NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F057417

Metagenome / Metatranscriptome Family F057417

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F057417
Family Type Metagenome / Metatranscriptome
Number of Sequences 136
Average Sequence Length 174 residues
Representative Sequence MQYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLSEEYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLGEEQEYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLGEEQEYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKED
Number of Associated Samples 120
Number of Associated Scaffolds 136

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 5.26 %
% of genes near scaffold ends (potentially truncated) 64.71 %
% of genes from short scaffolds (< 2000 bps) 83.82 %
Associated GOLD sequencing projects 112
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (83.824 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(18.382 % of family members)
Environment Ontology (ENVO) Unclassified
(44.853 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(86.765 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 5.21%    β-sheet: 26.56%    Coil/Unstructured: 68.23%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 136 Family Scaffolds
PF00226DnaJ 0.74



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.82 %
UnclassifiedrootN/A16.18 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005941|Ga0070743_10267596All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum554Open in IMG/M
3300006029|Ga0075466_1154001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum590Open in IMG/M
3300006355|Ga0075501_1234143All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum616Open in IMG/M
3300006390|Ga0075509_1409206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum580Open in IMG/M
3300006394|Ga0075492_1318946All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum554Open in IMG/M
3300006394|Ga0075492_1324746All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum671Open in IMG/M
3300006396|Ga0075493_1344189All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum670Open in IMG/M
3300006396|Ga0075493_1400832All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum587Open in IMG/M
3300006419|Ga0075496_1261631All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum593Open in IMG/M
3300006424|Ga0075497_1321456All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum563Open in IMG/M
3300006424|Ga0075497_1419994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum579Open in IMG/M
3300006803|Ga0075467_10406261All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum708Open in IMG/M
3300006850|Ga0075491_1336750All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum573Open in IMG/M
3300007545|Ga0102873_1185042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum626Open in IMG/M
3300007554|Ga0102820_1081228All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum779Open in IMG/M
3300007558|Ga0102822_1148040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum555Open in IMG/M
3300007621|Ga0102872_1085929All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum847Open in IMG/M
3300008930|Ga0103733_1040837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum734Open in IMG/M
3300008933|Ga0103736_1029541All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum710Open in IMG/M
3300008937|Ga0103740_1007081All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1123Open in IMG/M
3300008938|Ga0103741_1060847All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum736Open in IMG/M
3300008996|Ga0102831_1289544All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum541Open in IMG/M
3300009002|Ga0102810_1118161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum822Open in IMG/M
3300009071|Ga0115566_10442361All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum744Open in IMG/M
3300009263|Ga0103872_1009122All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum978Open in IMG/M
3300009263|Ga0103872_1069638All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum539Open in IMG/M
3300009265|Ga0103873_1089334All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum624Open in IMG/M
3300009508|Ga0115567_10949892All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300009599|Ga0115103_1526988All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum862Open in IMG/M
3300009606|Ga0115102_10104539All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum674Open in IMG/M
3300009606|Ga0115102_10930331All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum571Open in IMG/M
3300010309|Ga0102890_1114292All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum558Open in IMG/M
3300012036|Ga0136600_1081991All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum727Open in IMG/M
3300012471|Ga0129334_1005459All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum515Open in IMG/M
3300012472|Ga0129328_1009346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum857Open in IMG/M
3300012962|Ga0129335_1062427All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum630Open in IMG/M
3300012962|Ga0129335_1154193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum584Open in IMG/M
3300012967|Ga0129343_1327261All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum620Open in IMG/M
3300012968|Ga0129337_1052173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum564Open in IMG/M
3300012968|Ga0129337_1102901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum643Open in IMG/M
3300012970|Ga0129338_1225029All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum602Open in IMG/M
3300012970|Ga0129338_1234147All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum686Open in IMG/M
3300016703|Ga0182088_1231337All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum750Open in IMG/M
3300016726|Ga0182045_1380861All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum654Open in IMG/M
3300016732|Ga0182057_1500852All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum528Open in IMG/M
3300016737|Ga0182047_1313450All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum535Open in IMG/M
3300016740|Ga0182096_1235495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum793Open in IMG/M
3300016748|Ga0182043_1299940All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum631Open in IMG/M
3300016766|Ga0182091_1415309All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum599Open in IMG/M
3300017280|Ga0186684_116329All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum721Open in IMG/M
3300017697|Ga0180120_10178994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum887Open in IMG/M
3300017746|Ga0181389_1147353All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum628Open in IMG/M
3300017818|Ga0181565_10344917All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum992Open in IMG/M
