NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F056174

Metagenome Family F056174

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F056174
Family Type Metagenome
Number of Sequences 138
Average Sequence Length 43 residues
Representative Sequence MRKGLSGGVKSGPPPKKGPNPQGIKLKDAKKLLRKAVRKK
Number of Associated Samples 99
Number of Associated Scaffolds 138

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 55.80 %
% of genes near scaffold ends (potentially truncated) 42.75 %
% of genes from short scaffolds (< 2000 bps) 73.19 %
Associated GOLD sequencing projects 78
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (79.710 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(38.406 % of family members)
Environment Ontology (ENVO) Unclassified
(76.087 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(88.406 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 20.59%    β-sheet: 0.00%    Coil/Unstructured: 79.41%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 138 Family Scaffolds
PF00961LAGLIDADG_1 6.52
PF00166Cpn10 2.17
PF136402OG-FeII_Oxy_3 1.45
PF13578Methyltransf_24 1.45
PF07883Cupin_2 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 138 Family Scaffolds
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 2.17

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.58 %
UnclassifiedrootN/A7.97 %
unclassified Hyphomonasno rankunclassified Hyphomonas1.45 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000947|BBAY92_10113551All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium718Open in IMG/M
3300000973|BBAY93_10153376All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium579Open in IMG/M
3300001419|JGI11705J14877_10067164All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1153Open in IMG/M
3300002231|KVRMV2_101564916All Organisms → cellular organisms → Bacteria → Proteobacteria703Open in IMG/M
3300002482|JGI25127J35165_1117917All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium526Open in IMG/M
3300002483|JGI25132J35274_1002825All Organisms → cellular organisms → Bacteria4501Open in IMG/M
3300002483|JGI25132J35274_1018077All Organisms → cellular organisms → Bacteria → Proteobacteria1690Open in IMG/M
3300004097|Ga0055584_100258560All Organisms → cellular organisms → Bacteria1779Open in IMG/M
3300004097|Ga0055584_100920766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium915Open in IMG/M
3300004951|Ga0068513_1025608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium639Open in IMG/M
3300005074|Ga0070431_1015872All Organisms → cellular organisms → Bacteria4348Open in IMG/M
3300005346|Ga0074242_10902505Not Available2383Open in IMG/M
3300006025|Ga0075474_10169482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium679Open in IMG/M
3300006026|Ga0075478_10112410All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria864Open in IMG/M
3300006027|Ga0075462_10018592All Organisms → cellular organisms → Bacteria2240Open in IMG/M
3300006027|Ga0075462_10209582All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria584Open in IMG/M
3300006637|Ga0075461_10216567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium569Open in IMG/M
3300006735|Ga0098038_1005315Not Available5245Open in IMG/M
3300006735|Ga0098038_1031509All Organisms → cellular organisms → Bacteria1976Open in IMG/M
3300006735|Ga0098038_1041991All Organisms → cellular organisms → Bacteria1675Open in IMG/M
3300006735|Ga0098038_1042509All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1663Open in IMG/M
3300006735|Ga0098038_1048140All Organisms → cellular organisms → Bacteria1546Open in IMG/M
3300006735|Ga0098038_1068248All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1261Open in IMG/M
3300006737|Ga0098037_1116780All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria915Open in IMG/M
3300006737|Ga0098037_1123848All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium882Open in IMG/M
3300006749|Ga0098042_1046113All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1194Open in IMG/M
