Basic Information | |
---|---|
Family ID | F057540 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 136 |
Average Sequence Length | 45 residues |
Representative Sequence | LLLEIVISLAVTGLSDTTLRDLGVLGLALCLTGCKNQRLVLRT |
Number of Associated Samples | 116 |
Number of Associated Scaffolds | 135 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 3.94 % |
% of genes near scaffold ends (potentially truncated) | 86.03 % |
% of genes from short scaffolds (< 2000 bps) | 81.62 % |
Associated GOLD sequencing projects | 111 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.31 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (70.588 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.471 % of family members) |
Environment Ontology (ENVO) | Unclassified (22.794 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.70% β-sheet: 0.00% Coil/Unstructured: 49.30% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 135 Family Scaffolds |
---|---|---|
PF00300 | His_Phos_1 | 27.41 |
PF08240 | ADH_N | 9.63 |
PF13602 | ADH_zinc_N_2 | 7.41 |
PF00202 | Aminotran_3 | 5.19 |
PF02774 | Semialdhyde_dhC | 3.70 |
PF03091 | CutA1 | 2.96 |
PF01425 | Amidase | 1.48 |
PF02515 | CoA_transf_3 | 1.48 |
PF02518 | HATPase_c | 1.48 |
PF07920 | DUF1684 | 1.48 |
PF00355 | Rieske | 1.48 |
PF09335 | SNARE_assoc | 1.48 |
PF03965 | Penicillinase_R | 1.48 |
PF02036 | SCP2 | 1.48 |
PF00107 | ADH_zinc_N | 1.48 |
PF01435 | Peptidase_M48 | 0.74 |
PF16884 | ADH_N_2 | 0.74 |
PF02277 | DBI_PRT | 0.74 |
PF01161 | PBP | 0.74 |
PF00142 | Fer4_NifH | 0.74 |
PF02776 | TPP_enzyme_N | 0.74 |
PF00079 | Serpin | 0.74 |
PF14329 | DUF4386 | 0.74 |
PF01872 | RibD_C | 0.74 |
PF01988 | VIT1 | 0.74 |
PF00689 | Cation_ATPase_C | 0.74 |
PF04185 | Phosphoesterase | 0.74 |
PF03561 | Allantoicase | 0.74 |
PF00486 | Trans_reg_C | 0.74 |
PF13476 | AAA_23 | 0.74 |
PF01522 | Polysacc_deac_1 | 0.74 |
PF01243 | Putative_PNPOx | 0.74 |
PF00892 | EamA | 0.74 |
PF07859 | Abhydrolase_3 | 0.74 |
PF00702 | Hydrolase | 0.74 |
PF08281 | Sigma70_r4_2 | 0.74 |
PF01734 | Patatin | 0.74 |
PF01037 | AsnC_trans_reg | 0.74 |
PF14226 | DIOX_N | 0.74 |
PF00582 | Usp | 0.74 |
COG ID | Name | Functional Category | % Frequency in 135 Family Scaffolds |
---|---|---|---|
COG0136 | Aspartate-semialdehyde dehydrogenase | Amino acid transport and metabolism [E] | 3.70 |
COG0002 | N-acetyl-gamma-glutamylphosphate reductase | Amino acid transport and metabolism [E] | 3.70 |
COG1324 | Divalent cation tolerance protein CutA | Inorganic ion transport and metabolism [P] | 2.96 |
COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 1.48 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.48 |
COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 1.48 |
COG3358 | Uncharacterized conserved protein, DUF1684 family | Function unknown [S] | 1.48 |
COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 1.48 |
COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 1.48 |
COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 1.48 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.48 |
COG4266 | Allantoicase | Nucleotide transport and metabolism [F] | 0.74 |
COG4826 | Serine protease inhibitor | Posttranslational modification, protein turnover, chaperones [O] | 0.74 |
COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.74 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.74 |
COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.74 |
COG2038 | NaMN:DMB phosphoribosyltransferase | Coenzyme transport and metabolism [H] | 0.74 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.74 |
COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 0.74 |
COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 0.74 |
COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.74 |
COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 0.74 |
COG1348 | Nitrogenase ATPase subunit NifH/coenzyme F430 biosynthesis subunit CfbC | Coenzyme transport and metabolism [H] | 0.74 |
COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.74 |
COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.74 |
COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.74 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.74 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 70.59 % |
Unclassified | root | N/A | 29.41 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001632|JGI20235J16296_1003207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 744 | Open in IMG/M |
3300001632|JGI20235J16296_1003207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 744 | Open in IMG/M |
3300005435|Ga0070714_100868090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 875 | Open in IMG/M |
3300005436|Ga0070713_101378049 | Not Available | 684 | Open in IMG/M |
3300005467|Ga0070706_101399459 | Not Available | 640 | Open in IMG/M |
3300005471|Ga0070698_100310338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1508 | Open in IMG/M |
3300005994|Ga0066789_10061034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1641 | Open in IMG/M |
3300006028|Ga0070717_10039153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3856 | Open in IMG/M |
3300006028|Ga0070717_10284761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1466 | Open in IMG/M |
3300006102|Ga0075015_100194590 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
3300006176|Ga0070765_100342013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1389 | Open in IMG/M |
3300006854|Ga0075425_100254881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2019 | Open in IMG/M |
3300006954|Ga0079219_11872553 | Not Available | 565 | Open in IMG/M |
3300009520|Ga0116214_1063298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1346 | Open in IMG/M |
3300009521|Ga0116222_1513730 | Not Available | 525 | Open in IMG/M |
3300009698|Ga0116216_10995093 | Not Available | 501 | Open in IMG/M |
3300010048|Ga0126373_12798660 | Not Available | 544 | Open in IMG/M |
3300010358|Ga0126370_11250568 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300010359|Ga0126376_12110709 | Not Available | 607 | Open in IMG/M |
3300010361|Ga0126378_12646071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 573 | Open in IMG/M |
3300010376|Ga0126381_100083472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4027 | Open in IMG/M |
3300010376|Ga0126381_100211896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2598 | Open in IMG/M |
3300010376|Ga0126381_101369324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1023 | Open in IMG/M |
3300010876|Ga0126361_10246247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 537 | Open in IMG/M |
3300012210|Ga0137378_10355217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1361 | Open in IMG/M |
3300012210|Ga0137378_10550558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1062 | Open in IMG/M |
3300012211|Ga0137377_11221966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 681 | Open in IMG/M |
3300012957|Ga0164303_10071603 | Not Available | 1620 | Open in IMG/M |
3300012960|Ga0164301_10866651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. Iso805N | 697 | Open in IMG/M |
3300012960|Ga0164301_11742681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
3300012987|Ga0164307_10114295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1717 | Open in IMG/M |
3300013104|Ga0157370_11441406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 619 | Open in IMG/M |
3300016270|Ga0182036_10481154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 981 | Open in IMG/M |
3300016422|Ga0182039_11069149 | Not Available | 726 | Open in IMG/M |
3300017822|Ga0187802_10250215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidiferrimicrobium → unclassified Acidiferrimicrobium → Acidiferrimicrobium sp. IK | 686 | Open in IMG/M |
3300017924|Ga0187820_1071334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 965 | Open in IMG/M |
3300017924|Ga0187820_1087382 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
3300017924|Ga0187820_1170820 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300017928|Ga0187806_1101400 | Not Available | 919 | Open in IMG/M |
