NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F057397

Metagenome / Metatranscriptome Family F057397

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F057397
Family Type Metagenome / Metatranscriptome
Number of Sequences 136
Average Sequence Length 108 residues
Representative Sequence RVQSFLLKNTVPLQNLINNRLATRPGLIGRFFKGLEMGRREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFLGASNGPLNYTALLCYFWASGMILSRCRFEKARD
Number of Associated Samples 110
Number of Associated Scaffolds 136

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 7.35 %
% of genes near scaffold ends (potentially truncated) 71.32 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 104
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(24.265 % of family members)
Environment Ontology (ENVO) Unclassified
(58.824 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(79.412 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 57.66%    β-sheet: 0.00%    Coil/Unstructured: 42.34%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 136 Family Scaffolds
PF13445zf-RING_UBOX 0.74



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001263|BBAY83_10239646All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum565Open in IMG/M
3300006397|Ga0075488_1503629All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum703Open in IMG/M
3300006399|Ga0075495_1494120All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum632Open in IMG/M
3300006400|Ga0075503_1417681All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea545Open in IMG/M
3300006415|Ga0099654_10430520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum680Open in IMG/M
3300009003|Ga0102813_1106975All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum889Open in IMG/M
3300009054|Ga0102826_1170213All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum520Open in IMG/M
3300009263|Ga0103872_1036801All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum676Open in IMG/M
3300009265|Ga0103873_1061693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum736Open in IMG/M
3300009434|Ga0115562_1161467All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum828Open in IMG/M
3300009434|Ga0115562_1206874All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum700Open in IMG/M
3300009436|Ga0115008_10666897All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum753Open in IMG/M
3300009441|Ga0115007_10374971All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum929Open in IMG/M
3300009441|Ga0115007_10474689All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum824Open in IMG/M
3300009442|Ga0115563_1174954All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum842Open in IMG/M
3300009442|Ga0115563_1364320All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum517Open in IMG/M
3300009466|Ga0126448_1021157All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1562Open in IMG/M
3300009467|Ga0115565_10263969All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum786Open in IMG/M
3300009543|Ga0115099_10758581All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum703Open in IMG/M
3300009592|Ga0115101_1395762All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum702Open in IMG/M
3300009599|Ga0115103_1110113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum634Open in IMG/M
3300009599|Ga0115103_1268919All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum672Open in IMG/M
3300009599|Ga0115103_1577638All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum677Open in IMG/M
3300009599|Ga0115103_1714121All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum664Open in IMG/M
3300009606|Ga0115102_10457047All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum658Open in IMG/M
3300009606|Ga0115102_10524097All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum697Open in IMG/M
3300009606|Ga0115102_10847808All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum655Open in IMG/M
3300009606|Ga0115102_10862243All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum705Open in IMG/M
3300009677|Ga0115104_10301043All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum568Open in IMG/M
3300012414|Ga0138264_1309921All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum649Open in IMG/M
3300012414|Ga0138264_1612399All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum743Open in IMG/M
3300012415|Ga0138263_1605373All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum686Open in IMG/M
3300012524|Ga0129331_1450428All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum681Open in IMG/M
3300012782|Ga0138268_1419304All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum743Open in IMG/M
3300012920|Ga0160423_11033680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum550Open in IMG/M
3300012952|Ga0163180_10721506All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum772Open in IMG/M
3300012954|Ga0163111_10975818All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum817Open in IMG/M
3300016703|Ga0182088_1212085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum585Open in IMG/M