3300006752|Ga0098048_1142261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium717Open in IMG/M
3300006789|Ga0098054_1219757All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium690Open in IMG/M
3300006790|Ga0098074_1047032All Organisms → cellular organisms → Bacteria1215Open in IMG/M
3300006793|Ga0098055_1337864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium561Open in IMG/M
3300006802|Ga0070749_10135955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1437Open in IMG/M
3300006867|Ga0075476_10273801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium597Open in IMG/M
3300006868|Ga0075481_10016386All Organisms → cellular organisms → Bacteria2945Open in IMG/M
3300006916|Ga0070750_10019190Not Available3489Open in IMG/M
3300006916|Ga0070750_10101614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1332Open in IMG/M
3300006919|Ga0070746_10516716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium522Open in IMG/M
3300006921|Ga0098060_1113363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium763Open in IMG/M
3300006921|Ga0098060_1154336All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria636Open in IMG/M
3300006922|Ga0098045_1019387Not Available1825Open in IMG/M
3300006924|Ga0098051_1054628All Organisms → cellular organisms → Bacteria1100Open in IMG/M
3300006928|Ga0098041_1068146All Organisms → cellular organisms → Bacteria1149Open in IMG/M
3300006928|Ga0098041_1109554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium891Open in IMG/M
3300006928|Ga0098041_1117773All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium857Open in IMG/M
3300006929|Ga0098036_1078785All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1015Open in IMG/M
3300006929|Ga0098036_1262739All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium521Open in IMG/M
3300006958|Ga0101660_103026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium662Open in IMG/M
3300009027|Ga0102957_1055924All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1355Open in IMG/M
3300010299|Ga0129342_1093933All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1130Open in IMG/M
3300010318|Ga0136656_1124344All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria893Open in IMG/M
3300012920|Ga0160423_10334681unclassified Hyphomonas → Hyphomonas sp.1039Open in IMG/M
3300012920|Ga0160423_10616485All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria734Open in IMG/M
3300017721|Ga0181373_1088277All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria551Open in IMG/M
3300017726|Ga0181381_1016432Not Available1705Open in IMG/M
3300017755|Ga0181411_1007755All Organisms → cellular organisms → Bacteria3628Open in IMG/M
3300017756|Ga0181382_1196393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium511Open in IMG/M
3300017767|Ga0181406_1119018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium797Open in IMG/M
3300017769|Ga0187221_1169962All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium640Open in IMG/M
3300017781|Ga0181423_1016748Not Available3025Open in IMG/M
3300017824|Ga0181552_10017809All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria4498Open in IMG/M
3300017963|Ga0180437_11287101Not Available519Open in IMG/M
3300018080|Ga0180433_10140971All Organisms → cellular organisms → Bacteria2021Open in IMG/M
3300018080|Ga0180433_10614632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium815Open in IMG/M
3300018415|Ga0181559_10781768Not Available508Open in IMG/M
3300018416|Ga0181553_10118279All Organisms → cellular organisms → Bacteria1613Open in IMG/M
3300018416|Ga0181553_10381244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium769Open in IMG/M
3300018420|Ga0181563_10251531All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1053Open in IMG/M
3300018420|Ga0181563_10703835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium557Open in IMG/M
3300018421|Ga0181592_10343533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1068Open in IMG/M