3300017824|Ga0181552_10454509All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum607Open in IMG/M
3300017951|Ga0181577_10607999All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum673Open in IMG/M
3300018048|Ga0181606_10216511All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1103Open in IMG/M
3300018420|Ga0181563_10416808All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum764Open in IMG/M
3300018426|Ga0181566_10389989All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum992Open in IMG/M
3300018832|Ga0194240_1025601All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum574Open in IMG/M
3300018876|Ga0181564_10370140All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum785Open in IMG/M
3300018885|Ga0193311_10021848All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum879Open in IMG/M
3300018968|Ga0192894_10222219All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum629Open in IMG/M
3300018980|Ga0192961_10263233All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum503Open in IMG/M
3300018982|Ga0192947_10218383All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum622Open in IMG/M
3300019001|Ga0193034_10099221All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum667Open in IMG/M
3300019001|Ga0193034_10190090All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum513Open in IMG/M
3300019010|Ga0193044_10221957All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum592Open in IMG/M
3300019021|Ga0192982_10307254All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum569Open in IMG/M
3300019025|Ga0193545_10140568All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum515Open in IMG/M
3300019031|Ga0193516_10184986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum695Open in IMG/M
3300019031|Ga0193516_10227647All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum612Open in IMG/M
3300019032|Ga0192869_10319415All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum678Open in IMG/M
3300019036|Ga0192945_10160498All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum724Open in IMG/M
3300019045|Ga0193336_10570046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum554Open in IMG/M
3300019085|Ga0188830_1011673All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum711Open in IMG/M
3300019261|Ga0182097_1163097All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum517Open in IMG/M
3300019283|Ga0182058_1520565All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum650Open in IMG/M
3300020014|Ga0182044_1374205All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum563Open in IMG/M
3300021359|Ga0206689_11118211All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum640Open in IMG/M
3300021896|Ga0063136_1058586All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum625Open in IMG/M
3300021908|Ga0063135_1059810All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum808Open in IMG/M
3300021962|Ga0222713_10398605All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum847Open in IMG/M
3300021962|Ga0222713_10407197All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum835Open in IMG/M
3300022929|Ga0255752_10250959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum785Open in IMG/M
3300023709|Ga0232122_1091435All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum712Open in IMG/M
3300025508|Ga0208148_1105885All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum599Open in IMG/M
3300025570|Ga0208660_1083081All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum728Open in IMG/M
3300025690|Ga0209505_1116181All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum743Open in IMG/M
3300025887|Ga0208544_10353669All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum558Open in IMG/M
3300026403|Ga0247557_1046393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum511Open in IMG/M
3300026447|Ga0247607_1052877All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum709Open in IMG/M
3300026465|Ga0247588_1056864All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum771Open in IMG/M
3300026495|Ga0247571_1095924All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum688Open in IMG/M
3300026500|Ga0247592_1162540All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum531Open in IMG/M
3300027159|Ga0208020_1045987All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum822Open in IMG/M
3300027525|Ga0208437_1092124All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum701Open in IMG/M
3300027571|Ga0208897_1123142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum652Open in IMG/M
3300027757|Ga0208671_10276257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum595Open in IMG/M
3300028137|Ga0256412_1338615All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum552Open in IMG/M
3300028282|Ga0256413_1341437All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300028334|Ga0247597_1059937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum522Open in IMG/M
3300030670|Ga0307401_10321250All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum703Open in IMG/M
3300030699|Ga0307398_10566417All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum628Open in IMG/M
3300031036|Ga0073978_1012231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum641Open in IMG/M
3300031569|Ga0307489_10519079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum812Open in IMG/M
3300031729|Ga0307391_10652870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum598Open in IMG/M
3300031735|Ga0307394_10396397All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum552Open in IMG/M
3300032470|Ga0314670_10665296All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum535Open in IMG/M
3300032617|Ga0314683_10655237All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum643Open in IMG/M
3300032727|Ga0314693_10737199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum529Open in IMG/M
3300032730|Ga0314699_10499567All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum547Open in IMG/M
3300032733|Ga0314714_10683011All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum562Open in IMG/M
3300032734|Ga0314706_10601232All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum525Open in IMG/M