3300016734|Ga0182092_1018354All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum632Open in IMG/M
3300016746|Ga0182055_1250585All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea692Open in IMG/M
3300016766|Ga0182091_1197616All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum648Open in IMG/M
3300016776|Ga0182046_1642919All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea622Open in IMG/M
3300017951|Ga0181577_10407255All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea864Open in IMG/M
3300018410|Ga0181561_10386987All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum637Open in IMG/M
3300018684|Ga0192983_1028133All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum768Open in IMG/M
3300018692|Ga0192944_1030862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum775Open in IMG/M
3300018871|Ga0192978_1065008All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum677Open in IMG/M
3300018874|Ga0192977_1068617All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum719Open in IMG/M
3300018899|Ga0193090_1087614All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum717Open in IMG/M
3300018928|Ga0193260_10077561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum720Open in IMG/M
3300018974|Ga0192873_10295195All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum691Open in IMG/M
3300018980|Ga0192961_10130131All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum767Open in IMG/M
3300018982|Ga0192947_10161316All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum747Open in IMG/M
3300018989|Ga0193030_10279474All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum544Open in IMG/M
3300019021|Ga0192982_10171865All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum765Open in IMG/M
3300019022|Ga0192951_10279055All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum629Open in IMG/M
3300019031|Ga0193516_10156963All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum767Open in IMG/M
3300019032|Ga0192869_10304660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum695Open in IMG/M
3300019036|Ga0192945_10221365All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum604Open in IMG/M
3300019045|Ga0193336_10257999All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum741Open in IMG/M
3300019048|Ga0192981_10190529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum803Open in IMG/M
3300019048|Ga0192981_10231720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum712Open in IMG/M
3300019048|Ga0192981_10232246All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum711Open in IMG/M
3300019123|Ga0192980_1054412All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum760Open in IMG/M
3300019123|Ga0192980_1054415All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum760Open in IMG/M
3300019123|Ga0192980_1060895All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum712Open in IMG/M
3300019149|Ga0188870_10107689All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum664Open in IMG/M
3300019149|Ga0188870_10113419All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum642Open in IMG/M
3300019262|Ga0182066_1119995All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea711Open in IMG/M
3300021169|Ga0206687_1330984All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum627Open in IMG/M
3300021350|Ga0206692_1036943All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum582Open in IMG/M
3300021350|Ga0206692_1835869All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum719Open in IMG/M
3300021872|Ga0063132_105361All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum596Open in IMG/M
3300021887|Ga0063105_1055143All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum633Open in IMG/M
3300021902|Ga0063086_1009184All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum681Open in IMG/M
3300021902|Ga0063086_1021416All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea663Open in IMG/M
3300021910|Ga0063100_1096284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum529Open in IMG/M
3300021911|Ga0063106_1060307All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum620Open in IMG/M
3300021913|Ga0063104_1044934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea512Open in IMG/M
3300021913|Ga0063104_1097916All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum527Open in IMG/M
3300021924|Ga0063085_1071018All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum574Open in IMG/M
3300021925|Ga0063096_1025603All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum684Open in IMG/M
3300021927|Ga0063103_1003126All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum689Open in IMG/M
3300021927|Ga0063103_1040070All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum656Open in IMG/M
3300021950|Ga0063101_1019271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum678Open in IMG/M
3300021954|Ga0063755_1100833All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum517Open in IMG/M
3300021959|Ga0222716_10343764All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum886Open in IMG/M