3300018424|Ga0181591_10086940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium2575Open in IMG/M
3300020051|Ga0181555_1099308All Organisms → cellular organisms → Bacteria1291Open in IMG/M
3300020400|Ga0211636_10333118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium575Open in IMG/M
3300020403|Ga0211532_10351843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium560Open in IMG/M
3300020410|Ga0211699_10252983All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium680Open in IMG/M
3300020436|Ga0211708_10003323All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria6014Open in IMG/M
3300020436|Ga0211708_10156524All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300020439|Ga0211558_10138157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1179Open in IMG/M
3300021356|Ga0213858_10194011All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria987Open in IMG/M
3300021959|Ga0222716_10093801All Organisms → cellular organisms → Bacteria2040Open in IMG/M
3300021964|Ga0222719_10056993All Organisms → Viruses → Predicted Viral2959Open in IMG/M
3300022057|Ga0212025_1050657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium716Open in IMG/M
3300022063|Ga0212029_1062562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium544Open in IMG/M
3300022065|Ga0212024_1006419Not Available1624Open in IMG/M
3300022068|Ga0212021_1053224All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria823Open in IMG/M
3300022069|Ga0212026_1076508Not Available509Open in IMG/M
3300022071|Ga0212028_1026222All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300022158|Ga0196897_1013590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1004Open in IMG/M
3300022164|Ga0212022_1051849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium634Open in IMG/M
3300022168|Ga0212027_1005171All Organisms → Viruses → Predicted Viral1745Open in IMG/M
3300022183|Ga0196891_1032493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium977Open in IMG/M
3300022907|Ga0255775_1200748All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria763Open in IMG/M
3300022929|Ga0255752_10071764All Organisms → Viruses2013Open in IMG/M
3300024301|Ga0233451_10199569All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria854Open in IMG/M
3300024433|Ga0209986_10025456All Organisms → cellular organisms → Bacteria3883Open in IMG/M
3300024433|Ga0209986_10063651All Organisms → Viruses2122Open in IMG/M
3300025070|Ga0208667_1002862All Organisms → cellular organisms → Bacteria5416Open in IMG/M
3300025070|Ga0208667_1013110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1810Open in IMG/M
3300025083|Ga0208791_1003018All Organisms → cellular organisms → Bacteria5322Open in IMG/M
3300025086|Ga0208157_1006966All Organisms → Viruses3959Open in IMG/M
3300025086|Ga0208157_1028981All Organisms → Viruses1612Open in IMG/M
3300025086|Ga0208157_1029102All Organisms → cellular organisms → Bacteria1608Open in IMG/M
3300025099|Ga0208669_1086044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium670Open in IMG/M
3300025101|Ga0208159_1010722All Organisms → cellular organisms → Bacteria2482Open in IMG/M
3300025101|Ga0208159_1042825All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium971Open in IMG/M
3300025101|Ga0208159_1098844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium522Open in IMG/M
3300025102|Ga0208666_1012505All Organisms → Viruses2872Open in IMG/M
3300025102|Ga0208666_1084359All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria811Open in IMG/M
3300025110|Ga0208158_1009006All Organisms → Viruses → Predicted Viral2765Open in IMG/M
3300025120|Ga0209535_1024005All Organisms → cellular organisms → Bacteria3017Open in IMG/M
3300025127|Ga0209348_1001853All Organisms → Viruses10138Open in IMG/M
3300025127|Ga0209348_1010851All Organisms → cellular organisms → Bacteria3650Open in IMG/M
3300025127|Ga0209348_1011381Not Available3543Open in IMG/M
3300025127|Ga0209348_1078631All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1056Open in IMG/M