3300033572|Ga0307390_10726942All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum623Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous18.38%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine16.91%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh16.18%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine9.56%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine6.62%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater6.62%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater5.15%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine3.68%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water2.94%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica2.94%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine2.21%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.47%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine1.47%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.47%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.74%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.74%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.74%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.74%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake0.74%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.74%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004784Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006355Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006390Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006394Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006396Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006419Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006424Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006850Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007545Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3EnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300007558Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733EnvironmentalOpen in IMG/M
3300007621Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3EnvironmentalOpen in IMG/M
3300007667Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3EnvironmentalOpen in IMG/M
3300008835Eukaryotic communities of water from the North Atlantic ocean - ACM44EnvironmentalOpen in IMG/M
3300008930Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1BEnvironmentalOpen in IMG/M
3300008933Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2BEnvironmentalOpen in IMG/M
3300008937Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3CEnvironmentalOpen in IMG/M
3300008938Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4AEnvironmentalOpen in IMG/M
3300008996Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747EnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009508Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010309Estuarine microbial communities from the Columbia River estuary - metaG 1552A-3EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300012036Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #698EnvironmentalOpen in IMG/M
3300012471Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012472Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012766Freshwater microbial communities from Lake Montjoie, Canada - M_140807_M_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012962Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012967Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012968Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012970Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016703Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041407CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016726Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011504BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016732Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101403AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016737Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011506CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016740Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413YT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016748Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011502CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016766Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041409AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017280Metatranscriptome of coastal eukaryotic communities from Ligurian Sea in autoclaved artificial seawater, 19 C, 33 psu salinity and 638 ?mol photons light - Strombidium inclinatum S3 (MMETSP0208)Host-AssociatedOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017957Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018048Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018418Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018832Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000852 (ERX1782372-ERR1712031)EnvironmentalOpen in IMG/M
3300018876Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018885Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001654 (ERX1789521-ERR1719396)EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019025Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399745-ERR1328126)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019085Metatranscriptome of marine microbial communities from Baltic Sea - GS670_3p0_dTEnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019261Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413BS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019283Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101404CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020014Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011503CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021896Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S13 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021908Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S11 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022929Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaGEnvironmentalOpen in IMG/M
3300022934Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaGEnvironmentalOpen in IMG/M
3300023709Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025508Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025570Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025690Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026403Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 2R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026447Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 125R_r (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027159Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 (SPAdes)EnvironmentalOpen in IMG/M
3300027320Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes)EnvironmentalOpen in IMG/M
3300027525Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 (SPAdes)EnvironmentalOpen in IMG/M
3300027571Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes)EnvironmentalOpen in IMG/M
3300027753Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes)EnvironmentalOpen in IMG/M