3300023685|Ga0228686_1036412All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum675Open in IMG/M
3300024301|Ga0233451_10387046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea508Open in IMG/M
3300025626|Ga0209716_1098399All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum837Open in IMG/M
3300025640|Ga0209198_1169776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum585Open in IMG/M
3300025880|Ga0209534_10307474All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum726Open in IMG/M
3300025890|Ga0209631_10291566All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum794Open in IMG/M
3300026182|Ga0208275_1048214All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum855Open in IMG/M
3300026420|Ga0247581_1069626All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum561Open in IMG/M
3300026448|Ga0247594_1052045All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum704Open in IMG/M
3300026465|Ga0247588_1129177All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum508Open in IMG/M
3300026468|Ga0247603_1079483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum671Open in IMG/M
3300026495|Ga0247571_1093423All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum697Open in IMG/M
3300026495|Ga0247571_1104265All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum660Open in IMG/M
3300027810|Ga0209302_10210236All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum928Open in IMG/M
3300027833|Ga0209092_10280632All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea907Open in IMG/M
3300027899|Ga0209668_10874327All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum606Open in IMG/M
3300028106|Ga0247596_1126812All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum580Open in IMG/M
3300028109|Ga0247582_1155567All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum587Open in IMG/M
3300028250|Ga0247560_117682All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum542Open in IMG/M
3300028279|Ga0228613_1053824All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum952Open in IMG/M
3300028282|Ga0256413_1219757All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum679Open in IMG/M
3300028282|Ga0256413_1366060All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum504Open in IMG/M
3300028290|Ga0247572_1105873All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum695Open in IMG/M
3300028290|Ga0247572_1182328All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea527Open in IMG/M
3300028335|Ga0247566_1046581All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum719Open in IMG/M
3300030671|Ga0307403_10566186All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum615Open in IMG/M
3300030788|Ga0073964_11483752All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum625Open in IMG/M
3300031710|Ga0307386_10474277All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum652Open in IMG/M
3300031729|Ga0307391_10873498All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum518Open in IMG/M
3300031735|Ga0307394_10297739All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum640Open in IMG/M
3300031735|Ga0307394_10470264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea506Open in IMG/M
3300031738|Ga0307384_10405949All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum635Open in IMG/M
3300031742|Ga0307395_10292165All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum703Open in IMG/M
3300031750|Ga0307389_10560935All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum737Open in IMG/M
3300032492|Ga0314679_10348967All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum674Open in IMG/M
3300032517|Ga0314688_10460689All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum690Open in IMG/M
3300032517|Ga0314688_10466274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum686Open in IMG/M
3300032518|Ga0314689_10523607All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum618Open in IMG/M
3300032519|Ga0314676_10648381All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum620Open in IMG/M
3300032522|Ga0314677_10383223All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum750Open in IMG/M
3300032616|Ga0314671_10445959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum706Open in IMG/M
3300032616|Ga0314671_10667040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum559Open in IMG/M
3300032707|Ga0314687_10430015All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum733Open in IMG/M
3300032714|Ga0314686_10416583All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum667Open in IMG/M
3300032714|Ga0314686_10648095All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea509Open in IMG/M
3300032746|Ga0314701_10421182All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum604Open in IMG/M
3300032748|Ga0314713_10373186All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum607Open in IMG/M
3300032752|Ga0314700_10391046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum739Open in IMG/M
