016745 | Salt Marsh | SLPAGPGINISKILLSIYDIDYYSQKKTTFIISERQYVSFFIAMYT |
| Ga0181388_10527013 | 3300017724 | Seawater | PAGPGINISKILLSISAIDYCSQKKTTLIISERQYVSFFIIIYT |
| Ga0181431_11087962 | 3300017735 | Seawater | SSLPAGPGINISKILLSICDIDYYSQKKTTFIISERQYVSYFIINYT |
| Ga0181421_10337611 | 3300017741 | Seawater | SSLPAGPGINTSTILLSISVIDYYSQKKITFITTERQYVNFFK |
| Ga0181402_10690531 | 3300017743 | Seawater | GPGINISKILLSICDIDYYSQKKTTFIISERQYVSYFIINYT |
| Ga0187221_12419831 | 3300017769 | Seawater | GPVINISKILLSIVVIDYYSQKKIRFITTARQNVSFFFTLDT |
| Ga0181589_103653461 | 3300017964 | Salt Marsh | LPAGPGINISKILLSISDIDYYSQKKCTFIISQRQYVSFFFKL |
| Ga0181563_106100791 | 3300018420 | Salt Marsh | AGPGMNISKILLSIYDIDYYSQKKTTFIISERQYVSFFIAIYT |
| Ga0181562_105364012 | 3300019459 | Salt Marsh | PAGPGINISKILLSIYDIDYYSQKKTTFIISERQYVIFFIAIYT |
| Ga0194016_10025471 | 3300019708 | Sediment | AGPGINISKILLSIYDIDYYSQKKTTFIISERQYVSFFIAMYT |
| Ga0194024_10177403 | 3300019765 | Freshwater | PAGPGINISKILLSIYDIDYYSQKKTTFIISERQYVSFFIAMYT |
| Ga0211688_10716422 | 3300020317 | Marine | LPAGPGIKISKILLSISAIDYYSQKKITFITSQRQYVSYFIIFYT |
| Ga0211683_100640133 | 3300020372 | Marine | PAGPGIKTSIILLSINVIDYYYQKKNIFIITKRQYVNFFIYCILD |
| Ga0211683_101648601 | 3300020372 | Marine | PAGPGINTSTILLSINDIDYYSQKKVTSIISERQYVNFFM |
| Ga0211682_102481962 | 3300020376 | Marine | PGIKTSTILLSINVIDYYSQKKITSIISERQYVNFFA |
| Ga0211652_101723801 | 3300020379 | Marine | KISKILLSISVIDYHSQKKITFIISERQYVTFFVIIYT |
| Ga0211677_102566423 | 3300020385 | Marine | GINISKILLSICDIDYYSQKKTTFITSERQYVSYFIINYT |
| Ga0211678_101346991 | 3300020388 | Marine | LPAGPGIKTSTILLSISVIDYYSQKKITFITSKRQYVNFFI |
| Ga0211687_103413581 | 3300020396 | Marine | PAGPGINTSTILLSINDIDYYSQKKVTFIISERQYVNFFYVIYT |
| Ga0206682_101650503 | 3300021185 | Seawater | ASSLPAGPGINISKILLSICDIDYYSQKKTTFIISERQYVSFFKIIYT |
| Ga0213860_105046082 | 3300021368 | Seawater | SLPAGPGINISKILLSIYDIDYYSQKKTTFITSERQYVSFFIIIYT |
| Ga0213869_104027481 | 3300021375 | Seawater | SLPAGPGIKISKILLSICDIDYYSQKKTTFITSERQYVSFFITLYT |
| Ga0222716_104557443 | 3300021959 | Estuarine Water | ASSLPAGPGINTSTILLSISVIDYYSQKKITFITTERQYVNFFK |
| Ga0255775_10385774 | 3300022907 | Salt Marsh | SRPAGPGINISKILLSIYDIDYYSQKKTTFIISERQYVSFFIAIYT |
| Ga0255775_10540503 | 3300022907 | Salt Marsh | PAGPGINISKILLSIYDIDYYSQKKTTFIISERQYVSFFIVIYT |