3300017932|Ga0187814_10195593 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300017937|Ga0187809_10162063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 778 | Open in IMG/M |
3300017937|Ga0187809_10174657 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300017942|Ga0187808_10266085 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300017955|Ga0187817_10238306 | Not Available | 1159 | Open in IMG/M |
3300017972|Ga0187781_11497402 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300017974|Ga0187777_10693124 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300017994|Ga0187822_10321592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 551 | Open in IMG/M |
3300017995|Ga0187816_10379977 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300018001|Ga0187815_10023575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2632 | Open in IMG/M |
3300018007|Ga0187805_10631080 | Not Available | 507 | Open in IMG/M |
3300018042|Ga0187871_10415516 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300018060|Ga0187765_10259967 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
3300018088|Ga0187771_10562845 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
3300019887|Ga0193729_1016775 | All Organisms → cellular organisms → Bacteria | 3216 | Open in IMG/M |
3300020081|Ga0206354_10609777 | Not Available | 764 | Open in IMG/M |
3300020082|Ga0206353_11634021 | Not Available | 528 | Open in IMG/M |
3300020579|Ga0210407_10815879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 719 | Open in IMG/M |
3300020582|Ga0210395_10056090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2887 | Open in IMG/M |
3300021178|Ga0210408_10639193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 841 | Open in IMG/M |
3300021180|Ga0210396_11693983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 514 | Open in IMG/M |
3300021401|Ga0210393_10026457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 4525 | Open in IMG/M |
3300021402|Ga0210385_11355625 | Not Available | 544 | Open in IMG/M |
3300021403|Ga0210397_10475129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 944 | Open in IMG/M |
3300021406|Ga0210386_10193101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1721 | Open in IMG/M |
3300021559|Ga0210409_10914083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 751 | Open in IMG/M |
3300021560|Ga0126371_11193716 | Not Available | 898 | Open in IMG/M |
3300021560|Ga0126371_13100520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 562 | Open in IMG/M |
3300025703|Ga0208357_1003427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 9709 | Open in IMG/M |
3300025910|Ga0207684_10180549 | All Organisms → cellular organisms → Bacteria | 1820 | Open in IMG/M |
3300025944|Ga0207661_11740467 | Not Available | 569 | Open in IMG/M |
3300026217|Ga0209871_1000642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8747 | Open in IMG/M |
3300026551|Ga0209648_10419394 | Not Available | 860 | Open in IMG/M |
3300026889|Ga0207745_1023002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 551 | Open in IMG/M |
3300027110|Ga0208488_1054959 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300027110|Ga0208488_1066681 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300027521|Ga0209524_1098785 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300027783|Ga0209448_10067116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1206 | Open in IMG/M |
3300027795|Ga0209139_10067956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1249 | Open in IMG/M |
3300027855|Ga0209693_10261650 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
3300027857|Ga0209166_10133865 | Not Available | 1361 | Open in IMG/M |
3300027862|Ga0209701_10478812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 680 | Open in IMG/M |
3300027869|Ga0209579_10058757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 2039 | Open in IMG/M |