3300033572|Ga0307390_10922712All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum552Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine24.26%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine22.06%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater11.76%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater10.29%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh6.62%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine5.15%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.94%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.94%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine2.94%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.47%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater1.47%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.47%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.47%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water1.47%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.74%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.74%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.74%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond0.74%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.74%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001263Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY83Host-AssociatedOpen in IMG/M
3300006397Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006399Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006400Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006415Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake communityEnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009054Estuarine microbial communities from the Columbia River estuary - metaG S.737EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009466Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009467Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012524Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300016703Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041407CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016734Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041410CS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016746Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101401AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016766Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041409AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016776Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011505AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018410Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018899Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001029 (ERX1809754-ERR1740133)EnvironmentalOpen in IMG/M
3300018928Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001111 (ERX1789573-ERR1719386)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019262Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101412AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021910Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-87M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021911Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021924Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021954Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Euk ARK-5-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300023685Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 50R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024301Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504CT (spades assembly)EnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025640Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes)EnvironmentalOpen in IMG/M
3300025880Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300026182Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes)EnvironmentalOpen in IMG/M
3300026420Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 40R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300028106Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028250Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 8R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028279Seawater microbial communities from Monterey Bay, California, United States - 14DEnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028335Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 14R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030788Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032746Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032748Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
BBAY83_1023964613300001263Macroalgal SurfaceMTTRLQTWILANTKPLQYLVNERLAVRPGIIGRFFKAMEMGKREYSQHTLLRSFKVVNYFWVQIFHIYGVARPIGTRFFTNYGNGPLNYSAIFCYFWCTLMIFARCRFNNAREDYAFNS*
Ga0075488_150362923300006397AqueousIQSFILRNTGPLQNLINNRLASRPGFIGRIFKSIEMGQREYGAHTFHRAFRLVNFFWMGIFRTYALMRPVGSRFFGYSNGPLNYSGLFVYIWATAMIFARCRF*
Ga0075495_149412033300006399AqueousNLINNRLATRPGLIGRFFKGLEMGRREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFLGASNGPLNYTALLCYFWASGMILSRCRFEKARD*
Ga0075503_141768113300006400AqueousRVQAFLLKNTVPLQNLINNRLATRPGIIGRIFKGIEMGNREYSQHTFHRMFRVVNYFWVNLFAVYARMRPVGSRFFGAGNGPLNYTGLYCYFFATAAIFARCRFDKARDAYLFNA*