3300025127|Ga0209348_1171971unclassified Hyphomonas → Hyphomonas sp.624Open in IMG/M
3300025128|Ga0208919_1000216All Organisms → cellular organisms → Bacteria42247Open in IMG/M
3300025128|Ga0208919_1036830All Organisms → Viruses → Predicted Viral1739Open in IMG/M
3300025128|Ga0208919_1160370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium692Open in IMG/M
3300025137|Ga0209336_10124942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium702Open in IMG/M
3300025151|Ga0209645_1012677All Organisms → Viruses3351Open in IMG/M
3300025151|Ga0209645_1044397All Organisms → Viruses1583Open in IMG/M
3300025151|Ga0209645_1075609All Organisms → Viruses → Predicted Viral1128Open in IMG/M
3300025151|Ga0209645_1219321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium549Open in IMG/M
3300025647|Ga0208160_1045239All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1273Open in IMG/M
3300025674|Ga0208162_1012968All Organisms → Viruses3420Open in IMG/M
3300025674|Ga0208162_1121299All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria750Open in IMG/M
3300025687|Ga0208019_1022970All Organisms → cellular organisms → Bacteria2412Open in IMG/M
3300025759|Ga0208899_1144940All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria820Open in IMG/M
3300025759|Ga0208899_1148700All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria804Open in IMG/M
3300025810|Ga0208543_1036101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1236Open in IMG/M
3300025815|Ga0208785_1046779All Organisms → cellular organisms → Bacteria1228Open in IMG/M
3300025815|Ga0208785_1067961All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria947Open in IMG/M
3300025897|Ga0209425_10059695All Organisms → Viruses2470Open in IMG/M
3300026138|Ga0209951_1050845All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria889Open in IMG/M
3300026187|Ga0209929_1009914All Organisms → cellular organisms → Bacteria3115Open in IMG/M
3300029309|Ga0183683_1000084All Organisms → cellular organisms → Bacteria56835Open in IMG/M
3300029309|Ga0183683_1005274All Organisms → cellular organisms → Bacteria3966Open in IMG/M
3300029792|Ga0183826_1021750All Organisms → cellular organisms → Bacteria1031Open in IMG/M
3300034374|Ga0348335_111379All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria833Open in IMG/M
3300034375|Ga0348336_020819All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium3400Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine38.41%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous23.19%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh8.70%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine6.52%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater4.35%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine2.17%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water2.17%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment2.17%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater1.45%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface1.45%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.45%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.45%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment1.45%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface1.45%
Marine WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water0.72%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.72%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment0.72%
Marine Benthic Sponge Stylissa Massa AssociatedHost-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Benthic Sponge Stylissa Massa Associated0.72%
Coelocarteria Singaporensis (Marine Sponge)Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Coelocarteria Singaporensis (Marine Sponge)0.72%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000947Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92Host-AssociatedOpen in IMG/M
3300000973Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93Host-AssociatedOpen in IMG/M