| (restricted) Ga0233426_100247285 | 3300022920 | Seawater | AGPEINISKILLSICDIDYYSQKKTTFIISERQYVSFFKIIYT |
| (restricted) Ga0233426_100608003 | 3300022920 | Seawater | SNLPAGPGMNISKILLSICAIDYCSQKKTRFITSERQYVSFFIIIYT |
| (restricted) Ga0233426_102014823 | 3300022920 | Seawater | SSLPAGPGIKISKILLSICDIDYYSQKKTTFITSERQYVSFFILMYT |
| (restricted) Ga0233432_102201003 | 3300023109 | Seawater | SLPAGPGINISKILLSICDIDYYSQKKTTFIISERQYVSFFKIIYT |
| Ga0255768_101127041 | 3300023180 | Salt Marsh | SLPAGPGINISKILLSIYDIDYYSQKKTTFIISERQYVSFFIVIYT |
| Ga0228669_10321031 | 3300024185 | Seawater | LPAGPGINISKILLSICAIDYCSQKKTRFITSERQYVSFFIIIYT |
| Ga0228602_10074823 | 3300024188 | Seawater | ASSLPAGPGINISKILLSICDIDYYSQKKTTFIISERQYVSFFIVNYT |
| Ga0233399_10359953 | 3300024231 | Seawater | AGPGINISKILLSICDIDYYSQKKTTFITSERQYVSYFIINYT |
| Ga0228655_10906031 | 3300024236 | Seawater | PGINISKILLSIYDIDYYSQKKTTFIISERQYVSFFIAIYT |
| (restricted) Ga0233448_11542522 | 3300024299 | Seawater | SLPAGPGINISKILLSICDIDYYSQKKTRSIISERQYVNFFIIIYT |
| Ga0233451_102168153 | 3300024301 | Salt Marsh | SRPAGPGINISKILLSIYDIDYYSQKKTTFIISERQYVSFFIVIYT |
| Ga0228657_10404383 | 3300024314 | Seawater | FASSLPAGPGINISKILLSINDIDYYSQKKTTFITSERQYVSFFIAMYT |
| Ga0244775_111536462 | 3300024346 | Estuarine | LPAGPGINISKILLSINDIDYCSQKKTTFIISERQYVSFFIAIYT |
| Ga0233393_10353933 | 3300024413 | Seawater | ASSLPAGPGINISKILLSICAIDYCSQKKTRFITSERQYVSFFIIIYT |
| Ga0228663_11013481 | 3300024508 | Seawater | ASSLPAGPGINIYKILLSICAIDYCSQKKTRFITSERQYVSFFIIIYT |
| Ga0208646_10675031 | 3300025425 | Saline Lake | TSTILLSINDIDYYSQKKNTHITTKRQYVIFFAYCILD |
| Ga0209659_10540701 | 3300025658 | Marine | GPGINTSTILLSISVIDYYSQKKITFIITERQYVNFFN |
| Ga0209664_11132953 | 3300025662 | Marine | SLPAGPGINISKILFSISDIDYYSQKKTIFITSERQYVSFFTLIYT |
| Ga0209601_11196383 | 3300025666 | Pelagic Marine | LPAGPGINTSTILLSISVIDYYSQKKITFIITERQYVNFFN |
| Ga0209263_10281213 | 3300025681 | Marine | SSLPAGPGINISKILLSICDIDYYSQKKTRSIISERQYVNFFIIIYT |
| Ga0209653_11432563 | 3300025695 | Marine | LPAGPGINISKILLSIYDIDYYSQKKTTFIISERQYVSFFIVIYT |
| Ga0209667_11910411 | 3300025707 | Marine | SSLPAGPGINISKILLSICDIDYYSQKKTTFIISERQYVSFFKIIYT |
| Ga0209660_11673123 | 3300025722 | Marine | SLPAGPGINISKILFSISDIDYYSQKKTIFITSERQYVSFFISIYT |
| Ga0209714_11448831 | 3300025822 | Pelagic Marine | LPAGPGINISKILLSIYDIDYYSQKKTTFIISERQYVSFFIVFYT |