3300027884|Ga0209275_10715666 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300027884|Ga0209275_10923024 | Not Available | 503 | Open in IMG/M |
3300027905|Ga0209415_10394315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1122 | Open in IMG/M |
3300027911|Ga0209698_10115357 | All Organisms → cellular organisms → Bacteria | 2232 | Open in IMG/M |
3300028015|Ga0265353_1016221 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300028781|Ga0302223_10147963 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300028906|Ga0308309_11854572 | Not Available | 509 | Open in IMG/M |
3300030114|Ga0311333_10095420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Antricoccaceae → Antricoccus → Antricoccus suffuscus | 2208 | Open in IMG/M |
3300030494|Ga0310037_10144020 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
3300030707|Ga0310038_10202037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 948 | Open in IMG/M |
3300031549|Ga0318571_10196983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 719 | Open in IMG/M |
3300031564|Ga0318573_10038490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2281 | Open in IMG/M |
3300031564|Ga0318573_10128229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1320 | Open in IMG/M |
3300031573|Ga0310915_10265847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes xinjiangensis | 1208 | Open in IMG/M |
3300031679|Ga0318561_10288373 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300031682|Ga0318560_10642628 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300031708|Ga0310686_100971198 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300031708|Ga0310686_113496660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1117 | Open in IMG/M |
3300031753|Ga0307477_10456028 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300031765|Ga0318554_10007117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 5392 | Open in IMG/M |
3300031778|Ga0318498_10426160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 588 | Open in IMG/M |
3300031782|Ga0318552_10000217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 16133 | Open in IMG/M |
3300031799|Ga0318565_10492640 | Not Available | 592 | Open in IMG/M |
3300031831|Ga0318564_10106368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1247 | Open in IMG/M |
3300031831|Ga0318564_10486383 | Not Available | 536 | Open in IMG/M |
3300031860|Ga0318495_10175642 | Not Available | 965 | Open in IMG/M |
3300031894|Ga0318522_10026576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1926 | Open in IMG/M |
3300031897|Ga0318520_10064378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1970 | Open in IMG/M |
3300031897|Ga0318520_10391741 | Not Available | 848 | Open in IMG/M |
3300031902|Ga0302322_100473602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1452 | Open in IMG/M |
3300031910|Ga0306923_11488642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 709 | Open in IMG/M |
3300031942|Ga0310916_10177495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1773 | Open in IMG/M |
3300031947|Ga0310909_10600861 | Not Available | 919 | Open in IMG/M |
3300031962|Ga0307479_10823069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 903 | Open in IMG/M |
3300032039|Ga0318559_10287406 | Not Available | 763 | Open in IMG/M |
3300032054|Ga0318570_10469831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 574 | Open in IMG/M |
3300032055|Ga0318575_10487033 | Not Available | 626 | Open in IMG/M |
3300032066|Ga0318514_10792664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 504 | Open in IMG/M |
3300032090|Ga0318518_10731694 | Not Available | 503 | Open in IMG/M |
3300032160|Ga0311301_10507124 | All Organisms → cellular organisms → Bacteria | 1785 | Open in IMG/M |
3300032160|Ga0311301_12144458 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300032895|Ga0335074_11426390 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300032954|Ga0335083_10590156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 917 | Open in IMG/M |