3300001419Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m)EnvironmentalOpen in IMG/M
3300002231Marine sediment microbial communities from Santorini caldera mats, Greece - red matEnvironmentalOpen in IMG/M
3300002482Marine viral communities from the Pacific Ocean - ETNP_2_30EnvironmentalOpen in IMG/M
3300002483Marine viral communities from the Pacific Ocean - ETNP_6_30EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004951Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-EVsEnvironmentalOpen in IMG/M
3300005074Marine benthic sponge Stylissa massa associated microbial communities from Guam, USAHost-AssociatedOpen in IMG/M
3300005346Saline sediment microbial community from Etoliko Lagoon, GreeceEnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006790Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006867Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006928Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaGEnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300006958Marine sponge C. singaporensis. microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble', co31isHost-AssociatedOpen in IMG/M
3300009027Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MGEnvironmentalOpen in IMG/M
3300010299Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010318Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNAEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300017721Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaGEnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017756Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017963Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaGEnvironmentalOpen in IMG/M
3300018080Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaGEnvironmentalOpen in IMG/M
3300018415Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018421Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020051Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020400Marine microbial communities from Tara Oceans - TARA_B100001115 (ERX555947-ERR598992)EnvironmentalOpen in IMG/M
3300020403Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145)EnvironmentalOpen in IMG/M
3300020410Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148)EnvironmentalOpen in IMG/M
3300020436Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984)EnvironmentalOpen in IMG/M
3300020439Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029)EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022057Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2)EnvironmentalOpen in IMG/M
3300022063Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022069Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2)EnvironmentalOpen in IMG/M
3300022071Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2)EnvironmentalOpen in IMG/M
3300022158Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v3)EnvironmentalOpen in IMG/M
3300022164Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2)EnvironmentalOpen in IMG/M
3300022168Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2)EnvironmentalOpen in IMG/M
3300022183Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3)EnvironmentalOpen in IMG/M
3300022907Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaGEnvironmentalOpen in IMG/M
3300022929Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaGEnvironmentalOpen in IMG/M
3300024301Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504CT (spades assembly)EnvironmentalOpen in IMG/M
3300024433Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025083Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025099Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025101Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025102Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025110Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025127Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025128Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025687Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025815Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300026138Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026187Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300029309Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440EnvironmentalOpen in IMG/M