Ga0099654_1043052023300006415LakeVNEKLAKRSGLIGRIFKGLEMGKREYSEHTFFRAFRVVNYFWMSMWAFFARMRPIGSRFLGLSNGPLNYSGLYVYLWSTMLIFAGCRLQKTREISKFNA*
Ga0102813_110697523300009003EstuarineLINNRLATRPGIIGRIFKGIEMGHREYSQHTFHRMFRVVNYFWVNLFAVYARMRPVGSRFFGAGNGPLNYTGLYCYFFATAAIFARCRFDKARDAYLFNA*
Ga0102826_117021313300009054EstuarineMSQRVQSFLLNNTKPLQNLINNNLAHRPGIIGRFFKGLEMGKREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFFGAGNGPLNYTALLCYFWASGMILSRCRFEKARDQYMFNTQDGVEFWFDRYNMMFPPSFLH
Ga0103872_103680113300009263Surface Ocean WaterWLLKNTGGLQYLVNERLAVRPGLIGRIFKGLEMGKREYSEHTLHRAFRVVNYMWMSIFRVYGVMRPIGSRFLGAGNGPLNYSGLYVYIWATCMVFARCRFNKSRDQYLFNA*
Ga0103873_106169323300009265Surface Ocean WaterVNERLAVRPGLIGRIFKGLEMGKREYSEHTLHRAFRVVNYMWMSIFRVYGVMRPIGSRFLGAGNGPLNYSGLYVYIWATCMVFARCRFNKSRDQYLFNA*
Ga0115562_116146713300009434Pelagic MarineMSQRVQSFLLKNTVPLQNLINNRLATRPGLIGRFFKGLEMGRREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFLGASNGPLNYTALLCYFWASGMILSRCRFEKARD*
Ga0115562_120687413300009434Pelagic MarineNEKLGTRPGLIGRIFKGLEMGKREYSDHTLHRAFRVVNYMWMSIFRVYGAMRPVGSRFLGGGNGPLNYSGLYVYIWATMMVFARCRFSKSREQYTFNS*
Ga0115008_1066689713300009436MarineNRLANRPGIIGRVFKALEMGRREYGAHTFHRAFRLVNFFWMGIFRTYALMRPVGSRFLGYSNGPLNYSGLFVYLWATSMIFARCRF*
Ga0115007_1037497123300009441MarineMTSRLQAIILKNTAGLQHLINNRLATRPGGIGRLFKAIEMGQREYSAHTFHRAFRLVNFFWMGIFRTYANMRPVGSRFLGMSGGPLNYSGLFVYLWATAMIFARCRF*
Ga0115007_1047468923300009441MarineMTSRVQSFLLKNTVPLQNLINNRLATRPGLIGRVFKGLEMGTREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFFGASNGPLNYTGLLCYFWASGMILSRCRFEKARDQYTFNT*
Ga0115563_117495433300009442Pelagic MarineMSQRVQAFILRNTGGLQYLVNEKLGTRPGLIGRIFKGLEMGKREYSDHTLHRAFRVVNYMWMSIFRVYGAMRPVGSRFLGGGNGPLNYSGLYVYIWATMMVFARCRFSKSREQYTFNS*
Ga0115563_136432023300009442Pelagic MarineLRNTGGLQYLVNEKLAQRPGLIGRIFKGLEMGKREYSEHTLHRAFRVVNYMWMSIFRVYGVMRPIGSRFFGTGNGPLNYSGLYVYIWCTGMVFARCRF*
Ga0126448_102115713300009466Meromictic PondLKNTKGLQYLVNERLATRPGLIGRIFKGLEMGRREYSDHTLHRAFRVANFMWVGIFSVLGRMRPIGSRFFGLGNGPLNYPALFCYFASTFLIFARCRFSNARDQVYFNSQDGVEFWFDRY
Ga0115565_1026396913300009467Pelagic MarineLRNTGGLQHLVNEKLGKRPGLIGRIFKGLEMGKREYSEHTLHRAFRVVNYMWMSIFRVYGVMRPIGSRFLGGGNGPLNYSGLYVYIWATMMVFARCRFSKSREQYTFNS*
Ga0115099_1075858113300009543MarineRVQAFILRNTGGLQYLVNEKLGTRPGLIGRIFKGLEMGKREYSDHTLHRAFRVVNYMWMSIFRVYGAMRPVGSRFLGGGNGPLNYSGLYVYIWATMMVFARCRFSKSREQYTFNS*
Ga0115101_139576213300009592MarineKDLNMSQRVQAFILRNTGGLQYLVNEKLGTRPGLIGRIFKGLEMGKREYSDHTLHRAFRVVNYMWMSIFRVYGAMRPVGSRFLGGGNGPLNYSGLYVYIWATMMVFARCRFSKSREQYTFNS*
Ga0115103_111011313300009599MarineTPNLQFLVNERLAKRGGPIGSLFKKLEMGQREYSAHTFHRVFRVVNFFWMRMFQVYGGMRGVGSRFFGQGANGSLNYSGLFIYLFSTLMIFSRCRFSRSRDQYTFNA*
Ga0115103_126891913300009599MarineVQSFLLKNTVPLQNLINNRLATRPGLIGRFFKGLEMGRREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFLGAGNGPLNYTALLCYFWASGMILSRCRFEKARD*
Ga0115103_157763813300009599MarineSQRVQSFLLKNTKPLQNLINNNLAHRPGLIGRFFKGLEMGKREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFFGAGNGPLNYTALLCYFWASGMILSRCRFEKARD*
Ga0115103_171412113300009599MarineVNERLAVRPGLIGRIFKGLEMGKREYSEHTLHRAFRVVNYMWMSIFRVYGVMRPIGSRFLGAGNGPLNYSGLYVYIWATCMIFARCRFNKSRDQYMFNA*
Ga0115102_1045704713300009606MarineKMTTRIQSFILRNTGPLQNLINNRLATRPGFVGRVFKAIEMGQREYGAHTFHRAFRLVNFFWMGIFRTYALMRPVGSRFFGYSNGPLNYSGLFVYIWATAMIFARCRF*
Ga0115102_1052409713300009606MarineNMSQRVQAFILRNTGGLQYLVNEKLGTRPGLIGRIFKGLEMGKREYSDHTLHRAFRVVNYMWMSIFRVYGAMRPVGSRFLGGGNGPLNYSGLYVYIWATMMVFARCRFSKSREQYTFNS*
Ga0115102_1084780823300009606MarineVNERLAVRPGLIGRIFKGLEMGKREYSEHTLHRAFRVVNYMRMSIFRVYGVMRPIGSRFLGAGNGPLNYSGLYVYIWATCMIFARCRFNKSRDQYMFNA*
Ga0115102_1086224323300009606MarineMTTRIQSFILRNTGPLQNLINNRLASRPGFIGRIFKSIEMGQREYGAHTFHRAFRLVNFFWMGIFRTYALMRPVGSRFFGYSNGPLNYSGLFVYIWATAMIFARCRF*
Ga0115104_1030104313300009677MarineLNMSQRVQTFLLNNTKPLQNLINNNLAHRPGIIGRFFKGLEMGKREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFFGAGNGPLNYTALLCYFWASGMILSRCRFEKARD*
Ga0138264_130992123300012414Polar MarineVNNRLATRPGLIGRFFKGLEMGRREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFFGAGNGPLNYTALLCYFWASGMILSRCRFEKARD*
Ga0138264_161239913300012414Polar MarineKDLNMSQRVQAFILRNTGGLQYLVNEKLGTRPGLIGRIFKGLEMGKREYSEHTLHRAFRVVNYMWMSIFRVYGAMRPVGSRFIGGGNGPLNYSGLYVYIWATMMVFARCRFSKSREQYTFNS*
Ga0138263_160537313300012415Polar MarineQRVQAFILRNTGGLQYLVNEKLGTRPGLIGRIFKGLEMGKREYSEHTLHRAFRVVNYMWMSIFRVYGAMRPVGSRFIGGGNGPLNYSGLYVYIWATMMVFARCRFSKSREQYTFNS*
Ga0129331_145042823300012524AqueousSQRVQSFLLKNTVPLQNLINNRLATRPGLIGRFFKGLEMGRREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFLGASNGPLNYTALLCYFWASGMILSRCRFEKARD*
Ga0138268_141930413300012782Polar MarineQAFILRNTGGLQYLVNEKLGTRPGLIGRIFKGLEMGKREYSEHTLHRAFRVVNYMWMSIFRVYGAMRPVGSRFIGGGNGPLNYSGLYVYIWATMMVFARCRFSKSREQYTFNS*
Ga0160423_1103368013300012920Surface SeawaterSFLLRNTGPLQNLINNRLAPRAGFIGRVFKAIEMGQREYGAHTFHRAFRLVNFFWMGIFRTYAVMRPVGSRFFGYSNGPLNYSGLFVYIWATAMIFARCRFQKSRE*
Ga0163180_1072150623300012952SeawaterFILRNTGPLQNLINNRLATRPGIIGRVFKAIEMGQREYGAHTFHRAFRLVNFFWMGIFRTYALMRPVGSRFLGYSNGPLNYSGLFVYIWATAMIFARCRF*