3300033290|Ga0318519_10244480 | Not Available | 1037 | Open in IMG/M |
3300033805|Ga0314864_0155817 | Not Available | 583 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.47% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 10.29% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.09% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.88% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.88% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.41% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.41% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.68% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.68% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.21% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.47% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.47% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.47% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.47% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.47% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.47% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.47% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.74% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.74% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.74% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.74% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.74% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.74% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.74% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.74% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.74% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.74% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.74% |
Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.74% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.74% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.74% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.74% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001632 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025703 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F52-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026889 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 57 (SPAdes) | Environmental | Open in IMG/M |
3300027110 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes) | Environmental | Open in IMG/M |
3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028015 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 | Environmental | Open in IMG/M |
3300028781 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI20235J16296_10032072 | 3300001632 | Forest Soil | VISLAATGLSDTALRDVGVLGLAVCLVGSKNQRLVLRS* |
JGI20235J16296_10032073 | 3300001632 | Forest Soil | AAIASVLMLEIVISLAATGLSDTALRDVGVLGLAVCLVGSKNQHLVLRS* |
Ga0070714_1008680902 | 3300005435 | Agricultural Soil | IAPRISAAIASVLLLEIVISLSVSGLSDTSMRDVGVLGLAVVLTGCRNQRLVLRN* |
Ga0070713_1013780492 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | AVLVLEIVISLTVSGGLSDFILRDVGVLGLAICLTGIRQQRLVLSR* |
Ga0070706_1013994592 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | AGIAALLLAQIVIWLTATSGLSDLTLRDVGVLGLALCLTGTTERRLMLAR* |
Ga0070698_1003103381 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | IVIWLTATAGLSDLTLRDVGVLGLALCLTGTTQRRLMLAR* |
Ga0066789_100610341 | 3300005994 | Soil | LLEIVISLAVTGGLSDLTLRDVGVLGLAVCLTGRSIQRLVLTG* |
Ga0070717_100391534 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | RISAAIASVLLLEIVISLSVSGLSDTAMRDVGVLGLAVVLTGCRNQRLVLRN* |
Ga0070717_102847611 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | ISAAIASVLLLEIVISLSVSGLSDTSMRDVGVLGLAVVLTGCRNQRLVLRN* |
Ga0075015_1001945904 | 3300006102 | Watersheds | MLEIVIAVAMTGQSPTALRDVGVLGLAVCLTGVRHQRLVLRN* |
Ga0070765_1003420131 | 3300006176 | Soil | ATVLMLEIVIAVAVTGQSPTALRDVGVLGLAVCLTGVRHQRLVLRN* |
Ga0075425_1002548811 | 3300006854 | Populus Rhizosphere | AAAVSVALLLEIVISLTVASGLSDLVLRDVGVLGLAACLTAPTRQRLALSR* |
Ga0079219_118725532 | 3300006954 | Agricultural Soil | ALTVLVLLEIVVSLTLTTGLSDLVLRDVGVLGLAVCLTAPTPQRLVLTR* |