3300029792Marine giant viral communities collected during Tara Oceans survey from station TARA_041 - TARA_Y100000052EnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M
3300034375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
BBAY92_1011355123300000947Macroalgal SurfaceMRSEEQNKRKGLSGGVKSGPPPKRGPNPQGISLKNAKKFLRKSFRKK*
BBAY93_1015337623300000973Macroalgal SurfaceMRSERQNVRKGLSGGVKFGPPPKKGPNPQGIKIMRSKDGKKRLRKSIRKK*
JGI11705J14877_1006716423300001419Saline Water And SedimentMRKGLSGGKKYGPPPKKGPNPQGIKLKDAKKLLRKTL
KVRMV2_10156491623300002231Marine SedimentLRRNNEKGLSGAVKFGPPPKRGPNPQGIKMVRSNGKKLLRKS
JGI25127J35165_111791723300002482MarineMRSEEQNKRKGLSGGVKSGPPPKRGPNPQGITVKHAKKVLRKFKRNK*
JGI25132J35274_1002825103300002483MarineMNKRKGLSGGVKSGPPPKKGPNPQGITVKDAKRVLRKLKRNK*
JGI25132J35274_101807723300002483MarineMQSERQNKRKGLSGGVKFGPPPKRGPNPQGIKIVRSKNAKKLVRKSSKRT*
Ga0055584_10025856023300004097Pelagic MarineMTRSNEKGLSGGKRYGPPPKRGPNPQGITIAKAKKLLRKAVKKK*
Ga0055584_10092076633300004097Pelagic MarineLTQRNNNSLSGGVKSGPPPKRGPNPQGIKIRDAKKLLRKTFKKK*
Ga0068513_102560823300004951Marine WaterMRSEELNKRKGLSGGVRSGPPPKRGPNPQGITVKHAKKVLQKSKRNK*
Ga0070431_101587243300005074Marine Benthic Sponge Stylissa Massa AssociatedMQSERRDVRKGLSGGVKFGPPPKKGPNPQGIKIMRSSNGKKRLRKSTRKK*
Ga0074242_1090250543300005346Saline Water And SedimentMRKGLSGGKKYGPPPKKGPNPQGIKLKDAKKLLRKTLKKK*
Ga0075474_1016948213300006025AqueousKRSTRKNKGKGLSGGVKYGPPPKKGPNPQGIELNRVKKLLRKAIGKK*
Ga0075478_1011241023300006026AqueousMRKGLSGGKKYGPPPKKGPNPQGIKLKDAKKILRKTLKKK*
Ga0075462_1001859243300006027AqueousMRKGLSGGVKSGPPPKKGPNPQGIKLKNAKKLLRKTLKKK*
Ga0075462_1020958223300006027AqueousMRKGLSGGVKYGPPPKRGPNPQGIKILNKGSKNKNIYK
Ga0075461_1021656713300006637AqueousSGGVKYGPPPKKGPNPQGIELNRAKRLLRQALKKK*
Ga0098038_1005315133300006735MarineGGVRYGPPPKKGPNPQGIKVSERKKLLRKLAGKA*
Ga0098038_103150933300006735MarineMRKGLSGGVKSGPPPKKGPNPQGIKLKHAKKLLRKAVRKK*
Ga0098038_104199133300006735MarineMQSERQNKRRGLSGGVKFGPPPKRGPNPQGIKIVRSKNAKKLVRKSTKKS*
Ga0098038_104250933300006735MarineMRLEKQKKRKGLSGGVRYGPPPKKGPNPQGIKVSERKKLLRKLAGKA*
Ga0098038_104814033300006735MarineMRSEEQNKRKGLSGGVKSGPPPKKGPNSQGITVKDAKKVLRKSKRNK*
Ga0098038_106824833300006735MarineMRSEKQKKRKGLSGGVRYGPPPKKGPNPQGIKVSERKKLLRKLAGKA*
Ga0098037_111678013300006737MarineMRKGLSGGVKSGPPPKRGPNPQGIKLKHAKKLLRKAVRKK*
Ga0098037_112384833300006737MarineMRSEKQKKRKGLSGGVRYGPPPKKGPNPQGIKVSERKKLLRKLAGK
Ga0098042_104611333300006749MarineMRSEEQNKRKGLSGGVRSGPPPKRGPNPQGITVKHAKKVLQKSKRNK*
Ga0098048_114226133300006752MarineRRNNEKGLSGGVRSGPPPKRGPNPQGISVKHAKKVLRKSQRKK*
Ga0098054_121975723300006789MarineMQSEKQKKRKGLSGGVRYGPPPKKGPNPQGIKVSERKKLLQKLAGKA*
Ga0098074_104703233300006790MarineMQSEKQKKRKGLSGGVRYGPPPKKGPNPQGIKVSERKKLLRKLAGKA*
Ga0098055_133786433300006793MarineTIKMRKGLSGGVKSGPPPKRGPNPQGIKLKHAKKLLRKAVRKK*
Ga0070749_1013595523300006802AqueousMRKGLSGGVKSGPPPKKGPNPQGITLKDAKKLLRKTFKKK*
Ga0075476_1027380113300006867AqueousSTRKNKGKGLSGGVKYGPPPKKGPNPQGIELNRVKKLLRKAIGKK*
Ga0075481_1001638643300006868AqueousMRKGLSGGVKSGPPPKKGPNPQGIKLRNAKKLLRKTFKKK*
Ga0070750_1001919033300006916AqueousMRRNNEKGLSGGVRSGPPPKRGPNPQGITVKHAKKVLRRSQRKK*
Ga0070750_1010161423300006916AqueousMRKGLSGGVKSGPPPKKGPNPQGITLKNAKKFLRKSFRKK*
Ga0070746_1051671613300006919AqueousKRSTRKNKGKGLSGGVKYGPPPKKGPNPQGIKLNRAKRLLRQALKKK*
Ga0098060_111336323300006921MarineMRKGLSGGVKSGPPPKKGPNPQGIKLKNAKKLLRKVVRKK*
Ga0098060_115433623300006921MarineMRKGLSGGVRSGPPPKRGPNPQGIKLKHAKKLLRKAV
Ga0098045_101938713300006922MarineKMRKGLSGGVKSGPPPKKGPNPQGIKLKNDKKFVRKIVRKK*
Ga0098051_105462813300006924MarineNNEKGLSGGVKSGPPPKKGPNPQGITVKDAKRVLRKLKRNK*
Ga0098041_106814653300006928MarineMRSEEQNKRKGLSGGVKSGPPPKRGPNPQGITVKDAKRVLRKLKRNK*