Ga0163111_1097581813300012954Surface SeawaterLRNTGGLQYLVNEKLGKRPGLIGRIFKGLEMGKREYSEHTLHRAFRVVNYMWMSIFRVYGVMRPIGSRFFGAGNGPLNYSGLYVYIWCTGMVFARCRF*
Ga0182088_121208513300016703Salt MarshRVQSWLLKNTKGLQYLVNERLATRPGLIGRIFKGLEMGKREYSDHTLHRALRVANFMWVSIFRVYAYMRPVGSRFFGAGNGPLNYSGLFVYFFATAMVFARCRFVNARD
Ga0182092_101835423300016734Salt MarshLLKNTVPLQNLINNRLATRPGIIGRIFKGIEMGNREYSQHTFHRMFRVVNYFWVNLFAVYARMRPVGSRFFGAGNGPLNYTGLYCYFFATAAIFARCRFDKARDAYLFNA
Ga0182055_125058523300016746Salt MarshLKNTKGLQYLVNERLATRPGLIGRIFKGLEMGKREYSDHTLHRALRVANFMWVSIFRVYAYMRPVGSRFFGAGNGPLNYSGLFVYFFATAMVFARCRFVNARD
Ga0182091_119761613300016766Salt MarshNMSQRVQAFLLKNTVPLQNLINNRLATRPGIIGRIFKGIEMGNREYSQHTFHRMFRVVNYFWVNLFAVYARMRPVGSRFFGAGNGPLNYTGLYCYFFATAAIFARCRFDKARDAYLFNA
Ga0182046_164291923300016776Salt MarshSQRVQSWLLKNTKGLQYLVNERLATRPGLIGRIFKGLEMGKREYSDHTLHRALRVANFMWVSIFRVYAYMRPVGSRFFGAGNGPLNYSGLFVYFFATAMVFARCRFVNARD
Ga0181577_1040725523300017951Salt MarshMSQRVQSWLLKNTKGLQYLVNERLATRPGLIGRIFKGLEMGKREYSDHTLHRALRVANFMWVSIFRVYAYMRPVGSRFFGAGNGPLNYSGLFVYFFATAMVFARCRFVNARD
Ga0181561_1038698723300018410Salt MarshLLKNTKGLQYLVNERLATRPGLIGRIFKGLEMGKREYSDHTLHRAMRVANFMWVSIFRVYAYMRPVGSRFFGAGNGPLNYSGLFVYFFATAMVFARCRFVNARD
Ga0192983_102813313300018684MarineMGIIIFNKKDLNMSQRVQAFILRNTGGLQYLVNEKLGTRPGLIGRIFKGLEMGKREYSEHTLHRAFRVVNYMWMSIFRVYGAMRPVGSRFIGGGNGPLNYSGLYVYIWATMMVFARCRFSKSREQYTFNS
Ga0192944_103086233300018692MarineMSQRVQAFILRNTGGLQYLVNEKLGTRPGLIGRIFKGLEMGKREYSDHTLHRAFRVVNYMWMSIFRVYGAMRPVGSRFLGQGNGPLNYSGLYVYIWATMMVFARCRFSKSREQYTFNS
Ga0192978_106500813300018871MarineQRVQSFLLKNTVPLQNLVNNRLATRPGIIGRFFKGLEMGRREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFFGASNGPLNYTALLCYFWASGMILSRCRFEKARD
Ga0192977_106861723300018874MarineLNMSQRVQAFILRNTGGLQYLVNEKLGTRPGLIGRIFKGLEMGKREYSEHTLHRAFRVVNYMWMSIFRVYGAMRPVGSRFIGGGNGPLNYSGLYVYIWATMMVFARCRFSKSREQYTFNS
Ga0193090_108761423300018899MarineNMSQRVQAFILRNTGGLQYLVNEKLGTRPGLIGRIFKGLEMGKREYSEHTLHRAFRVVNYMWMSIFRVYGAMRPVGSRFIGGGNGPLNYSGLYVYIWATMMVFARCRFSKSREQYTFNS
Ga0193260_1007756123300018928MarineRLQSFILRNTQGLQHLVNERLAKRPGGIGRFFKAIEMGQREYSAHTFHRAFRLVNFFWMGIFRTYAVMRPVGSRFLGLSGGPLNYSGLFVYLWATAMIFARCRF
Ga0192873_1029519523300018974MarineTTRIQSFILRNTVPLQNLINNRLATRPGIIGRVFKAIEMGQREYGAHTFHRAFRLVNFFWMGIFRTYALMRPVGSRFFGYSNGPLNYSGLFVYIWATAMIFARCRF
Ga0192961_1013013113300018980MarineHGELFIKYKMSQRVQSFLLRNTVGLQHLINNKLATRSGFIGRIFKGLEMGKREYSAHTFHRAFRMVNFFWMGIFRTYANMRPIGSRFFGLANGPLNYSGLFVYIWATAMIFSRCRF
Ga0192947_1016131613300018982MarineMTARIQSFILRNTGPLQNLINNRLATRPGFIGRIFKAIEMGQREYGAHTFHRAFRLVNFFWMGIFRTYAVMRPVGSRFFGYSNGPLNYSGLFVYIWATAMIFARCRF
Ga0193030_1027947413300018989MarineINNRLAPRPGPIGRLFKAIEMGQREYGAHTFHRAFRLVNFFWMGIFRTYAVMRPVGSRFFGYSNGPLNYSGLFVYIWATAMIFARCRF
Ga0192982_1017186513300019021MarineTWGIIFNKKDLNMSQRVQAFILRNTGGLQYLVNEKLGTRPGLIGRIFKGLEMGKREYSEHTLHRAFRVVNYMWMSIFRVYGAMRPVGSRFIGGGNGPLNYSGLYVYIWATMMVFARCRFSKSREQYTFNS
Ga0192951_1027905533300019022MarineKLGTRPGLIGRIFKGLEMGKREYSDHTLHRAFRVVNYMWMSIFRVYGAMRPVGSRFLGQGNGPLNYSGLYVYIWATMMVFARCKFSKSREQYTFNS
Ga0193516_1015696313300019031MarineMTERVQSFLLKNTKPLQNLINNKLATRPGMIGRIFKGIEMGNREYGAHTFHRAFRLVNFAWMGIFRTYATMRPVGSRFFGRGNGPLNYTGLFVYCWATIMIFARCRF
Ga0192869_1030466023300019032MarineMNTGGLQHLVNEKLGKRPGLIGRIFKGLEMGKREYSEHTLHRAFRVVNYMWMSIFRVYGVMRPIGSRFFGSGNGPLNYSGLYVYIWCTGMVFARCRF
Ga0192945_1022136513300019036MarineNRLATRPGLIGRFFKGLEMGKREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFFGAGNGPLNYTALLCYFWASGMILSRCRFEKARD
Ga0193336_1025799913300019045MarineVPLQNLINNRLATRPGLIGRIFKGLEMGNREYSQHTFHRMFRVVNYFWVNIFAVFARMRPVGSRFFGAGNGPLNYTGLYCYCFASAAIFSRCRFEKARDAYLFNA
Ga0192981_1019052913300019048MarineMGILIIFNKKDLNMSQRVQAFILRNTGGLQYLVNEKLGTRPGLIGRIFKGLEMGKREYSEHTLHRAFRVVNYMWMSIFRVYGAMRPVGSRFIGGGNGPLNYSGLYVYIWATMMVFARCRFSKSREQYTFNS
Ga0192981_1023172013300019048MarineLINNRLATRPGLIGRFFKGLEMGRREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFFGASNGPLNYTALLCYFWASGMILSRCRFEKARD
Ga0192981_1023224613300019048MarineLVNNRLATRPGIIGRFFKGLEMGRREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFFGAGNGPLNYTALLCYFWASGMILSRCRFEKARD
Ga0192980_105441213300019123MarineVNNRLATRPGIIGRFFKGLEMGRREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFFGAGNGPLNYTALLCYFWASGMILSRCRFEKARD
Ga0192980_105441523300019123MarineVNNRLATRPGIIGRFFKGLEMGRREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFFGASNGPLNYTALLCYFWASGMILSRCRFEKARD
Ga0192980_106089513300019123MarineMSQRVQSFLLKNTVPLQNLVNNRLATRPGIIGRFFKGLEMGRREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFFGAGNGPLNYTALLCYFWASGMILSRCRFEKARD
Ga0188870_1010768913300019149Freshwater LakeTTRIQSFILRNTGPLQNLINNRLASRPGFIGRIFKSIEMGQREYGAHTFHRAFRLVNFFWMGIFRTYALMRPVGSRFFGYSNGPLNYSGLFVYIWATAMIFARCRF
Ga0188870_1011341913300019149Freshwater LakeSQRVQSFLLKNTVPLQNLINNRLATRPGLIGRIFKGLEMGRREYSEHTFHRMFRVVNYFWVELFGVYTRMRPVGSRFFGAGNGPLNYTGLFCYFWASGMLLSRCRFEKARD
Ga0182066_111999523300019262Salt MarshQRVQSWLLKNTKGLQYLVNERLATRPGLIGRIFKGLEMGKREYSDHTLHRALRVANFMWVSIFRVYAYMRPVGSRFFGAGNGPLNYSGLFVYFFATAMVFARCRFVNARD
Ga0206687_133098413300021169SeawaterFLLNNTKPLQNLINNNLAHRPGIIGRFFKGLEMGKREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFFGAGNGPLNYTALLCYFWASGMILSRCRFEKARD