Ga0116214_10632983 | 3300009520 | Peatlands Soil | AAAAVASVLMLEIVIAVAMTGQSPTALRDVGVLGLAVCLTGVRHQRLVLRN* |
Ga0116222_15137301 | 3300009521 | Peatlands Soil | SVLLLEIVISLAVTGLDATAVRDVGVLGLAVCLTGGKNQRLVLRN* |
Ga0116216_109950932 | 3300009698 | Peatlands Soil | ASLLMLEIVIALAATGLSDTALRDVGVLGLAVCLTGCKNQRLVLRN* |
Ga0123355_114512112 | 3300009826 | Termite Gut | AQIVVWLWASAGLSDLTLRDVGVLGLALCIAGRTEQRLVLTG* |
Ga0126373_127986601 | 3300010048 | Tropical Forest Soil | VISLTVQAGLSDLTLRDVGVLGLALCLTGAAEQRFVLAS* |
Ga0126370_112505681 | 3300010358 | Tropical Forest Soil | MMNESKVIWLTATAGLSDLTMRDVGVLGLALCLTGATEQRFTLTS* |
Ga0126376_121107091 | 3300010359 | Tropical Forest Soil | ITGGLSDLTLRDVGVLGLALCLTADTRQRAVLSN* |
Ga0126378_126460712 | 3300010361 | Tropical Forest Soil | ISLTISGGLSDLTLRDVGVLGLAVVLTGVSQERLVLTG* |
Ga0126379_105558761 | 3300010366 | Tropical Forest Soil | LWASAGLSDLTLRDVGVLGLAPCLTGRTEQRFALTN* |
Ga0126381_1000834725 | 3300010376 | Tropical Forest Soil | GAAIATIVLLQIVITLTITGGLSDLTMRDVGVLGLAVSLTGRARQRLTI* |
Ga0126381_1002118964 | 3300010376 | Tropical Forest Soil | LLIAEIVIWLTITAGLSDLTLRDVGVLGLAVCLSGDTRQRLVLAT* |
Ga0126381_1013693241 | 3300010376 | Tropical Forest Soil | AVTAVLLAQIVLTLAITGGLSDLTLRDLGVLGLAVCLTGSGPQRLTV* |
Ga0126361_102462471 | 3300010876 | Boreal Forest Soil | LEIVIGLAATGVSDTALRDLGVLGLAVCLTGCKNQRLVLRG* |
Ga0137362_117144181 | 3300012205 | Vadose Zone Soil | LTITGGLTDLTLRDVGVLGLAVCLTGATRQRALLTA* |
Ga0137378_103552173 | 3300012210 | Vadose Zone Soil | VILLAEIVISLAVSDGLSDLVLRDIGVLGLAVCLTGCSRHRLVLSR* |
Ga0137378_105505582 | 3300012210 | Vadose Zone Soil | GVALRLAAAVAAVLLLQIVITLAVTGGLTDVTLRDVGVLGLAVCLTGDGRQRLVLRR* |
Ga0137378_105942642 | 3300012210 | Vadose Zone Soil | TITGGLTDLTLRDVGVFGLAICLTGGSRQRAVLTR* |
Ga0137377_112219662 | 3300012211 | Vadose Zone Soil | WLAVSGGLSDLVIRDLGVLGLAVCLTGCSSHRAVLSR* |
Ga0164303_100716034 | 3300012957 | Soil | VVLLLQIVTSLTMSNGLSDLILRDVGVLGLAVCLTASTRQRLVLSR* |
Ga0164301_108666511 | 3300012960 | Soil | VLLLLQIVTSLTMSNGLSDLVLRDVGVLGLAVCLTATTRQRLVLSR* |
Ga0164301_117426811 | 3300012960 | Soil | IVTSLSMSNGLSDLVLRDVGVLGLAVCLTATTRQRLVLSR* |
Ga0126369_119064782 | 3300012971 | Tropical Forest Soil | VLQIVITLTVTGGLTDLTLRDAGVLGLALCLTGSSRQRAVLTG* |
Ga0164307_101142951 | 3300012987 | Soil | LLLQIVASLTMSNGLSDLVLRDVGVLGLAVCLTATTRQRLVLRG* |
Ga0157370_114414061 | 3300013104 | Corn Rhizosphere | ALSAVLLLEIVISLTLAGGLSDLSVRDLGVLGLAVGLTAATRQRLVLRG* |
Ga0182036_104811541 | 3300016270 | Soil | SLAASGISDTTLRDLGVLGLAIVLTGSERQRLVLRG |
Ga0182039_110691491 | 3300016422 | Soil | AALASVLLLEIVISLAASGISDTTLRDLGVLGLAIVLTGSERQRLVLRG |
Ga0187802_102502151 | 3300017822 | Freshwater Sediment | MLLEIVIALTVSGGLSDLVLRDVGVLGLALAVVGQRHDRLVLRH |
Ga0187820_10713341 | 3300017924 | Freshwater Sediment | AAAVASVLLLEIVISLAVTGAAETTARDIGVLGLAVCLTGCKNQRLVLRG |
Ga0187820_10873823 | 3300017924 | Freshwater Sediment | SVLLLEIVISLAVTGLDATAVRDVGVLGLAVCLTGGKNQRLVLRN |
Ga0187820_11708201 | 3300017924 | Freshwater Sediment | PRVAAAIASLLMLEIVISLAATGLSDTALRDVGVLGLAVCLTGCQNQRLVLRT |
Ga0187806_11014002 | 3300017928 | Freshwater Sediment | VSAAIASVLLLEIVINLSVSGLSDTSLRDLGVLGLAICLTGCRDQRLRLRG |
Ga0187814_101955932 | 3300017932 | Freshwater Sediment | ALASLLMLEIVISLAATGLSDTALRDVGVLGLAVCLTGCQNQRLVLRT |
Ga0187809_101620631 | 3300017937 | Freshwater Sediment | RAAAAAAAVLLLEIVAGLTVSGGLSDLTLRDVGVLGLAICLTGHTRQRLVLRG |
Ga0187809_101746571 | 3300017937 | Freshwater Sediment | RAAAALASLLMLEIVISLAATGLSDTALRDVGVLGLAVCLSGCQNQRLVLRT |
Ga0187808_102660851 | 3300017942 | Freshwater Sediment | LLQIVVSLTITAGLSDLTLRDVGVLGLAICLVGDRKQRLVLTG |
Ga0187817_102383061 | 3300017955 | Freshwater Sediment | MPRAAAAVASVLLLEIVISLAATGVSDTVMRDVGVLGLAVCLTGCRNQRLVLRG |
Ga0187781_114974022 | 3300017972 | Tropical Peatland | VISLAATGLSDTALRDVGVLGLALCLIGSKNQHLVLRG |
Ga0187777_102949571 | 3300017974 | Tropical Peatland | ITLAITGGLTDLTLRDVGVLGLAICVAGNTRQRLVLTS |
Ga0187777_106931242 | 3300017974 | Tropical Peatland | VLLLEIVISLAVTGVSATAVRDVGVLGLAVCLTGCPNQRLALRS |