Ga0098041_110955413300006928MarineSEKQKKRKGLSGGVRYGPPPKKGPNPQGIKVSERKKLLQKLAGKA*
Ga0098041_111777313300006928MarineMQSEKQKKRKGLSGGVRYGPPPKRGPNPQGLKVGDAKKLLRKSSGKV*
Ga0098036_107878523300006929MarineMRSEEQSKRKGLSGGVKSGPPPKRGPNPQGITVKDAKRVLRKLKRNK*
Ga0098036_126273923300006929MarineMRSEEQNKRKGLSGGVRSGPPPKRGPNPQGITIKDAKRILRKLKREK*
Ga0101660_10302633300006958Coelocarteria Singaporensis (Marine Sponge)KNKNTKRKGLSGGVRYGPPPKKGPNPQGINVSDAKKLLRKSSTKA*
Ga0102957_105592413300009027Pond WaterMRKGLSGGKKYGPPPKKGPNPQGIKLKDAKKLLRKAHKKK*
Ga0129342_109393323300010299Freshwater To Marine Saline GradientMRKGLSGGKKYGPPPKKGPNPQGIKLKDAKKLLRKTLK
Ga0136656_112434423300010318Freshwater To Marine Saline GradientMRKGLSGGKKYGPPPKKGPNPQGIKLKDAKKLLRKTFKKK*
Ga0160423_1033468113300012920Surface SeawaterKRKGLSGGVRYGPPPKKGPNPQGIKVSERKKLLRKLAGKA*
Ga0160423_1061648523300012920Surface SeawaterLQKNKDTKRKGLSGGVRYGPPPKKGPNPQGIKVSERKKLLRKLAGKA*
Ga0181373_108827723300017721MarineMLRERNLRKNNEKGLSGGVRSGPPPKRGPNPQGISVKHAKKVLRKSQRK
Ga0181381_101643263300017726SeawaterQRRNNSLSGRVKSGPPPKRGPNPQGIKIQDAKKLLRKSFRKK
Ga0181411_1007755133300017755SeawaterMLLEKNLRRNNEKGLSGGVRSGPPPKRGPNPQGISVKNAKKFLRKSVRKK
Ga0181382_119639313300017756SeawaterTQRRNNSLSGGVKSGPPPKRGPNPQGIKIQDAKKLLRKSFRKK
Ga0181406_111901823300017767SeawaterMQKKRKGLSGGVRSGPPPKRGPNPQGITFKHAKKILRKSKQNK
Ga0187221_116996213300017769SeawaterNEKGLSGGVRSGPPPKRGPNPQGIKIVRSKHGNKFLRKTSRGK
Ga0181423_101674813300017781SeawaterMLLEKNLRRNNEKGLSGGVRSGPPPKRGPNPQGISVKNAKKLLRKSVRKK
Ga0181552_1001780943300017824Salt MarshMRKGLSGGVRSGPPPKRGPNPQGIKLKHAKKLLRKAVRKK
Ga0180437_1128710113300017963Hypersaline Lake SedimentMRKGLSGGKKYGPPPKKGPNPQGIKLKDAKKLLRKTLKKK
Ga0180433_1014097123300018080Hypersaline Lake SedimentMRKGLSGGVKSGPPPKKGPNPQGLKLKDVKKFLRKPSKKK
Ga0180433_1061463213300018080Hypersaline Lake SedimentGLSGGVKYGPPPKKGPNPQGIKLNRVKKLLRKAIGKK
Ga0181559_1078176823300018415Salt MarshMRKGLSGGVRSGPPPKRGPNPQGIKLKHAKKLLRKAVRK
Ga0181553_1011827933300018416Salt MarshMQSEKQKKRKGLSGGVRYGPPPKKGPNPQGIKVSERKKLLRKLAGKA
Ga0181553_1038124433300018416Salt MarshMRRNNEKGLSGGVRSGPPPKRGPNPQGITVKHAKKVLRRSQRKK
Ga0181563_1025153133300018420Salt MarshMRSEKQKKRKGLSGGVRYGPPPKKGPNPQGIKVSERKKLLRKLAGKA
Ga0181563_1070383513300018420Salt MarshKRKGLSGGVRYGPPPKKGPNPQGIKVSERKKLLQKLAGKA
Ga0181592_1034353323300018421Salt MarshMRKGLSGGVKSGPPPKKGPNPQGITLKDAKKILRKTFKKK
Ga0181591_1008694033300018424Salt MarshMRKGLSGGVKSGPPPKKGPNPQGITLKDAKKVLRKTFKKK
Ga0181555_109930823300020051Salt MarshMRKGLSGGVRSGPPPKRGPNPQGIKLKHAKKLLRKAIRKK
Ga0211636_1033311823300020400MarineMQSERQTKRKGLSGGVKFGPPPKKGPNPQGIKMVRSKNAKKLVRNARKKS
Ga0211532_1035184323300020403MarineMRSERQNVRKGLSGGVKFGPPPKKGPNPQGIKIMRSKDGKKRLRKSIRKK
Ga0211699_1025298323300020410MarineMQSERRNVRKGLSGGVKFGPPPKRGPNPQGLQMMRSKDGKKRLRKSIKKK
Ga0211708_1000332363300020436MarineMQSERRNVRKGLSGGVKFGPPPKRGPNPQGLQMMRSKDGKKRLRKSIRKK
Ga0211708_1015652423300020436MarineMQSERRNVRKGLSGGVKYGPPPKKGPNPQGLKMMRSNNDKKRLRKSARKK
Ga0211558_1013815743300020439MarineMRKGLSGGVKSGPPPKRGPNPQGIKLKNVKKLLRKSQRKK
Ga0213858_1019401113300021356SeawaterMRKGLSGGKKSGPPPKRGPNPQGISLKNAKKFLRKSFRKK
Ga0222716_1009380163300021959Estuarine WaterMRKGLSGGVKSGPPPKRGPNPQGIKLKHAKKLLRKAVRKK
Ga0222719_1005699333300021964Estuarine WaterMRKGLSGGVKSGPPPKKGPNPQGIKLKNAKKLLQKTLKKK
Ga0212025_105065713300022057AqueousSGGKKYGPPPKKGPNPQGIKLKDAKKLLRKTLKKK
Ga0212029_106256223300022063AqueousMRKGLSGGVKSGPPPKKGPNPQGITLKDAKKLLRKTFKKK
Ga0212024_100641953300022065AqueousMRKGLSGGVKSGPPPKKGPNPQGIKLKNAKKLLRKTLKKK
Ga0212021_105322423300022068AqueousMRKGLSGGKKYGPPPKKGPNPQGIKLKDAKKILRKTL
Ga0212026_107650823300022069AqueousMRKGLSGGKKYGPPPKKGPNPQGIKLKDAKKILRKTLKKK
Ga0212028_102622243300022071AqueousRSTRKNKGKGLSGGVKYGPPPKKGPNPQGIELNRVKKLLRKAIGKK
Ga0196897_101359013300022158AqueousMRKGLSGGVKYGPPPKRGPNPQGIKILNKGSKNKNIYKKRK
Ga0212022_105184913300022164AqueousERKLTQRNNEKGLSGGVRSGPPPKRGPNPQGIKIQNAKKLLRKSFRKK
Ga0212027_100517133300022168AqueousMRKGLSGGVKSGPPPKKGPNPQGIKLRNAKKLLRKTFKKK
Ga0196891_103249313300022183AqueousEKGLSGGVRSGPPPKRGPNPQGIKIQNAKKLLRKSFRKK