Ga0206692_103694323300021350SeawaterGLQYLVNEKLGTRPGLIGRIFKGLEMGKREYSDHTLHRAFRVVNYMWMSIFRVYGAMRPVGSRFLGGGNGPLNYSGLYVYIWATMMVFARCRFSKSREQYTFNS
Ga0206692_183586923300021350SeawaterKLKMTTRIQSFILRNTGPLQNLINNRLATRPGFVGRVFKAIEMGQREYGAHTFHRAFRLVNFFWMGIFRTYALMRPVGSRFFGYSNGPLNYSGLFVYIWATAMIFARCRF
Ga0063132_10536113300021872MarineKTLQYVVNERLAQRSGPIGNLFKALEMGKREYSAHTLHRAFRVVNYFWMRMFQIYGGMRPIGTRFLSGSNGPLNYSGLFVYCFATIMVFARLRFSKSRDQYKFNS
Ga0063105_105514313300021887MarineRVQSFLLKNTVPLQNLINNRLATRPGLIGRVFKGLEMGTREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFFGASNGPLNYTGLLCYFWASGMILSRCRFEKARDQYTFNT
Ga0063086_100918413300021902MarineGPLQNLINNRLATRPGFVGRVFKAIEMGQREYGAHTFHRAFRLVNFFWMGIFRTYALMRPVGSRFFGYSNGPLNYSGLFVYIWATAMIFARCRF
Ga0063086_102141613300021902MarineIKMTTRIQSFLLKNTVPLQNLINNRLANRPGIIGRVFKALEMGRREYGAHTFHRAFRLVNFFWMGIFRTYALMRPVGSRFLGYSNGPLNYSGLFVYLWATSMIFARCRF
Ga0063100_109628413300021910MarineAIILKNTAGLQHLINNRLATRPGGIGRLFKAIEMGQREYSAHTFHRAFRLVNFFWMGIFRTYANMRPVGSRFLGMSGGPLNYSGLFVYLWATAMIFARCRF
Ga0063106_106030713300021911MarineQRVQSFLLNNTKPLQNLINNNLAHRPGIIGRFFKGLEMGKREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFFGAGNGPLNYTALLCYFWASGMILSRCRFEKARD
Ga0063104_104493413300021913MarineSRVQSFLLKNTVPLQNLINNRLATRPGLIGRVFKGLEMGTREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFFGASNGPLNYTGLLCYFWASGMILSRCRFEKARDQYTFNT
Ga0063104_109791613300021913MarineLQAIILKNTAGLQHLINNRLATRPGGIGRLFKAIEMGQREYSAHTFHRAFRLVNFFWMGIFRTYANMRPVGSRFLGMSGGPLNYSGLFVYLWATAMIFARCRF
Ga0063085_107101813300021924MarineQSFILRNTGPLQNLINNRLATRPGFVGRVFKAIEMGQREYGAHTFHRAFRLVNFFWMGIFRTYALMRPVGSRFFGYSNGPLNYSGLFVYIWATAMIFARCRF
Ga0063096_102560313300021925MarineKMTSRLQAIILKNTAGLQHLINNRLATRPGGIGRLFKAIEMGQREYSAHTFHRAFRLVNFFWMGIFRTYANMRPVGSRFLGMSGGPLNYSGLFVYLWATAMIFARCRF
Ga0063103_100312613300021927MarineLNMTSRVQSFLLKNTVPLQNLINNRLATRPGLIGRVFKGLEMGTREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFFGASNGPLNYTGLLCYFWASGMILSRCRFEKARDQYTFNT
Ga0063103_104007013300021927MarineSQRVQSFLLKNTVPLQNLINNRLATRPGLIGRVFKGLEMGTREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFFGASNGPLNYTGLLCYFWASGMILSRCRFEKARD
Ga0063101_101927113300021950MarineMTSRVQSFLLKNTVPLQNLINNRLATRPGLIGRVFKGLEMGTREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFFGASNGPLNYTGLLCYFWASGMILSRCRFEKARDQYTFNT
Ga0063755_110083313300021954MarineVPLQNLINNRLATRPGLIGRFFKGLEMGRREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFLGASNGPLNYTALLCYFWASGMILSRCRFEKARD
Ga0222716_1034376423300021959Estuarine WaterPKPQNPKNVKYVLCVFIVLYIKNIELKMTTRIQSFILRNTGPLQNLINNRLASRPGFIGRIFKSIEMGQREYGAHTFHRAFRLVNFFWMGIFRTYALMRPVGSRFFGYSNGPLNYSGLFVYIWATAMIFARCRF
Ga0228686_103641223300023685SeawaterVQSFLLKNTKPLQNLINNNLAHRPGIIGRFFKGLEMGKREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFFGAGNGPLNYTALLCYFWASGMILSRCRFEKARD
Ga0233451_1038704613300024301Salt MarshMSQRVQSWLLKNTKGLQYLVNERLATRPGLIGRIFKGLEMGKREYSDHTLHRAMRVANFMWVSIFRVYAYMRPVGSRFFGAGNGPLNYSGLFVYFFATAMVFARCRFVNARD
Ga0209716_109839913300025626Pelagic MarineMSQRVQSFLLKNTVPLQNLINNRLATRPGLIGRFFKGLEMGRREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFLGASNGPLNYTALLCYFWASGMILSRCRFEKARD
Ga0209198_116977623300025640Pelagic MarineMSQRVQAFILRNTGGLQYLVNEKLGTRPGLIGRIFKGLEMGKREYSDHTLHRAFRVVNYMWMSIFRVYGAMRPVGSRFLGGGNGPLNYSGLYVYIWATMMVFARCRFSKSREQYTFNS
Ga0209534_1030747413300025880Pelagic MarineMTQRLQNWILKNTGGLQYLVNERLATRPGIIGRLFKSLEMGKREYSQHTLLRAFKVVNYFWMQIFHVFGTSRPHGGKFLTSLGNGPLNYSALFCWFWCTGMIIARCRFENSRDQYAFND
Ga0209631_1029156623300025890Pelagic MarineMSQRVQSFLLKNTVPLQNLINNRLATRPGLIGRIFKGLEMGRREYSEHTFHRMFRVVNYFWVELFGVYTRMRPVGSRFFGAGNGPLNYTGLFCYFWASGMLLSRCRFEKARD
Ga0208275_104821413300026182MarineLAKRPGRIGDVFRGIEMGPREYSAHALHRTFRVVNYFWMGIFKVYALMRPIGSRFMGMSNGALNYSGLFVYFWCSVMIFARCRFSKSREQWHMNA
Ga0247581_106962613300026420SeawaterNMSQRVQTFLLNNTKPLQNLINNNLAHRPGIIGRFFKGLEMGKREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFFGAGNGPLNYTALLCYFWASGMILSRCRFEKARD
Ga0247594_105204533300026448SeawaterSQRVQAFILRNTGGLQYLVNEKLGTRPGLIGRIFKGLEMGKREYSDHTLHRAFRVVNYMWMSIFRVYGAMRPVGSRFLGGGNGPLNYSGLYVYIWATMMVFARCRFSKSREQYTFNS
Ga0247588_112917713300026465SeawaterQRVQTFLLNNTKPLQNLINNNLAHRPGIIGRFFKGLEMGKREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFFGAGNGPLNYTALLCYFWASGMILSRCRFEKARD
Ga0247603_107948313300026468SeawaterRVQTFLLNNTKPLQNLINNNLAHRPGIIGRFFKGLEMGKREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFFGAGNGPLNYTALLCYFWASGMILSRCRFEKARD
Ga0247571_109342313300026495SeawaterLNMSQRVQTFLLNNTKPLQNLINNNLAHRPGIIGRFFKGLEMGKREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFFGAGNGPLNYTALLCYFWASGMILSRCRFEKARD
Ga0247571_110426513300026495SeawaterRNTGGLQYLVNEKLGTRPGLIGRIFKGLEMGKREYSDHTLHRAFRVVNYMWMSIFRVYGAMRPVGSRFLGGGNGPLNYSGLYVYIWATMMVFARCRFSKSREQYTFNS
Ga0209302_1021023613300027810MarineMTSRLQAIILKNTAGLQHLINNRLATRPGGIGRLFKAIEMGQREYSAHTFHRAFRLVNFFWMGIFRTYANMRPVGSRFLGMSGGPLNYSGLFVYLWATAMIFARCRF
Ga0209092_1028063223300027833MarineMTTRIQSFLLKNTVPLQNLINNRLANRPGIIGRVFKALEMGRREYGAHTFHRAFRLVNFFWMGIFRTYALMRPVGSRFLGYSNGPLNYSGLFVYLWATSMIFARCRF
Ga0209668_1087432713300027899Freshwater Lake SedimentVNEKLAKRSGLIGRIFKGLEMGKREYSEHTFFRAFRVVNYFWMSMWAFFARMRPIGSRFLGLSNGPLNYSGLYVYLWSTMLIFAGCRLQKTREISKFNA