Ga0187822_103215922 | 3300017994 | Freshwater Sediment | LAAAVASMVLLEIVISLAVTGLSPTALRDLGVLGLAVCLTGCKNQRLVLRG |
Ga0187816_103799771 | 3300017995 | Freshwater Sediment | IVISLAVTGLDATAVRDVGVLGLAVCLTGGKNQRLVLRN |
Ga0187815_100235754 | 3300018001 | Freshwater Sediment | RLGGAIAALLLLQIVVSLTITAGLSDLTLRDVGVLGLAICLVGDRKQRLVLTG |
Ga0187805_106310802 | 3300018007 | Freshwater Sediment | LAQIVIWLTATAGLSDLTLRDVGVLGLALCIAGSTEQRLTLAS |
Ga0187871_104155162 | 3300018042 | Peatland | VAMTGQSPTALRDIGVLGLAVCLTGVRHQRLVLRN |
Ga0187765_102599673 | 3300018060 | Tropical Peatland | LEIVIALAATGLSDTALRDLGVLGLAVCLTGVREHHLVLRD |
Ga0187771_105628451 | 3300018088 | Tropical Peatland | VASVLLLEIVISLSVTGLSDTAFRDLGVLGLALCLTGCKNQRLVLRA |
Ga0193729_10167755 | 3300019887 | Soil | MAVSAALLLEIVISLAVTGGLSDLTLRDVGVLGLAVCLTGIPQQRLLLARPGAGGPRR |
Ga0206354_106097771 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | IAPRTAAAIAAVMLLEIVISLSATAGLSDLTLRDVGVLGLAVGLTGCTRHRLVLRG |
Ga0206353_116340212 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | VISLSATAGLSDLTLRDVGVLGLAVGLTGCTRHRMVLRG |
Ga0210407_108158792 | 3300020579 | Soil | IASVLLLEIVISLVVTGVSDTALRDLGVLGLAVCLTGCKNQRLVLRG |
Ga0210399_101237272 | 3300020581 | Soil | MGSNGRTAGLPDLTLRDVGVLGLAICLTGRTRPRLVLRG |
Ga0210399_105127652 | 3300020581 | Soil | MGSNGWTAGLPDLMLRDVGVLGLAICLTGHTRPRLVL |
Ga0210395_100560907 | 3300020582 | Soil | VATVLMLEIVIAVAVTGQSPTALRDVGVLGLAVCLTGIRHQRLVLRN |
Ga0210408_106391932 | 3300021178 | Soil | IVIWLTATAGLSDLTLRDAGVLGLALCIAGSTEQRLTLAS |
Ga0210396_116939831 | 3300021180 | Soil | GIAPRISAAIASVVLLEIVISLSVSGLSDTSMRDVGVLGLAVVLTGCRNQRLVLRN |
Ga0210393_100264578 | 3300021401 | Soil | LMLEIVIAVAVTGQSPTALRDVGVLGLAVCLTGIRHQRLVLRN |
Ga0210385_113556252 | 3300021402 | Soil | PRISAAIASVLLLEIVISLSVSGLSDTSMRDVGVLGLAVVLTGCRNQRLALRN |
Ga0210397_104751292 | 3300021403 | Soil | AAAVVAILLLEIVISLTVTAGLSDLTLRDVGVLGLAIALTGPSEQRLTLTR |
Ga0210386_101931012 | 3300021406 | Soil | RASAAVASVLMLEIVISLSVSGLSDTSMRDVGVLGLAICLTGCRNQRLVLRG |
Ga0210409_109140832 | 3300021559 | Soil | MTRLTTAAPGVSDTALRDLGALGLAVCLTGCKNQRLVLRG |
Ga0126371_111937161 | 3300021560 | Tropical Forest Soil | IAAAITTVTLLEIVISLTVTAGPSDLVLRDLGVLGLAICLTGITQQRLVLRR |
Ga0126371_131005202 | 3300021560 | Tropical Forest Soil | AAVVALLLAQIVIWLTIKAGLSDLTLRDVGVLGLSLCMTGTAEQRFVLAS |
Ga0208357_10034271 | 3300025703 | Arctic Peat Soil | AAVLLLEIVISLAVTGGLSDLTLRDVGVLGLAVCLTGRSIQRLVLTG |
Ga0207684_101805493 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | ASVLLLEIVISLSVSGLSDTSMRDVGVLGLAVVLTGCRNQRLLLRD |
Ga0207661_117404671 | 3300025944 | Corn Rhizosphere | GITPRTAAAIAAVMLLEIVISLAATGGLSDLTLRDVGVLGLAVGLTGCTRHRMVLRG |
Ga0209871_100064211 | 3300026217 | Permafrost Soil | AAAAAAAVLLLEIVISLAVTGGLSDLTLRDVGVLGLAVCLTGRSIQRLVLTG |
Ga0209648_104193941 | 3300026551 | Grasslands Soil | LLLLQIVVWLTISAGLSDLTLRDVGVLGLAVCLMGSREQRLVLTS |
Ga0207745_10230022 | 3300026889 | Tropical Forest Soil | AAAIASVLLLEIVISLAVSGLSDTTLRDLGVLGLALCLTGCRNQRLVLRT |
Ga0208488_10549592 | 3300027110 | Forest Soil | SVLMLEIVISLAATGLSDTALRDVGVLGLAVCLVGSKNQRLVLRS |
Ga0208488_10666811 | 3300027110 | Forest Soil | SVLMLEIVISLAATGLSDTALRDVGVLGLAVCLVGSKNQHLVLRS |
Ga0209524_10987852 | 3300027521 | Forest Soil | LEIVISLAVTGGLSDLTLRDVGVLGLAVCLTGISHQRLALRR |
Ga0209448_100671163 | 3300027783 | Bog Forest Soil | VISLVVTGVSDTALRDLGVLGLAVCLTGCKNQRLVLRG |
Ga0209139_100679561 | 3300027795 | Bog Forest Soil | AAIASVLLLEIVISLVVTGVSDTALRDLGVLGLAVCLTGCKNQRLVLRG |
Ga0209693_102616502 | 3300027855 | Soil | AVASVLLLEIVIALAATGVSDTALRDLGVLGLAVCLTGCQNQRLVLRG |
Ga0209166_101338651 | 3300027857 | Surface Soil | ISLTVNGGLSDLTMRDVGVLGLAVLLSSGTRQRLTLTR |
Ga0209701_104788121 | 3300027862 | Vadose Zone Soil | VISLTVTGGLSDLTLRDVGVLGLAVCLTAATRQRLVLSR |
Ga0209579_100587575 | 3300027869 | Surface Soil | AAAALASLLMLEIVISLAATGLSDTALRDVGVLGLAVCLTGGQNQRLVLRT |
Ga0209275_107156662 | 3300027884 | Soil | VLLLEIVIALAVNGLSDTTLRDLGVLGLALCLTGSTNQRLVLRN |
Ga0209275_109230241 | 3300027884 | Soil | ASVLLLEIVISLAVTGVSDTALRDLGVLGLAVCLTGCQNQRLLLRG |