Ga0255775_120074813300022907Salt MarshMRKGLSGGVRSGPPPKRGPNPQGIKLKHAKKLLRKA
Ga0255752_1007176473300022929Salt MarshKQKKRKGLSGGVRYGPPPKKGPNPQGIKVSERKKLLRKLAGKA
Ga0233451_1019956923300024301Salt MarshMRKGLSGGVRSGPPPKRGPNPQGIKLKHAKKLLRKS
Ga0209986_1002545633300024433Deep SubsurfaceMRKGLSGGVRSGPPPKRGPNPQGIKLKYAKKLLRKAIRKK
Ga0209986_1006365183300024433Deep SubsurfaceEDTIKMRKGLSGGVRSGPPPKRGPNPQGIKLKHAKKLLRKAVRKK
Ga0208667_100286253300025070MarineMRKGLSGGVKSGPPPKKGPNPQGIKLKHAKKLLRKAVRKK
Ga0208667_101311023300025070MarineMRKGLSGGVKSGPPPKKGPNPQGIKLKNDKKFVRKIVRKK
Ga0208791_100301863300025083MarineMLLEKKLTQRRNNSLSGGVKSGPPPKRGPNPQGIKIQDAKKLLRKSVRKK
Ga0208157_100696633300025086MarineMRSEEQNKRKGLSGGVKSGPPPKKGPNSQGITVKDAKKVLRKSKRNK
Ga0208157_102898133300025086MarineMQSERQNKRRGLSGGVKFGPPPKRGPNPQGIKIVRSKNAKKLVRKSTKKS
Ga0208157_102910243300025086MarineMRLEKQKKRKGLSGGVRYGPPPKKGPNPQGIKVSERKKLLRKLAGKA
Ga0208669_108604413300025099MarineEDTIKMRKGLSGGVKSGPPPKRGPNPQGIKLKHAKKLLRKAVRKK
Ga0208159_101072223300025101MarineMRKGLSGGVKSGPPPKKGPNPQGIKLKNAKKLLRKVVRKK
Ga0208159_104282533300025101MarineMRSEEQNKRKGLSGGVRSGPPPKRGPNPQGITVKHAKKVLQKSKRN
Ga0208159_109884433300025101MarineYLRQEKMQSERQNKRRGLSGGVKFGPPPKRGPNPQGIKIVRSKNAKKLVRKSTKKS
Ga0208666_101250553300025102MarineMLQERNLRKNNEKGLSGGVKSGPPPKKGPNPQGIVVKNAKKVLQKSQRKK
Ga0208666_108435913300025102MarineLTRNNEKGLSGGVRSGPPPKRGPNPQGISVKHAKKVLRKSQ
Ga0208158_100900623300025110MarineMRKNNEKGLSGGVKSGPPPKKGPNSQGISVKDAKKVLRKLKRKK
Ga0209535_102400533300025120MarineMRKGLSGGVKSGPPPKKGPNPQGIKLKDAKKLLRKAVRKK
Ga0209348_100185333300025127MarineMQSGRRNVRKGLSGGVKFGPPPKRGPNPQGLQMMRSKDGKKRLRKSIRKK
Ga0209348_101085183300025127MarineMRSEEQNKRKGLSGGVKSGPPPKRGPNPQGITVKHAKKVLRKFKRNK
Ga0209348_1011381103300025127MarineMRQGLSGGKKYGPPPKKGPNPQGIKLKNAKKLLRKSLKKK
Ga0209348_107863133300025127MarineMRSEKQKKRKGLSGGVRYGPPPKKGPNPQGIKVSERKKLLRKL
Ga0209348_117197123300025127MarineMQSERQTKRKGLSGGVKFGPPPKRGPNPQGINMGGSQNAKKLLRKPSKKK
Ga0208919_1000216643300025128MarineDKGLSGGVRSGPPPKKGPNPQGISIKHAKKILRKSKQHK
Ga0208919_103683023300025128MarineMRSEEQSKRKGLSGGVKSGPPPKRGPNPQGITVKDAKRVLRKLKRNK
Ga0208919_116037033300025128MarineGLSGGVKSGPPPKKGPNPQGITVKDAKRVLRKLKRNK
Ga0209336_1012494213300025137MarineRKGLSGGVKSGPPPKKGPNPQGIKLRDAKKLLRKAVRKK
Ga0209645_101267733300025151MarineMNKRKGLSGGVKSGPPPKKGPNPQGITVKDAKRVLRKLKRNK
Ga0209645_104439733300025151MarineMRSEEQKKRKGLSGGVKSGPPPKRGPNPQGITVKNAKKILRKSYKKK
Ga0209645_107560933300025151MarineMRSEEQNKRKGLSGGVKSGPPPKRGPNPQGITLKDAKRVLRKSKRNK
Ga0209645_121932133300025151MarineQYLKQEKMRSEKQKKRKGLSGGVRYGPPPKRGPNPQGLKVSDAKKLLRKSSGKA
Ga0208160_104523913300025647AqueousMRKGLSGGKKYGPPPKKGPNPQGIKLKDAKKLLRK
Ga0208162_101296823300025674AqueousMRKGLSGGVKSGPPPKKGPNPQGITLKNAKKFLRKSFRKK
Ga0208162_112129913300025674AqueousMRKGLSGGVRSGPPPKRGPNPQGIKLKHAKKLLRKSFK
Ga0208019_102297013300025687AqueousTRKNKGKGLSGGVKYGPPPKKGPNPQGIELNRVKKLLRKAIGKK
Ga0208899_114494023300025759AqueousMRKGLSGGKKYGPPPKKGPNPQGIKLKDAKKLLRKSLKKK
Ga0208899_114870013300025759AqueousMRKGLSGGVRSGPPPKRGPNPQGIKLKHAKKLLRKSFKK
Ga0208543_103610123300025810AqueousMRKGLSGGVKSGPPPKKGPNPQGIKLKNAKKLLRKT
Ga0208785_104677943300025815AqueousKRSTRKNKGKGLSGGVKYGPPPKKGPNPQGIELNRVKKLLRKAIGKK
Ga0208785_106796113300025815AqueousMRKGLSGGKKYGPPPKKGPNPQGIKLKDAKKLLRKT
Ga0209425_1005969523300025897Pelagic MarineMTRSNEKGLSGGKRYGPPPKRGPNPQGITIAKAKKLLRKAVKKK
Ga0209951_105084513300026138Pond WaterMRKGLSGGVRSGPPPKRGPNPQGIKIKHAKKLLRKAVRKK
Ga0209929_100991423300026187Pond WaterMRKGLSGGKKYGPPPKKGPNPQGIKLKDAKKLLRKAHKKK
Ga0183683_1000084813300029309MarineMRSEKQKKRKGLSGGVRYGPPPKKGPNPQGIKVSERKKLLRKLAGKV
Ga0183683_100527423300029309MarineMRSEKQNKRKGLSGGVKSGPPPKRGPNPQGITVKNAKKILHKSYKKK
Ga0183826_102175023300029792MarineMQSERRNVRKGLSGGVKFGPPPKKGPNPQGIKIMRSSNGKKRLRKSTRKK
Ga0348335_111379_1_1263300034374AqueousMRKGLSGGVKYGPPPKRGPNPQGIKILNKGSKNKNIYKKRKS
Ga0348336_020819_3_1193300034375AqueousMRKGLSGGKKYGPPPKKGPNPQGIKLKDAKKILRKTLKK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.