3300027757Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028334Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 68R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031036Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_X_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032727Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032730Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032733Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032734Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032750Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0007744_129159413300004784Freshwater LakeITKRHHQESSYEPGWGHNSGDSYNNGPTTHFYYGKASPYSVVKEDVQVDEQEGYEPLWGHDSGDSYNNGPTTHFYYGKASPYSVIKEDVQLEDKSEYEPLWGHDSGDSYNNGPTTHFYYGKASPYSVIKEDVQLDE*
Ga0070743_1026759613300005941EstuarineMQYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLDAQQEYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQVGEEMAYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLGEEMAYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKED*
Ga0075466_115400113300006029AqueousPIKFNKYCIIYKMKYTLAAILLAGASAHKHHHRKGLKQELNKKYEWEWGHNSGDSYNNGPTTHFAHGKASPYSVTKEDVQLDQKQGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSVVKEDVQLDEKNGQGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSVIKEDVQLDAKEGNGYEWEWGHNSGNSYDNGPFTH
Ga0075501_123414313300006355AqueousIAVCLVAGSAEAVQKHHRHTLKRALSTKYEPEWGHNSGNSYNNGPTTHFYHGKASPYSVTKEDVQLEESASYEPGWGHNSGNSYHNGPFTHFYHGKASPYSVVKEDVQLDSSYEPGWGHNSGNSYHNGPFTHFYHGKASPYSVVKEDVQLESKVAYEPEWGHNSGNSYNNGPFTHFYHGKASPFSVLKED*
Ga0075509_140920613300006390AqueousAVLVASTEAIQKKHHKHHSLKQNLEEKYEPGWGHNSGNSYHNGPTTNFYHGKASPYSVTKEDVQLEGEAKYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVLKEDVQLEGEAKYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVLKEDVQLEDKVNYEPEWGHNSGNSYNNGPFTHFYWGKASPYSVLKED*
Ga0075492_131894613300006394AqueousLNQLKDKNYEPEWGHNSGNSYNNGPTTHFYHGKASPYSVTKEDVQLDNQNGYEWEWGHNSGNSYNNGPFTHFYHGKASPYIVVKEDVQLEDKQALGYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVVKEDVQLDDKQGADYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVVKED*
Ga0075492_132474613300006394AqueousMKYTLAAILLAGASAHKHHHRKGLKQELNKKYEWEWGHNSGDSYNNGPTTHFAHGKASPYSVTKEDVQLDQKQGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSVVKEDVQLDEKNGQGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSVIKEDVQLDAKEGNGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSVLKED*
Ga0075493_134418913300006396AqueousYKMKYTLAAILLAGASAHKHHHRKGLKQELNKKYEWEWGHNSGDSYNNGPTTHFAHGKASPYSVTKEDVQLDQKQGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSVVKEDVQLDEKNGQGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSVIKEDVQLDAKEGNGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSVLKED*
Ga0075493_140083213300006396AqueousALLVAGCSAHKLNQLKDKNYEPEWGHNSGNSYNNGPTTHFYHGKASPYSVTKEDVQLDNQNGYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVVKEDVQLEDKQAQGYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVVKEDVQLDDKQGADYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVVKED*
Ga0075496_126163113300006419AqueousYIALLVAGFAAHKLNQLKDKNYEPEWGHNSGNSYNNGPTTHFYHGKASPYSVTKEDVQLDNQNGYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVVKEDVQLEDKQAQGYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVVKEDVQLDDKQGADYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVVKED*
Ga0075497_132145613300006424AqueousAHKLNQLKDKNYEPEWGHNSGNSYNNGPTTHFYHGKASPYSVTKEDVQLDNQNGYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVVKEDVQLEDKQALGYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVVKEDVQLDDKQGADYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVVKED*
Ga0075497_141999413300006424AqueousTLAAILLAGASAHKHHHRKGLKQELNKKYEWEWGHNSGDSYNNGPTTHFAHGKASPYSVTKEDVQLDQKQGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSVVKEDVQLDEKNGQGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSVIKEDVQLDAKEGNGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSV
Ga0075467_1040626113300006803AqueousMKYIALLVAGFAAHKLNQLKDKNYEPEWGHNSGNSYNNGPTTHFYHGKASPYSVTKEDVQLDNQNGYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVVKEDVQLEDKQAQGYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVVKEDVQLDDKQGADYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVVKED*
Ga0075491_133675013300006850AqueousLLAGASAHKHHHRKGLKQELNKKYEWEWGHNSGDSYNNGPTTHFAHGKASPYSVTKEDVQLDQKQGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSVVKEDVQLDEKNGQGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSVIKEDVQLDAKEGNGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSVLKE
Ga0075473_1046084813300006875AqueousKASPYSVTKEDVQIDDEPGWGHNSGNSYHNGPFTNFYHGKASPYSVIKEDVQIGEQYEPGWGHNSGNSYHNGPFTNFYHGKASPYSVLKEDVQLESTVEYEPGWGHNSGNSYHNGPFTNFYHGKASPFSVLKED*
Ga0102873_118504213300007545EstuarineMKYIALFIAGAFAHKHSHRKTLKQTYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVTKEDVQLEKSYEPEWGHNSGNSYNNGPTTHFYHGKASPYSVVNEDVQVDADQKYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLDNQEGYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDV*
Ga0102820_108122813300007554EstuarineFIAGAFAHKHSHRKTLKQTYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVTKEDVQLEKSYEPEWGHNSGNSYNNGPTTHFYHGKASPYSVVNEDVQVDADQKYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLDNQEGYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDV*
Ga0102822_114804013300007558EstuarineEWGHNSGNSYNNGPFTHFYHGKASPYSVTKEDVQLEKSYEPEWGHNSGNSYNNGPTTHFYHGKASPYSVVNEDVQVDADQKYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLDNQEGYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDV*
Ga0102872_108592913300007621EstuarineMKYIALFIAGAFAHKHSHRKTLKQTYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVTKEDVQLEKSYEPEWGHNSGNSYNNGPTTHFYHGKASPYSVVNEDVQVDADQKYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKENVQHDNQEGYEWEWGHNSGKSYNNGPFTHFYHGKASPYSVIKEDV*
Ga0102910_116056813300007667EstuarineYSVIKEDVQLDAQQEYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQVGEEMAYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLGEEMAYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKED*
Ga0103883_105460113300008835Surface Ocean WaterPYSVIKEDVQLDASQEYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLGEQMEYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLGEEMEYEPEWGHNSGNSYNNGPTTHFYHGKASPYSVIKED*
Ga0103733_104083713300008930Ice Edge, Mcmurdo Sound, AntarcticaFSYNNGPFAHFYAGKASPYSVTKEDLQIAENQGYEADWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLDDKYEADWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLEDKVAYEADWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQVGEQMNLGEGYEAEWGHNSGDSYNNGPFTHFYLGKASPYSVIKED*
Ga0103736_102954113300008933Ice Edge, Mcmurdo Sound, AntarcticaEWGHNSGDSYNNGPFTHFYAGKASPYSVTKEDLQIAENQGYEADWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLDDKYEADWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLEDKVAYEADWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQVGEQMNLGEGYEAEWGHNSGDSYNNGPFTHFYLGKASPYSVIKED*