| Ga0228607_10241731 | 3300026517 | Seawater | LPAGPGINISKILLSINDIDYYSQKKTTFITSERQYVSFFIAMYT |
| Ga0228607_10844831 | 3300026517 | Seawater | LPAGPGINISKILLSIYDIDYYSQKKTTFIISERQYVSYFIINYT |
| Ga0208809_10195463 | 3300027251 | Estuarine | SLPAGPGINISKILLSICDIDYYSQKKTTFITSERQYVSFFIIIYT |
| Ga0209709_102407643 | 3300027779 | Marine | IKTSTILLSINDIDYYSQKKVTSIISERQYVNFFM |
| Ga0209709_103212351 | 3300027779 | Marine | AGPGIKISTILLSICVIDYYSQKKITSIISKRQYVNFFS |
| Ga0209709_103329822 | 3300027779 | Marine | STILLSINVIDYYFQKKNTPIITKRQYVNFFEKSILD |
| Ga0209709_104225512 | 3300027779 | Marine | AGPGIKTSTILLSISVIDYYSQKKITSIITKRQYVNFFK |
| Ga0209709_104267841 | 3300027779 | Marine | LPAGPGINTSTILLSINDIDYYSQKKATSIISERQYVIFFLYCILD |
| Ga0209711_102604181 | 3300027788 | Marine | SILPAGPGIKTSTILLSINDIDYYSQKKVTSIISERQYVNFFI |
| Ga0257106_10217941 | 3300028194 | Marine | PAGPGIKTSTILLSINVIDYYSQKKITFITTKRQYVNFFI |
| Ga0228640_11153731 | 3300028273 | Seawater | LPAGPGINISKILLSIYDIDYYSQKKTTFIISERQYVSFFIAIYT |
| Ga0228617_10560681 | 3300028297 | Seawater | LPAGPGINISKILLSICAIDYCSQKKTRFITSERQYVSFFITIYT |
| Ga0228627_10211421 | 3300028414 | Seawater | PGINISKILFSISDIDYYSQKKTTFIISERQYVSFFIVNYT |
| Ga0228625_10827532 | 3300028419 | Seawater | GPGINISKILLSICAIDYCSQKKTRFITSERQYVSFFIIIYT |
| Ga0308010_11326671 | 3300031510 | Marine | SLPAGPGMKISKILLSISAIDYYSQKKITFIISERQYVSFFI |
| Ga0308009_103774011 | 3300031612 | Marine | PGIKTSTILLSINDIDYYSQKKTTPIISERQYVNFFILSILD |
| Ga0302135_100080648 | 3300031625 | Marine | PAGPGIKISTILLSISVIDYYSQKKITSIITKRQYVNFFKQSILD |
| Ga0308004_102974532 | 3300031630 | Marine | TSTILLSISVIDYYSQKKITFIITKRQYVNFFKESILD |
| Ga0308005_101824362 | 3300031656 | Marine | ILPAGPGIKTSTILLSINDIDYYSQKKTTPIISERQYVNFFILSILD |
| Ga0307986_104152612 | 3300031659 | Marine | TSTILLSISVIDYYSQKKNTTIITKRQYVNFFTQSILD |
| Ga0308016_102594932 | 3300031695 | Marine | GPGIKTSTILLSINVIDYYSQKKIRSIITKRQYVNFFM |
| Ga0315328_104088551 | 3300031757 | Seawater | NISKILFSISDIDYYSQKKTIFITSERQYVSFFTLIYT |
| Ga0315331_106445761 | 3300031774 | Seawater | LPAGPGINISNILLSICDIDYYSQKKCTFTTCERQYVSFFLN |
| Ga0315316_115573602 | 3300032011 | Seawater | PGINTSTILLSISVIDYYSQKKITFIITERQYVNFFN |
| Ga0315330_103617073 | 3300032047 | Seawater | SLPAGPGINISKILLSINDIDYYSQKKTTFITSERQYVSFFIAMYT |
| Ga0315321_103814891 | 3300032088 | Seawater | SLPAGPGINISKILLSIYDIDYYSQKKTTFIISERQYVSFFIAIYT |
| ⦗Top⦘ |