Ga0209415_103943151 | 3300027905 | Peatlands Soil | IASLLMLEIVIALAATGLSDTALRDVGVLGLAVCLTGCKNQRLVLRT |
Ga0209698_101153574 | 3300027911 | Watersheds | LLEIVVSLTVTAGLSDLVLRDLGVLGLAICLTGITQHRLVLRR |
Ga0265353_10162212 | 3300028015 | Soil | EIVIAVAVTGQSPTALRDVGVLGLAVCLTGVRHQRLVLRN |
Ga0302223_101479632 | 3300028781 | Palsa | ASVLLLEITISLAVTGQSPTALRDVGVLGLAVCLTGCKNQRLALRN |
Ga0308309_118545721 | 3300028906 | Soil | AAAAIASVLLLEIVISLVVTGVSDTALRDLGVLGLAVCLTGCKNQRLVLRG |
Ga0311333_100954203 | 3300030114 | Fen | LTITNGLSDLVLRDVGVLGLAVCLTAATRQRLVLTG |
Ga0310037_101440201 | 3300030494 | Peatlands Soil | IVIAVAMTGQSPTALRDVGVLGLAVCLTGVRHQRLVLRN |
Ga0310038_102020371 | 3300030707 | Peatlands Soil | PRAAAALASLLMLEIVISLAVTGLSDTALRDVGVLGLAVCLTGCKNQRLVLRN |
Ga0318571_101969832 | 3300031549 | Soil | LTEIVISLLASGGWSDLVMRDVGVLGLAVSLTGSARHRLVLR |
Ga0318573_100384901 | 3300031564 | Soil | AAAAIASVLLLEIVISLAVTGLSDTTLRDLGVLGLALCLTGCKNQRLVLRT |
Ga0318573_101282294 | 3300031564 | Soil | VLLLKIVISLAVTGLSDTALRDLGVLGLAVCLTGCQNQRPVLR |
Ga0310915_102658471 | 3300031573 | Soil | AAVLLLEIVISLTISGGLSDLTLRDAGVLGLAITLTGVSQRRLVLRH |
Ga0318561_102883732 | 3300031679 | Soil | IVISLAVTGLSDTTLRDLGVLGLALCLTGCKNQRLVLRT |
Ga0318560_106426282 | 3300031682 | Soil | VEIVISLAVTGLSPTALRDLGVLGLAVCLTGCKNQRLVLRG |
Ga0310686_1009711982 | 3300031708 | Soil | VIALAATGLSDTALRDVGVLGLALCLVGSKNQHLVLRG |
Ga0310686_1134966601 | 3300031708 | Soil | AIASLLLLEIVIALAATGLSDTALRDLGVLGLAVCLTGCKNQRLVLRG |
Ga0307477_104560281 | 3300031753 | Hardwood Forest Soil | VALLEIVISLAVTGLSPTALRDVGVLGLAVCLTGCKNQRLVLRG |
Ga0318554_100071171 | 3300031765 | Soil | ASVLMLEIVISLSVSGLSDTSMRDVGVLGLAICLTGCRTHRLTLRG |
Ga0318498_104261601 | 3300031778 | Soil | VISLAVTGLSDTALRDLGVLGLAVCLTGCQNQRPVLRN |
Ga0318552_100002171 | 3300031782 | Soil | VISLTISGGLSDLTLRDAGVLGLAITLTGVSQRRLVLRH |
Ga0318565_104926402 | 3300031799 | Soil | EIVISLAVTGLSPTALRDVGVLGLAVCLTGCKNQRLVLRG |
Ga0318564_101063681 | 3300031831 | Soil | SVLLLEIVISLAVTGLSDTTLRDLGVLGLALCLTGCKNQRLVLLT |
Ga0318564_104863831 | 3300031831 | Soil | LLEIIISLTVTAGLSDLTMRDVGVLGLAVCLTGLSHQRLALRR |
Ga0318512_100201784 | 3300031846 | Soil | LLAALLLAEIVISLTISGGLSDLTMRDAGVLGLAITLTGVSQRRLVLRR |
Ga0318495_101756422 | 3300031860 | Soil | IVISLTISGGLSDLTLRDAGVLGLAITLTGVSQRRLVLRR |
Ga0318522_100265761 | 3300031894 | Soil | VLLAEIVISLTISGGLSDLTLRDAGVLGLAITLTGVSQRRLVLRR |
Ga0318520_100643784 | 3300031897 | Soil | LLLEIVISLAVTGLSDTTLRDLGVLGLALCLTGCKNQRLVLRT |
Ga0318520_103917411 | 3300031897 | Soil | VLLLEIVISLTISGGLSDLTLRDAGVLGLAITLTGVSQRRLVLRH |
Ga0302322_1004736023 | 3300031902 | Fen | TITNGLSDLVLRDVGVLGLAVCLTAATRQRLVLIG |
Ga0306923_114886422 | 3300031910 | Soil | APRAAAAIASVLLLEIVISLAASGLSDTALRDLGVLGLALCLTGCQNQRLVLRT |
Ga0310916_101774951 | 3300031942 | Soil | TAVLLLEIVIGLTVTAGLSDLTLRDVGVLGLAVCLTGRTRQRFVLRG |
Ga0310909_106008611 | 3300031947 | Soil | NSLTISGGLSDLTLRDAGVLGQAITLTGVSQRRLVLRH |
Ga0307479_108230692 | 3300031962 | Hardwood Forest Soil | LLEIVISLTVTGGLSDLTLRDVGVLGLAIGLTGRHTQRLVLSR |
Ga0318559_102874061 | 3300032039 | Soil | AALASVLLLEIVISLAVSGISDTTLRDLGVLGLAIVLTGCERQRLVLRG |
Ga0318570_104698311 | 3300032054 | Soil | AIASVLLLEIVISLSVSGLTDTSMRDVGVLGLAICLTGCRTHRLALRG |
Ga0318575_104870331 | 3300032055 | Soil | VAAALASVLLLEIVISLAASGISDTTLRDLGVLGLAIVLTGSERQRLVLRG |
Ga0318514_107926642 | 3300032066 | Soil | AAAAAAAALLLEIVAGLTVTGGLSDLTLRDVGVLGLAICLTGRTRQRLVLRG |
Ga0318518_107316941 | 3300032090 | Soil | LEIVVSLTVTAGLSDLVLRDLGVLGLAICLTAITQQRLVLRR |
Ga0311301_105071244 | 3300032160 | Peatlands Soil | IVISLAVTGLSPTALRDIGVLGLAVCLTGCKNQRLVLRG |
Ga0311301_121444582 | 3300032160 | Peatlands Soil | ASVLMLEIVIAVAMTGQSPTALRDIGVLGLAVCLTGVRHQRLVLRN |
Ga0335074_114263902 | 3300032895 | Soil | VLLLEIVISLSVSGLSDTSMRDVGVLGLAVVLTGCRDQRLVLRN |
Ga0335083_105901562 | 3300032954 | Soil | IAPRISAAIASVLLLEIVISLMVSGLSDTSMRDVGVLGLAVVLAGCRNQRLVLRN |
Ga0318519_102444801 | 3300033290 | Soil | EIVISLTISGGLSDLTLRDAGVLGLAITLTGVSQRRLVLRH |
Ga0314864_0155817_467_583 | 3300033805 | Peatland | VSLAATAGLSDLVLRDLGVLGLAVCLTGVTQQRLVLRR |
⦗Top⦘ |