Ga0103740_100708113300008937Ice Edge, Mcmurdo Sound, AntarcticaLQIAENQGYEADWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLDDKYEADWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLEDKVAYEADWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQVGEQMNLGEGYEAEWGHNSGDSYNNGPFTHFYLGKASPYSVIKED*
Ga0103741_106084713300008938Ice Edge, Mcmurdo Sound, AntarcticaHNSGDSYNNGPFTHFYAGKASPYSVTKEDLQIAENQGYEADWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLDDKYEADWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLEDKVAYEADWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQVGEQMNLGEGYEAEWGHNSGDSYNNGPFTHFYLGKASPYSVIKED*
Ga0102831_128954413300008996EstuarineMKYIALFIAGAFAHKHSHRKTLKQTYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVTKEDVQLEKSYEPEWGHNSGNSYNNGPTTHFYHGKASPYSVVNEDVQVDADQKYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLDNQEGYEWEWGHNSGN
Ga0102810_111816123300009002EstuarineMKYAIIAALFLAGTTEAIQKKHHHSLKKSIEKKYEPEWAHNSGNSYNNGPTTHFYHGKASPYSVTKEDVQLEDKSQFEPGWVHNSGNSYNNGPFTNFYHGKASPYSVVKEDVQLEDKASFEPGWVHNTGNSYNNGPFTNFYHGKASPYSVVKEDVQLSAETEFEPGWVHNTGNSYNNGPFTNFYHGKASPYSVLKED*
Ga0115566_1044236113300009071Pelagic MarineMQYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLDAKQEYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQVGEEMAYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLGEEMAYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKED*
Ga0103872_100912223300009263Surface Ocean WaterMQYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLDASQEYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLGEQMEYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLGEEMEYEPEWGHNSGNSYNNGPTTHFYHGKASPYSVIKED*
Ga0103872_106963823300009263Surface Ocean WaterYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLSEEYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLGEEQEYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLGEEQEYEPEWGHNSGNSYNNGPFTHFYHGKASP*
Ga0103873_108933413300009265Surface Ocean WaterMQYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLSEEYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLGEEQEYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLGEEQEYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKED*
Ga0115563_136492813300009442Pelagic MarineKEDVQLDAKQEYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQVGEEMAYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLGEEMAYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKED*
Ga0115567_1083289513300009508Pelagic MarineYHGKASPYSVIKEDVQLDAKQEYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQVGEEMAYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLGEEMAYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKED*
Ga0115567_1094989213300009508Pelagic MarineEYEPEWGHNSGNSYNNGPFTHFYHGKASPYNVNMDDGLDVQVNQKVTYEPEWGHNSGNSYNNGPFTHFYHGKASPYNVNMDDGLDVQVGAKVAYEPEWGHNSGNSYNNGPFTHFYHGKASPYNVNMDDGLDVQLKEKIAYEPEWGHNSGNSYNNGPFTHFYHGKASPYN
Ga0115103_152698823300009599MarineLLAGVDAKHHHHKQKKAKTLKQHYEPEWGHNSGNSYNNGPTTHFAHGKASPYKVTKDDVQVEDKYEPEWGHNSGNSYNNGPFTHFAFGKASPYKVTKDDLQLEDKYEPEWGHNSGNSYNNGPFTHFAFGKASPYKVTKDDIQLKQEYEPEWGHNSGNSYNNGPFTHFAFGKASPYKVTKDDVQLGE*
Ga0115102_1010453913300009606MarineEWGHNSGDSYNNGPTDHFYHGKASPYSVTKEDLQIGENQGYEADWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLDDKYEADWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLEDKVGYEAEWGHNSGDSYNNGPFTHFYLGKASPYSVIKEDVQLEDKINMGEGYEAEWGHNSGDSYNNGPFTHFYLGKASPYSVIKED*
Ga0115102_1093033113300009606MarineKVAIAALLVVSASAHKHQHRIKNALNKKYETEWGHNSGDSYNNGPTTHFAHGKASPYSVTKEDVQLGEQYETEWGHNSGNSYNNGPFTHFYHGKASPYSVVKEDVQLGEGYETEWGHNSGNSYDNGPFTHFYHGKASPYSVVKEDVQLGEGYETEWGHNSGNSYNNGPFTHFYHGKASPYSVVKEDVQT
Ga0102890_111429213300010309EstuarineMKYIALFIAGAFAHKHSHRKTLKQTYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVTKEDVQLEKSYEPEWGHNSGNSYNNGPTTHFYHGKASPYSVVNEDVQVDADQKYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLDNQEGYEWEWGHNSGNSYNNGP
Ga0138326_1046354013300010985MarineRLILKTKNKYEFEWGHNSGNSYNNGPFTHFAFGKASPYDVTGDDGLEVQTKSDMALENLNRYETEWGHNSGNSYNNGPFTHFAFGKASPYDVTGDDGLEVQLKAETENKQKYEFEWGHNSGNSYNNGPFTHFAFGKASPYDVTGDDGLEVQLDSKVNTGNKYETEWGHNSGNSYN
Ga0136600_108199113300012036Saline LakeMKYIAIACLLASAEAVQKHHKKTLKHALKEKYEPEWGHNSGNSYNNGPTTHFYHGKASPYSVTKEDVQLEENYEPQWGHNSGNSYNNGPFTHFYHGKASPYSVVKEDVQTEEKVNYEPQWGHNSGNSYNNGPFTHFYHGKASPYSVLKEDVQLDSKVDYEPQWGHNSGNSYNNGPFTHFYHGKASPFSVLKED*
Ga0129334_100545913300012471AqueousGNSYNNGPFTHFYHGKASPYSVVKEDVQLESNVDYEPGWGHNSGNSYHNGPFTHFYHGKASPYSVVKEDVQVGEEIHYEPEWGHNSGNSYNNGPFTHFYHGKASPFSVLKEDVQLDSSLDYEPGWGHNSGNSYNNGPFTHFYYGKASPFSVLKED*
Ga0129328_100934623300012472AqueousMDDGLDVQVNQKVTYEPEWGHNSGNSYNNGPFTHFYHGKASPYNVNMDDGLDVQVGAKVAYEPEWGHNSGNSYNNGPFTHFYHGKASPYNVNMDDGLDVQLKEKIAYEPEWGHNSGNSYNNGPFTHFYHGKASPYNVNMDDGLDVQLKEKIAYEPEWGHNSGNSYNNGPFTHFYHGKA
Ga0138282_110842713300012766Freshwater LakeALSVEAIKKRHQHKYEPGWGHNSGDSYNNGPTTHFYYGKASPYSVIKKDVQLEDKTEYEPLWGHDSGDSYNNGPTTHFYYGKASPYSVIKEDVQLDEELNYEPLWGHNSGDSYNNGPTTHFYYGKASPYNVHKEE*
Ga0129335_106242713300012962AqueousIIAACLFAGSAEAIRKHHKKTLKNAVSETYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVVKEDVQLESNVDYEPGWGHNSGNSYHNGPFTHFYHGKASPYSVVKEDVQVGEEIHYEPEWGHNSGNSYNNGPFTHFYHGKASPFSVLKEDVQLDSSLDYEPGWGHNSGNSYNNGPFTHFYYGKASPFSVLKED*
Ga0129335_115419313300012962AqueousKTLKQTYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVTKEDVQLEKSYEPEWGHNSGNSYNNGPTTHFYHGKASPYSVVNEDVQVDADQKYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVINEDVQLNNQEGYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDV*
Ga0129343_132726113300012967AqueousMQYEPEWGHNSGNSYENGPTTHFYHGKASPYSVIKEDVQLSEEYEPEWGHNSGNSYENGPTTHFYHGKASPYSVISEDVQLGEQMKYEPEWGHNSGNSYENGPFSHFYHGKASPYSVIKEDVQLGEQLAYEPEWGHNSGNSYENGPTTHFYHGKASPYSVIKED*
Ga0129337_105217313300012968AqueousAGAFAHKHSHRKTLKQTYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVTKEDVQLEKSYEPEWGHNSGNSYNNGPTTHFYHGKASPYSVVNEDVQVDADQKYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLDNQEGYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDV
Ga0129337_110290113300012968AqueousYIIAACLFAGSAEAIRKHHKKSLKNAVSETYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVVKEDVQLESNVDYEPGWGHNSGNSYHNGPFTHFYHGKASPYSVVKEDVQVGEEIHYEPEWGHNSGNSYNNGPFTHFYHGKASPFSVLKEDVQLDSSLDYEPGWGHNSGNSYNNGPFTHFYYGKASPFSVLKED*
Ga0129338_122502913300012970AqueousYIIAACLFAGSAEAIRKHHKKTLKNAVSETYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVVKEDVQLESNVDYEPGWGHNSGNSYHNGPFTHFYHGKASPYSVVKEDVQVGEEIHYEPEWGHNSGNSYNNGPFTHFYHGKASPFSVLKEDVQLDSSLDYEPGWGHNSGNSYNNGPFTHFYYGKASPFSVLKED*
Ga0129338_123414713300012970AqueousLFIAGAFAHKHSHRKTLKQTYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVTKEDVQLEKSYEPEWGHNSGNSYNNGPTTHFYHGKASPYSVVNEDVQVDADQKYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLDNQEGYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDV*
Ga0182088_123133723300016703Salt MarshVTKDDVQLGEQYEHEWGHNSGDSYNNGPFTHFAHGKASPYKVTKDDVQLGESYEHEWGHNSGDSYANGPFTNFAHGKASPYKVTKDDIQLGEEYEHEWGHNSGNSYNNGPFTHFAHGKASPYKVTKDDVQLGEQYEAEWGHNSGNSYNNGPFTHFAFGKASPYKV