Ga0247596_112681213300028106SeawaterTTRIQSFILKNTGPLQNLINNRLATRPGFIGRMFKAIEMGQREYGAHTFHRAFRLVNFFWMGIFRTYALMRPVGSRFFGYSNGPLNYSGLFVYIWATAMIFARCRF
Ga0247582_115556713300028109SeawaterRIQSFILRNTCPLQNLINNRLATRPGAIGRIFKAIEMGQREYGAHTFHRAFRLVNFFWMGIFRTYALMRPVGSRFFGYSNGPLNYSGLFVYIWATAMIFARCRF
Ga0247560_11768223300028250SeawaterQTFLLNNTKPLQNLINNNLAHRPGIIGRFFKGLEMGKREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFFGAGNGPLNYTALLCYFWASGMILSRCRFEKARD
Ga0228613_105382423300028279SeawaterMSQRVQSFLLKNTKPLQNLINNNLAHRPGIIGRFFKGLEMGKREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFFGAGNGPLNYTALLC
Ga0256413_121975723300028282SeawaterSQRVQTFLLNNTKPLQNLINNNLAHRPGIIGRFFKGLEMGKREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFFGAGNGPLNYTALLCYFWASGMILSRCRFEKARD
Ga0256413_136606013300028282SeawaterSFLLRNTKPLQYLINERYAKRPGLIGRIFKGLEMGKREYSEHTLHRSFRVVNYFWMSIFGIYGRMRPIGSRFLTNSNGPLNYSGLYVYMFVTFMVFARCRF
Ga0247572_110587313300028290SeawaterLNMSQRVQAFILRNTGGLQYLVNEKLGTRPGLIGRIFKGLEMGKREYSDHTLHRAFRVVNYMWMSIFRVYGAMRPVGSRFLGGGNGPLNYSGLYVYIWATMMVFARCRFSKSREQYTFNS
Ga0247572_118232813300028290SeawaterIELKMTTRIQSFILRNTGPLQNLINNRLAIRPGFIGRIFKAIEMGPREYGAHTFHRAFRLVNFFWMGIFRTYALMRPVGSRFFGYSNGPLNYSGLFVYIWATAMIFARCRF
Ga0247566_104658113300028335SeawaterKMTTRIQSFILRNTVPLQNLINNRLATRPGAIGRIFKAIEMGQREYGAHTFHRAFRLVNFFWMGIFRTYALMRPVGSRFFGYSNGPLNYSGLFVYIWATAMIFARCRF
Ga0307403_1056618613300030671MarineNTKPLQNLINNNLAHRPGIIGRFFKGLEMGKREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFFGAGNGPLNYTALLCYFWASGMILSRCRFEKARD
Ga0073964_1148375213300030788MarineQGLQYVVNERLAARDNLIGRMFKPFIIGKREYSAHTFHRAFRVVNYFWMRMFQIYGGMRPIGSRFLTNSGGGPLNYSGLFVYCFATVCVFARLRFSKSRDQYKFNS
Ga0307386_1047427723300031710MarineSERVQSFLLRNTRGLQYLINERLATRSGLIGRMFKGIEMGKREYGEHTFHRAFRMVNYFWVQIFHVMGGMRPIGSRFLSNANGPLNYSGLYVYILVTMMVFARCRF
Ga0307391_1087349823300031729MarineQSFLLKNTKPLQNLINNNLAHRPGIIGRFFKGLEMGKREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFFGAGNGPLNYTALLCYFWASGMILSRCRFEKARD
Ga0307394_1029773913300031735MarineQRVQSFLLKNTVGLQHLINNKLATRSGIIGRIFKGLEMGKREYSAHTFHRAFRMVNFFWMGIFRTYANMRPIGSRFFGLANGPLNYSGLFVYIWATAMIFSRCRF
Ga0307394_1047026423300031735MarineSQRVQSFLLNNTKPLQNLINNNLAHRPGIIGRFFKGLEMGKREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFSGASNGPLNYTALLCYFWASGMILSRCRFEKARD
Ga0307384_1040594913300031738MarineILSIKMTTRIQSFLLKNTVPLQNLINNRLATRPGFIGRIFKTIEMGQREYGAHTFHRAFRLVNFFWMGIFRTYALMRPVGSRFFGYSNGPLNYSGLFVYIWATAMIFARCRF
Ga0307395_1029216513300031742MarineNTVGLQHLINNKLATRSGIIGRIFKGLEMGKREYSAHTFHRAFRMVNFFWMGIFRTYANMRPIGSRFFGLANGPLNYSGLFVYIWATAMIFSRCRF
Ga0307389_1056093513300031750MarineIDKMTARIQSFILRNTGPLQNLINNRLATRPGFIGRIFKAIEMGQREYGAHTFHRAFRLVNFFWMGIFRTYAVMRPVGSRFFGYSNGPLNYSGLFVYIWATAMIFARCRF
Ga0314679_1034896733300032492SeawaterLRNTGGLQYLVNEKLAQRPGLIGRIFKGLEMGKREYSEHTLHRAFRVVNYMWMSIFRVYGVMRPIGSRFFGTGNGPLNYSGLYVYIWCTGMVFARCRF
Ga0314688_1046068913300032517SeawaterLNMSQRVQSFLLKNTVPLQNLINNRLATRPGLIGRFFKGLEMGRREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFLGASNGPLNYTALLCYFWASGMILSRCRFEKARD
Ga0314688_1046627433300032517SeawaterLRNTGGLQYLVNEKLGTRPGLIGRIFKGLEMGKREYSDHTLHRAFRVVNYMWMSIFRVYGAMRPVGSRFLGGGNGPLNYSGLYVYIWATMMVFARCRFSKSREQYTFNS
Ga0314689_1052360713300032518SeawaterNNRLATRPGLIGRFFKGLEMGRREYSEHTFHRMFRLVNFFWVGLFSLYTRMRPVGSRFLGASNGPLNYTALLCYFWASGMILSRCRFEKARD
Ga0314676_1064838113300032519SeawaterQAFILRNTGGLQYLVNEKLGTRPGLIGRIFKGLEMGKREYSDHTLHRAFRVVNYMWMSIFRVYGAMRPVGSRFLGGGNGPLNYSGLYVYIWATMMVFARCRFSKSREQYTFNS
Ga0314677_1038322313300032522SeawaterNMSQRVQAFILRNTGGLQYLVNEKLGTRPGLIGRIFKGLEMGKREYSDHTLHRAFRVVNYMWMSIFRVYGAMRPVGSRFLGGGNGPLNYSGLYVYIWATMMVFARCRFSKSREQYTFNS
Ga0314671_1044595913300032616SeawaterSQRVQSFLLKNTVPLQNLINNRLATRPGLIGRFFKGLEMGRREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFLGASNGPLNYTALLCYFWASGMILSRCRFEKARD
Ga0314671_1066704013300032616SeawaterTRPGLIGRIFKGLEMGKREYSDHTLHRAFRVVNYMWMSIFRVYGAMRPVGSRFLGGGNGPLNYSGLYVYIWATMMVFARCRFSKSREQYTFNS
Ga0314687_1043001513300032707SeawaterQRVQAFILRNTGGLQYLVNEKLGTRPGLIGRIFKGLEMGKREYSDHTLHRAFRVVNYMWMSIFRVYGAMRPVGSRFLGGGNGPLNYSGLYVYIWATMMVFARCRFSKSREQYTFNS
Ga0314686_1041658313300032714SeawaterGLQYLVNEKLAQRPGLIGRIFKGLEMGKREYSEHTLHRAFRVVNYMWMSIFRVYGVMRPIGSRFFGTGNGPLNYSGLYVYIWCTGMVFARCRF
Ga0314686_1064809523300032714SeawaterNMSQRVQSFLLKNTVPLQNLINNRLATRPGLIGRFFKGLEMGRREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFLGASNGPLNYTALLCYFWASGMILSRCRFEKARD
Ga0314701_1042118213300032746SeawaterRVQSFLLKNTVPLQNLINNRLATRPGLIGRFFKGLEMGRREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFLGASNGPLNYTALLCYFWASGMILSRCRFEKARD
Ga0314713_1037318613300032748SeawaterQRVQSFLLKNTVPLQNLINNRLATRPGLIGRFFKGLEMGRREYSEHTFHRMFRLVNFFWVGLFSVYTRMRPVGSRFLGASNGPLNYTALLCYFWASGMILSRCRFEKARD
Ga0314700_1039104613300032752SeawaterKMTTRIQSFILRNTGPLQNLINNRLASRPGFIGRIFKSIEMGQREYGAHTFHRAFRLVNFFWMGIFRTYALMRPVGSRFFGYSNGPLNYSGLFVYIWATAMIFARCRF
Ga0307390_1092271223300033572MarineLVNEKLGKRPGLIGRIFKGLEMGKREYSEHTLHRAFRVVNYMWMSIFRVYGVMRPIGSRFLGQGNGPLNYSGLYVYMWATAMVFARCRF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.