Ga0182045_138086113300016726Salt MarshMQYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLDAQQEYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQVGEEMAYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLGEEMAYEPEWGQNSGNSYNNGPFTHFYHGKASPYNVNKDDGLDV
Ga0182057_150085213300016732Salt MarshMQYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLDAQQEYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQVGEEMAYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLGEEMAYEPEWGQNSGNSYNNGPFTHFYHGK
Ga0182047_131345013300016737Salt MarshKMKYTLAAILLAGASAHKHHHRKGLKQELNKKYEWEWGHNSGDSYNNGPTTHFAHGKASPYSVTKEDVQLDQKQGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSVVKEDVQLDEKNGQGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSVIKEDVQLDAKEGNGYEWEWGHNSGNSY
Ga0182096_123549523300016740Salt MarshVTKDDVQLGEQYEHEWGHNSGDSYNNGPFTHFAHGKASPYKVTKDDVQLGESYEHEWGHNSGDSYANGPFTNFAHGKASPYKVTKDDIQLGEEYEHEWGHNSGNSYNNGPFTHFAHGKASPYKVTKDDVQLGEQYEAEWGHNSGNSYNNGPFTHFAFGKASPYK
Ga0182043_129994013300016748Salt MarshMKYTLAAILLAGASAHKHHHRKGLKQELNKKYEWEWGHNSGDSYNNGPTTHFAHGKASPYSVTKEDVQLDQKQGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSVVKEDVQLDEKNGQGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSVIKEDVQLDAKEGNGYEWEWGHNSGNSYDNGPFTHFYHGKA
Ga0182091_141530913300016766Salt MarshMQYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLDAQQEYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQVGEEMAYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLGEEMAYESEWVQNSGNSYNNGPFTHFYHGKASPYSVIKED
Ga0186684_11632913300017280Host-AssociatedMYKTSLLALLGFTAAKQHHAKTLYEDEWGHNSGNSYNNGPFTDFYHGKASPYAVTNDDIQLKSDSKYEDEWGHNSGNSYENGPFTHFYHGKASPYSVIKEDVQLKSQYEDEWGHNTGNSYENGPFTHFYHGKASPYSVIKEDVQLKSQYEDEWGHNSGNSYENGPFTHFYHGKASPYSVIKEDVQLKSQYEDEWGHNSGNSYNNGPFTNFYHGKASPYAVTADD
Ga0180120_1017899413300017697Freshwater To Marine Saline GradientNNGPFTHFYHGKASPYNVNMDDGLDVQLKEKIAYEPEWGHNSGNSYNNGPFTHFYHGKASPYNVNMDDGLDVQLKEKIAYEPEWGHNSGNSYNNGPFTHFYHGKASPYNVNMDDGLDVQLKEKIAYEPEWGHNSGNSYNNGPFTHFYHGKASPYNVNKDDGLD
Ga0181389_114735313300017746SeawaterMKISFAALALAVSAKHHHHRKGLKQAVEKKQGYEWEWGHNSGNSYNNGPTTHFYHGKASPYSVTKEDVQLDNKEGYEWEWGHNSGNSYNNGPFTHFAHGKASPYSVLKEDVQLDQKEGTGYEWEWGHNSGNSYNNGPFTHFAHGKASPYSVLKEDVQLDSQEGSGYEWEWGHNSGNSYNNGPFTHFA
Ga0181565_1034491723300017818Salt MarshVTKDDVQLGEQYEHEWGHNSGDSYNNGPFTHFAHGKASPYKVTKDDVQLGESYEHEWGHNSGDSYANGPFTNFAHGKASPYKVTKDDIQLGEEYEHEWGHNSGNSYNNGPFTHFAHGKASPYKVTKDDVQLGEQYEAEWGHNSGNSYNNGPFTHFAFGKASPYKVTKDD
Ga0181552_1045450913300017824Salt MarshSGDSYNNGPTTHFAHGKASPYSVTKEDVQLDQKQGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSVVKEDVQLDEKNGQGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSVIKEDVQLDAKEGNGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSVLKED
Ga0181577_1060799913300017951Salt MarshMQYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLDAQQEYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQVGEEMAYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLGEEMAYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKED
Ga0181571_1081234613300017957Salt MarshFYHGKASPYSVIKEDVQLDAQQEYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQVGEEMAYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLGEEMAYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKED
Ga0181606_1021651113300018048Salt MarshVTKDDVQLGEQYEHEWGHNSGDSYNNGPFTHFAHGKASPYKVTKDDVQLGESYEHEWGHNSGDSYANGPFTNFAHGKASPYKVTKDDIQLGEEYEHEWGHNSGNSYNNGPFTHFSHGKASPYKVTKDDVQLGEQYEAEWGHNSGNSYNNGPFTHFAFGKASPYKVTKDD
Ga0181567_1094823613300018418Salt MarshASPYSVIKEDVQLDAQQEYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQVGEEMAYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLGEEMAYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKED
Ga0181563_1041680813300018420Salt MarshRPIKFNKYCIIYKMKYTLAAILLAGASAHKHHHRKGLKQELNKKYEWEWGHNSGDSYNNGPTTHFAHGKASPYSVTKEDVQLDQKQGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSVVKEDVQLDEKNGQGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSVIKEDVQLDAKEGNGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSVLKED
Ga0181566_1038998923300018426Salt MarshVTKDDVQLGEQYEHEWGHNSGDSYNHGPFTHLAHAKPSPYKVTKDDVQLGESYEHEWGHNSGDSYANGPFTNFAHGKASPYKVTKDDIQLGEEYEHEWGHNSGNSYNNGPFTHFAHGKASPYKVTKDDVQLGEQYEAEWGHNSGNSYNNGPFTHFAFGKASPYKVTKDD
Ga0193031_104457813300018765MarineRVRHHHKHQKHSGYEPGWGHNSGDSYNNGPTTHFAYGKASPYDVTGDDGLEVQTKSDMTLENLNRYETEWGHNSGNSYNNGPFTHFAFGKASPYDVTGDDGLEVQLKAETENKQKYEFEWGHNSGNSYNNGPFTHFAFGKASPYDVTGDDGLEVQLASKVNTGNKYETEWGHNSGNSYNNGPFTHFAFGKASPYDVTGDDGLE
Ga0194240_102560113300018832MarineWEWGHNSGDSYNNGPFTHFYHGKASPYSVIKEDVQLDSKEGNGYEWEWGHNSGDSYNNGPFTHFYHGKASPYSVIKEDVQLDEKMNMGEGNGYEWEWGHDSGDSYNNGPFTHFYHGKASPYSVIKEDVQLDDKMNMGEGYEWEWGHDSGDSYNNGPFTHFYHGKASPYSVIKED
Ga0181564_1037014013300018876Salt MarshMKYTLAAILLAGASAHKHHHRKGLKQELNKKYEWEWGHNSGDSYNNGPTTHFAHGKASPYSVTKEDVQLDQKQGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSVVKEDVQLDEKTGQGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSVIKEDVQLDAKEGNGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSVLKED
Ga0193311_1002184813300018885MarineVQTNQTVTYEPEWGHNSGNSYNNGPFTHFYHGKASPYNVNMDDGLDVQTNQTVSYEPEWGHNSGNSYNNGPFTHFYHGKASPYNVNMDDGLDVQVGQKVAYEPEWGHNSGNSYNNGPFTHFYHGKASPYNVNMDDGLDVQLKEKIAYEPEWGHNSGNSYNNGPFTHFYHGKASPYNVNRDDGLD
Ga0192894_1022221913300018968MarinePGWGHNSGNSYNNGPFTNFYHGKASPYSVIKEDLQTESDNHYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQTEAEYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQTEADVKYENEWAHNSGNSYNNGPFTHFYFGKASPYSVIKED
Ga0192961_1026323313300018980MarineSHYEPEWAHNSGNSYENGPTTHFYHGKASPYSVTKEDVQLEEQYEPEWAHNSGNSYDNGPFTHFYHGKASPYSVVKEDLQVDNQVSYEPEWAHNSGNSYDNGPFTHFYHGKASPYSVIKEDVQLDNQVAYEPEWAHNSGNSYDNGPFTHFYHGKASPYSVVKEDXGI
Ga0192947_1021838313300018982MarineHHKHKHQKKEGYEVEWGHNSGSSYNNGPTTHFYHGKASPYSVTKEDVQLENQNGYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVLKEDVQLDQKVDNGYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVLKEDVQLDAKVDNGYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVLKED
Ga0193030_1005411613300018989MarineMKYEPGWGHNSGNSYNNGPFTHFYYGKASPYNVNMDDGLDVQLDEKMKYEPGWGHNSGNSYMNGPFTHFAYGKASPYNVNGDDGLDVQLDSKVNYEPGWGHNSGNSYMNGPFTHFYYGKASPYNVNGDDGLDVQLDSKVNYEPGWGHNSGNSYNNGPFTHFYYGKASPYNVNMDDGLD
Ga0193030_1005429413300018989MarineVNYEPGWGHNSGNSYNNGPFTHFYYGKASPYNVNKDDGEDVQLDSKVNYEPGWGHNSGNSYMNGPFTHFYYGKASPYNVNGDDGLDVQLDSKVNYEPGWGHNSGNSYMNGPFTHFYYGKASPYNVNGDDGLDVQLDSKVNYEPGWGHNSGNSYNNGPFTHFAYGKASPYNVNMDDGLD
Ga0193030_1023301213300018989MarineRAHKKASYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQTEADQKYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLSSENEYEPEWGHNSGNSYDNSPFSHFYHGKTSPYSVIKEDV
Ga0193034_1009922113300019001MarineTWGGHNSGNSYNNGPFTHFYYGKASPYNVNMDDGLDVQTKSEVKYEPGWGHNSGNSYNNGPFTHFYYGKASPYNVNMDDGLDVQTKSEVKYEPGWGHNSGNSYFNGPFTHFYYGKASPYNVNKDDGEDVQLDSDVKYEPGWGHNSGNSYNNGPFTHFYYGKASPYNVNMDDGLD
Ga0193034_1019009013300019001MarineNGPFTHFYHGKASPYSVTKEDLQVGEQNGYEWEWGHDSGNSYNNGPFTHFYHGKASPYSVIKEDLQLDDKAGYEWEWGHNDGNSYDNGPFTHFYHGKASPYSVDKEDLQLDSQNGYEWEWGRDSGNSYNNGPFTHFYHGKASPYSVTKDD
Ga0193044_1022195713300019010MarineGHAKTLKSHYEPEWAHNSGNSYNNGPTTHFYHGKASPYSVTKEDVQLDEQYEPEWAHNSGNSYENGPTTHFYHGKASPFSVIKEDVQLDDQVAYEPEWAHNSGNSYSNGPTTHFYHGKASPFSVIKEDVQLDDQVAYEPEWAHNSGNSYSNGPTTHFYHGKASPYSVIKED
Ga0192982_1030725413300019021MarineWGHNSGNSMNNGPTTHFYHGKASPYSVTKEDVQLENSSAYEPEYGMNSGNSYNNGPFTHFYHGKASPFSVVKEDVQLENKEGYEPLWGHNSGNSYDNGPFTHFYYGKASPYNVIKEDVQLDSKVDQGYEPLWGHNSGNSYDNGPFTHFYYGKASPYNVIKED
Ga0193545_1014056813300019025MarineGGHNSGNSYDNGPFTHFYHGKASPYNVNMDDGLDVQLKYEPEWGHNSGNSYDNGPFTHFYHGKASPYNVNMDDGLDVQLKEKVNYEPEWGHNSGNSYDNGPFTHFYHGKASPYNVNMDDGLDVQLKEKVNYEPEWGHNSGNSYDNGPFTHFYHGKASPYNVNMDDGLD
Ga0193516_1018498613300019031MarineGKASPYSVIKEDLQTEADYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQTEADYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQTEADMKYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQTEADVKYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKED
Ga0193516_1022764713300019031MarineMKYSLAALVLVASAKHHHHRKGLKKAIEEKYEPGWGHNSGDSYHNGPTTHFYHGKASPYSVTKEDVQLDNKEGYEWEWGHNSGNSYANGPFTHFYHGKASPYSVVKEDVQLDNKEGSEYEWEWGHNSGNSYANGPFTHFYHGKASPYSVVKEDVQLDAKEGSGYEWEWGHNSGNSYSNGPFTHFYHGKASPYSVLKE
Ga0192869_1031941513300019032MarineHGEFNKMKISFAALALAVSAKHHHHRKGLKQAVEQNQGYEWEWGHNSGNSYNNGPTTHFAHGKASPYSVTKEDVQLGNKEGYEWEWGHNSGNSYNNGPFTHFAHGKASPYSVLKEDVQLENKEGSQYEWEWGHNSGNSYNNGPFTHFAFGKASPYSALKEDVQLDSQEGNGYEWEWATTLATPTTMDPSPTLLSAKPALTQP
Ga0192945_1016049813300019036MarineGHNSGNSYENGPTDHFYHGKASPYSVTKEDLQIGENQGYEADWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLDDKYEADWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLEDKVGYEAEWGHNSGDSYNNGPFTHFYLGKASPYSVIKEDVQLEDKLNMGEGYEAEWGHNSGDSYNNGPFTHFYLGKASPYSVIKED
Ga0193336_1057004613300019045MarineRKGLKQAVEKKQGYEWEWGHNSGNSYNNGPTTHFYHGKASPYSVTKEDVQLDNKEGYEWEWGHNSGNSYNNGPFTHFAHGKASPYSVLKEDVQLDQKEGYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVLKEDVQLDSQEGSGYEWEWGHNSGNSYNNGPFTHFAFGKASPFSVVKED
Ga0188830_101167323300019085Freshwater LakeIALFIAGAFAHKHSHRKTLKQTYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVTKEDVQLEKSYEPEWGHNSGNSYNNGPTTHFYHGKASPYSVVNEDVQVDADQKYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLDNQEGYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDV
Ga0192946_105597423300019103MarineEPEWGHNSGSSYNNGPFTHFYHGKASPYSVIKEDVQTEADQKYEPEWGHNSGNSYSNGPFTNFYHGKASPYSVIKEDVQLNAESEYEPEWGHNSGNSYDNSPFSNFYHGKTSPYSVIKED
Ga0182097_116309713300019261Salt MarshYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQIGEEQEYEPEWGQNSGNSYNNGPTTHFYHGKASPYSVISEDVQVGEQMEYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLGEEMQYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKED
Ga0182058_152056513300019283Salt MarshSSYDNGPTTHFYHGKASPYSVTKEDVQLDENTQYEPGWGHNSGNSYNNGPFTHFYYGKASPYAANKEDVQLDEKTEYEPLWGHNSGDSYNNGPFTHFYYGKASPYPVTKEDVQLEEKTEYEPLWGHNSGNSYNNGPFTHFYYGKASPYSVLKEDS
Ga0182044_137420513300020014Salt MarshMQYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLDAQQEYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQVGEEMAYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLGEEMAYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDXRRLIIII
Ga0206689_1111821113300021359SeawaterKFIIAVCLLGSTSAVQKHHKKTIKKALSAKYEPGWGHNSGDSYNNGPTTNFYHGKASPYSVTKEDVQLESNEAYEPDWGHNSGNSYHNGPFTNFYHGKASPYSVVKEDVQIDQKVDYEPQWGHNSGNSYDNGPFTHFYYGKASPYSAIKEDVQLESNIDQKYETEWGHNSGNSYHNGPFTNFYLGKASPYSVVKED
Ga0063136_105858613300021896MarineHNSGNSYDNGPFTHFYHGKASPYNVNMDDGLDVQLKEKVHYEPEWGHNSGNSYDNGPFTHFYHGKASPYNVNMDDGLDVQLKEKVNYEPEWGHNSGNSYDNGPFTHFYHGKASPYNVNMDDGLDVQLKEKIAYEPEWGHNSGNSYDNGPFTHFYHGKASPYNVNMDDGLD
Ga0063135_105981013300021908MarineKHSKKYEPEWGHNSGSSYDNGPTDHFYHGKASPYNVNGDDGLDVQTEYEPEWGHNSGNSYNNGPFTHFYHGKASPYNVNMDDGLDVQVNQKVAYEPEWGHNSGNSYNNGPFTHFYHGKASPYNVNKDDGLDVQIGEKVAYEPEWGHNSGNSYNNGPFTHFYHGKASPYNVNMDDGLDV
Ga0222713_1039860513300021962Estuarine WaterMKYIALFIAGAFAHKHSHRKTLKQTYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVTKEDVQLEKSYEPEWGHNSGNSYNNGPTTHFYHGKASPYSVVNEDVQVDADQKYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLDNQEGYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDV
Ga0222713_1040719713300021962Estuarine WaterMKYIIAACLFAGSAEAIRKHHKKTLKNAVSETYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVVKEDVQLESNVDYEPGWGHNSGNSYHNGPFTHFYHGKASPYSVVKEDVQVGEEIHYEPEWGHNSGNSYNNGPFTHFYHGKASPFSVLKEDVQLDSSLDYEPGWGHNSGNSYNNGPFTHFYYGKASPFSVLKED
Ga0255752_1025095913300022929Salt MarshMKYTLAAILLAGASAHKHHHRKGLKQELNKKYEWEWGHNSGDSYNNGPTTHFAHGKASPYSVTKEDVQLDQKQGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSVVKEDVQLDEKNGQGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSVIKEDVQLDAKEGNGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSVLKED
Ga0255781_1048237913300022934Salt MarshMQYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLDAQQEYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQVGEEMAYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQL
Ga0232122_109143513300023709Salt MarshTLAAILLAGASAHKHHHRKGLKQELNKKYEWEWGHNSGDSYNNGPTTHFAHGKASPYSVTKEDVQLDQKQGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSVVKEDVQLDEKNGQGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSVIKEDVQLDAKEGNGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSVLKED
Ga0244775_1138511613300024346EstuarineSPYSVIKEDVQLDAQQEYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQVGEEMAYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLGEEMAYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKED
Ga0208148_110588513300025508AqueousMKYTLAAILLAGASAHKHHHRKGLKQELNKKYEWEWGHNSGDSYNNGPTTHFAHGKASPYSVTKEDVQLDQKQGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSVVKEDVQLDEKNGQGYEWEWGHNSGNSYDNGPFTHFYHGKASPYSVIKEDVQLDAKEGNGYEWEWGHNSGNSYDN
Ga0208660_108308113300025570AqueousMEYIALLVAGFAAHKLNQLKDKNYEPEWGHNSGNSYNNGPTTHFYHGKASPYSVTKEDVQLDNQNGYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVVKEDVQLEDKQALGYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVVKEDVQLDDKQGADYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVVKED
Ga0209505_111618113300025690Pelagic MarineMQYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLDAKQEYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQVGEEMAYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLGEEMAYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKED
Ga0208544_1035366913300025887AqueousNGPTTHFYHGKASPYSVTKEDVQLDNQNGYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVVKEDVQLEDKQAQGYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVVKEDVQLDDKQGADYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVVKED
Ga0247557_104639313300026403SeawaterRRHHHNQHNCGKKPKGKKYEPEWGHNSGSSYDNGPTDHFYHGKASPYNVNMDDGLDVQLKEKVNYEPEWGHNSGNSYHNGPYTHFSHGKASPYQVTGDDGLDVQIGAQVAYEPEWGHNSGNSYHNGPYTHFSHGKASPYQVTGDDGLDVQIGAQVAYEPEWGHNSGNSYH
Ga0247607_105287713300026447SeawaterYHNGPYTHFSHGKASPYNVAGDDGLDVQIGAKVAYEPEWGHNSGNSYHNGPYTHFSHGKASPYQVTGDDGLDVQIGAQVAYEPEWGHNSGNSYHNGPYTHFSHGKASPYQVTGDDGLDVQIGAQVAYEPEWGHNSGNSYHNGPYTHFSHGKASPYQVTGDDGLDVQLDSKVNF
Ga0247588_105686413300026465SeawaterNGPFTHFYHGKASPYNVNMDDGLDVQLKEKVHYEPEWGHNSGNSYDNGPFTHFYHGKASPYNVNMDDGLDVQLKEKVNYEPEWGHNSGNSYDNGPFTHFYHGKASPYNVNMDDGLDVQLKEKIAYEPEWGHNSGNSYDNGPFTHFYHGKASPYNVNMDDGLD
Ga0247571_109592413300026495SeawaterEWGHNSGDSYNNGPTDHFYHGKASPYSVTKEDLQIGENQGYEADWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLDDKYEADWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLEDKVGYEAEWGHNSGDSYNNGPFTHFYLGKASPYSVIKEDVQLEDKINMGEGYEAEWGHNSGDSYNNGPFTHFYLGKASPYSVIKED
Ga0247592_116254013300026500SeawaterMQYEPEWGQNSGNSYNNAPFTHFYHGKASPYSVIKEDVQLDASQEYEPEWGHNSGNSYDNGPFTHFYHGKASPYSVIKEDVQVGEQMEYEPEWGHNSGNSHDNGPFTHFYHGKASPYSVIKEDVQLGEEMAYEPEWGQNSGNSYNNGPTTHFYHGKASPYSVIKED
Ga0208020_104598723300027159EstuarineMKYAIIAALFLAGTTEAIQKKHHHSLKKSIEKKYEPEWAHNSGNSYNNGPTTHFYHGKASPYSVTKEDVQLEDKSQFEPGWVHNSGNSYNNGPFTNFYHGKASPYSVVKEDVQLEDKASFEPGWVHNTGNSYNNGPFTNFYHGKASPYSVVKEDVQLSAETEFEPGWVHNTGNSYNNGPFTNFYHGKASPYSVLKED
Ga0208923_109018713300027320EstuarineKEDVQLEDKSQFEPGWVHNSGNSYNNGPFTNFYHGKASPYSVVKEDVQLEDKASFEPGWVHNTGNSYNNGPFTNFYHGKASPYSVVKEDVQLSAETEFEPGWVHNTGNSYNNGPFTNFYHGKASPYSVLKED
Ga0208437_109212413300027525EstuarineKYIALFIAGAFAHKHSHRKTLKQTYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVTKEDVQLEKSYEPEWGHNSGNSYNNGPTTHFYHGKASPYSVVNEDVQVDADQKYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLDNQEGYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDV
Ga0208897_112314223300027571EstuarineALFIAGAFAHKHSHRKTLKQTYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVTKEDVQLEKSYEPEWGHNSGNSYNNGPTTHFYHGKASPYSVVNEDVQVDADQKYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLDNQEGYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDV
Ga0208305_1021811413300027753EstuarineNNGPFTHFYHGKASPYSVTKEDVQLEKSYEPEWGHNSGNSYNNGPTTHFYHGKASPYSVVNEDVQVDADQKYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLDNQEGYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDV
Ga0208671_1027625723300027757EstuarineMQYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLDAQQEYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQVGEEMAYEPEWGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLGEEMAYEPEWGQNSGNSYNNGPFTHFYHGKA
Ga0256412_129845613300028137SeawaterVIKEDVQLGSEYEPEWGHNTGNSYENGPFTHFYHGKASPYSVIKEDVQLGGESKYEPEWGHNTGNSYENGPFTHFYHGKASPYSVIKEDVQVGGEAKYEPEWGHNTGNSYENGPTTHFYHGKASPYSVIKED
Ga0256412_133861513300028137SeawaterAALALAVSAKHHHHRKGLKQAVEKKQGYEWEWGHNSGNSYNNGPTTHFYHGKASPYSVTKEDVQLDNKEGYEWEWGHNSGNSYNNGPFTHFAHGKASPYSVLKEDVQLDQKEGTGYEWEWGHNSGNSYNNGPFTHFAFGKASPYSVLKEDVQLDSQEGSGYEWEWGHNSGNSYNNGPFTHFAF
Ga0256413_134143713300028282SeawaterDVQVGQKVAYEPEWGHNSGNSYNNGPFTHFYHGKASPYNVNMDDGLDVQLKEKIAYEPEWGHNSGNSYNNGPFTHFYHGKASPYNVNMDDGLDVQLKEKIAYEPEWGHNSGNSYNNGPFTHFYHGKASPYNVNMDDGLDVQLKEKIAYEPEWGHNSGNSYNNGPFTHFYHGKAS
Ga0247597_105993713300028334SeawaterTHFYHGKASPYSVIKEDVQTEADQKYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLEDKVGYEAEWGHNSGDSYNNGPFTHFYLGKASPYSVIKEDVQLEDKINMGEGYEAEWGHNSGDSYNNGPFTHFYHGKASPYNVNMDDGLDVQLKEKIAYEPEWGHNSGNS
Ga0307401_1032125013300030670MarineKQAIKYEPEWGHNSGNSYDNGPFTHFYHGKASPYNVNMDDGLDVQLKEKVAYEPEWGHNSGNSYDNGPFTHFYHGKASPYNVNMDDGLDVQLKEKIAYEPEWGHNSGNSYDNGPFTHFYHGKASPYNVNMDDGLDVQLKEKIAYEPEWGHNSGNSYDNGPFTHFYHGKASPYNVNMDDGL
Ga0307398_1056641713300030699MarineYIIAACLFAGSTEAIKKHQRIRNALSVNYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVTKEDVQLEANAEYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVVKEDVQLDEKVNYEPQWGHNSGNSYNNGPFTHFYHGKASPYSVVKEDVQLDSSVDQTYEPQWGHNSGNSYNNGPFTHFYHGKASPYSVVKED
Ga0073978_101223113300031036MarineKISFAALALAVSAKHHHHRKGLKQAVEKKAGYEWEWGHNSGNSYNNGPTTHFYHGKASPYSVTKEDVQLDNKEGYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVLKEDVQLDQKEGSEYEWEWGHNSGNSYNNGPFTHFYHGKASPYSVLKEDVQLDAQEGSGYEWEWGHNSGNSYNNGPFTHFAFGKASPYSVLKED
Ga0307489_1051907913300031569Sackhole BrineMKYEIIAILLAGSAEAVQKHHRHTLKKSIEKKYEPEWAHNSGNSYNNGPTTNFYHGKASPYSVTKEDVQLDDKQAFEVGWTHNSGNSYNNGPFTNFYHGKASPYSVVKEDVQLDDKQAFEVGWTHNTGNSYNNGPFTNFYHGKASPYSVVKEDVQLDDKQGFEVGWTHNTGNSYNNGPFTNFYHGKASPYSVLKED
Ga0307489_1137753723300031569Sackhole BrinePYSVIKEDVQLGEKYEPEYGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLGEKYEPEYGQNSGNSYNNGPFTHFYHGKASPYSVIKEDVQLGEQYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVIKED
Ga0307391_1065287013300031729MarineSTEAIKKHQRIRNALSVNYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVTKEDVQLEANAEYEPQWGHNSGNSYNNGPFTHFYHGKASPYSVVKEDVQVEDKVNYEPQWGHNSGNSYNNGPFTHFYHGKASPYSVVKEDVQLDSSVDQTYEPQWGHNSGNSYNNGPFTHFYHGKASPYSVLKED
Ga0307394_1039639713300031735MarineIIAACLFAGSTEAIKKHQRIRNALSVNYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVTKEDVQLEANAEYEPQWGHNSGNSYNNGPFTHFYHGKASPYSVVKEDVQVEDKVNYEPQWGHNSGNSYNNGPFTHFYHGKASPYSVVKEDVQLDSSVDQTYEPQWGHNSGNSYNNGPFTHFYHGK
Ga0314670_1066529613300032470SeawaterLKSHYEPEWAHNSGNSYENGPTTHFYHGKASPYSVTKEDVQLEEQYEPEWAHNSGNSYDNGPFTHFYHGKASPYSVVKEDLQVDNQVSYEPEWAHNSGNSYDNGPFTHFYHGKASPYSVIKEDVQLDNQVAYEPEWAHNSGNSYDNGPFTHFYHGKASPYSVVKED
Ga0314683_1065523713300032617SeawaterLKSHYEPEWAHNSGNSYENGPTTHFYHGKASPYSVTKEDVQLEEQYEPEWAHNSGNSYDNGPFTHFYHGKASPYSVVKEDLQVDNQVSYEPEWAHNSGNSYDNGPFTHFYHGKASPYSVIKEDVQLDNQVAYEPEWAHNSGNSYDNGPFTHFYHGKASPYNVNMDDGLDVQVGAKVAYEPEWGHNSGNSYN
Ga0314693_1073719913300032727SeawaterENGPTTHFYHGKASPYSVTKEDVQLEEQYEPEWAHNSGNSYDNGPFTHFYHGKASPYSVVKEDLQVDNQVSYEPEWAHNSGNSYDNGPFTHFYHGKASPYSVIKEDVQLDNQVAYEPEWAHNSGNSYDNGPFTHFYHGKASPYSVVKED
Ga0314699_1049956713300032730SeawaterSPYNVNGDDGLDVQTAAEYEPEWGHNSGNSYNNGPFTHFYHGKASPYNVNMDDGLDVQVNQKVTYEPEWGHNSGNSYNNGPFTHFYHGKASPYNVNMDDGLDVQVGAKVAYEPEWGHNSGNSYNNGPFTHFYHGKASPYNVNMDDGLDVQLKEKIAYEPEWGHNSGNSYNNGPFTHFYHG
Ga0314714_1068301113300032733SeawaterSHYEPEWAHNSGNSYENGPTTHFYHGKASPYSVTKEDVQLEEQYEPEWAHNSGNSYDNGPFTHFYHGKASPYSVVKEDLQVDNQVSYEPEWAHNSGNSYDNGPFTHFYHGKASPYSVIKEDVQLDNQVAYEPEWAHNSGNSYDNGPFTHFYHGKASPYSVIKED
Ga0314706_1060123213300032734SeawaterSHYEPEWAHNSGNSYENGPTTHFYHGKASPYSVTKEDVQLEEQYEPEWAHNSGNSYDNGPFTHFYHGKASPYSVVKEDLQVDNQVSYEPEWAHNSGNSYDNGPFTHFYHGKASPYSVIKEDVQLDNQVAYEPEWAHNSGNSYDNGPFTHFYHGKASPYSVVKED
Ga0314708_1047993113300032750SeawaterTHFYHGKASPYNVNMDDGLDVQVGAKVAYEPEWGHNSGNSYNNGPFTHFYHGKASPYNVNMDDGLDVQLKEKIAYEPEWGHNSGNSYNNGPFTHFYHGKASPYNVNMDDGLDVQLKEKIAYEPEWGHNSGNSYNNGPFTHFYHGKASPYNVNMDDGLDVQLKEKIAYEPEWGHNSGNSYNNGPFTHFYHGKASPYNVNKD
Ga0307390_1072694213300033572MarineIIAACLFAGSTEAIKKHQRIRNALSVNYEPEWGHNSGNSYNNGPFTHFYHGKASPYSVTKEDVQLEANAEYEPQWGHNSGNSYNNGPFTHFYHGKASPYSVVKEDVQVEDKVNYEPQWGHNSGNSYNNGPFTHFYHGKASPYSVVKEDVQLDSSVDQTYEPQWGHNSGNSYNNGPFTHFYHGKASPYSVIKED


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.