NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F056056

Metagenome / Metatranscriptome Family F056056

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F056056
Family Type Metagenome / Metatranscriptome
Number of Sequences 138
Average Sequence Length 99 residues
Representative Sequence IELVDDKILNNEEFKKNVAIPYFKDIFKDLVSQSDDKNKGINKITLLTYTNLPGIIGERFFAVLDLSKNDYIDLREFVHGFFKVYYSNLETKIKLSFDV
Number of Associated Samples 117
Number of Associated Scaffolds 138

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 25.36 %
% of genes near scaffold ends (potentially truncated) 37.68 %
% of genes from short scaffolds (< 2000 bps) 63.77 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (98.551 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(10.145 % of family members)
Environment Ontology (ENVO) Unclassified
(26.812 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(59.420 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.39%    β-sheet: 4.72%    Coil/Unstructured: 44.88%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 138 Family Scaffolds
PF00169PH 21.01
PF00069Pkinase 19.57
PF13405EF-hand_6 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 138 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 78.26


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000128|SA_S1_NOR08_45mDRAFT_c10034784All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2009Open in IMG/M
3300000130|SA_S2_NOR15_50mDRAFT_c10022182All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2881Open in IMG/M
3300000736|JGI12547J11936_1008476All Organisms → cellular organisms → Eukaryota2723Open in IMG/M
3300001263|BBAY83_14690349All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1415Open in IMG/M
3300002835|B570J40625_100212836All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2073Open in IMG/M
3300003216|JGI26079J46598_1010042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2868Open in IMG/M
3300003409|JGI26088J50261_1060242All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum669Open in IMG/M
3300003860|Ga0031658_1017756All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1198Open in IMG/M
3300003909|JGI26087J52781_1002411All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2653Open in IMG/M
3300004687|Ga0065174_1005880All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2204Open in IMG/M
3300004692|Ga0065171_1004184All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2281Open in IMG/M
3300004796|Ga0007763_11585798All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum724Open in IMG/M
3300005043|Ga0071100_1023750All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1621Open in IMG/M
3300005043|Ga0071100_1100935All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum659Open in IMG/M
3300005043|Ga0071100_1150734All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum518Open in IMG/M
3300005941|Ga0070743_10045586All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1498Open in IMG/M
3300005941|Ga0070743_10159095All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum749Open in IMG/M
3300005942|Ga0070742_10009630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2518Open in IMG/M
3300006037|Ga0075465_10062311All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum799Open in IMG/M
3300006117|Ga0007818_1006519All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2564Open in IMG/M
3300006118|Ga0007859_1075781All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum682Open in IMG/M
3300006125|Ga0007825_1099539All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum582Open in IMG/M
3300006165|Ga0075443_10141349All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum845Open in IMG/M
3300006641|Ga0075471_10039601All Organisms → Viruses → Predicted Viral2669Open in IMG/M
3300006641|Ga0075471_10203311All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1031Open in IMG/M
3300006803|Ga0075467_10050436All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2595Open in IMG/M
3300006803|Ga0075467_10051542All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2561Open in IMG/M
3300006875|Ga0075473_10179518All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum854Open in IMG/M
3300007513|Ga0105019_1031937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum3399Open in IMG/M
3300007513|Ga0105019_1038579All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2989Open in IMG/M
3300007513|Ga0105019_1072914All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1954Open in IMG/M
3300007543|Ga0102853_1092844All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum562Open in IMG/M
3300007550|Ga0102880_1036290All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1335Open in IMG/M
3300007551|Ga0102881_1008778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2868Open in IMG/M
3300007623|Ga0102948_1072908All Organisms → Viruses → Predicted Viral1071Open in IMG/M
3300007632|Ga0102894_1008718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2446Open in IMG/M
3300007954|Ga0105739_1125892All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum598Open in IMG/M
3300008263|Ga0114349_1038883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2348Open in IMG/M
3300008952|Ga0115651_1059491All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida3027Open in IMG/M
3300009002|Ga0102810_1014548All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2692Open in IMG/M
3300009059|Ga0102830_1199788All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum585Open in IMG/M
3300009071|Ga0115566_10059005All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2573Open in IMG/M
3300009077|Ga0115552_1046460All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1998Open in IMG/M
3300009079|Ga0102814_10773460All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum530Open in IMG/M
3300009172|Ga0114995_10030102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum3185Open in IMG/M
3300009172|Ga0114995_10034079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2969Open in IMG/M
3300009182|Ga0114959_10294026All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum813Open in IMG/M
3300009182|Ga0114959_10481152All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum601Open in IMG/M
3300009184|Ga0114976_10359836All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum768Open in IMG/M
3300009432|Ga0115005_10922358All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum705Open in IMG/M
3300009436|Ga0115008_10688854All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum741Open in IMG/M
3300009436|Ga0115008_10734938All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum719Open in IMG/M
3300009436|Ga0115008_10862810All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum667Open in IMG/M
3300009436|Ga0115008_11034287All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum615Open in IMG/M
3300009441|Ga0115007_10070006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2208Open in IMG/M
3300009442|Ga0115563_1216088All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum729Open in IMG/M
3300009445|Ga0115553_1283518All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum642Open in IMG/M
3300009466|Ga0126448_1009667All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2433Open in IMG/M
3300009470|Ga0126447_1009152All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2535Open in IMG/M
3300009505|Ga0115564_10171622All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1149Open in IMG/M
3300009538|Ga0129287_10025952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2553Open in IMG/M
3300009684|Ga0114958_10335954All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum736Open in IMG/M
3300009785|Ga0115001_10716977All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum606Open in IMG/M
3300010883|Ga0133547_10953429All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1666Open in IMG/M
3300010885|Ga0133913_11644788All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1617Open in IMG/M
3300012036|Ga0136600_1010628All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2652Open in IMG/M
3300012953|Ga0163179_12137760All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum517Open in IMG/M
3300012966|Ga0129341_1327991All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida629Open in IMG/M
3300013004|Ga0164293_10226442All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1334Open in IMG/M
3300016742|Ga0182052_1224832All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1228Open in IMG/M
3300016771|Ga0182082_1573930All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea675Open in IMG/M
3300017697|Ga0180120_10194116All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum843Open in IMG/M
3300017724|Ga0181388_1166002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum523Open in IMG/M
3300017769|Ga0187221_1246278All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum507Open in IMG/M
3300017788|Ga0169931_10108559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2634Open in IMG/M
3300017818|Ga0181565_10671098All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum660Open in IMG/M
3300017950|Ga0181607_10142690All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1461Open in IMG/M
3300017952|Ga0181583_10088635All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2132Open in IMG/M
3300017952|Ga0181583_10177943All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1406Open in IMG/M
3300017957|Ga0181571_10755637All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum578Open in IMG/M
3300017962|Ga0181581_10390252All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum877Open in IMG/M
3300018420|Ga0181563_10097232All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1934Open in IMG/M
3300020048|Ga0207193_1116473All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2364Open in IMG/M
3300020083|Ga0194111_10446461All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum844Open in IMG/M
3300020159|Ga0211734_11084450All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum594Open in IMG/M
3300020179|Ga0194134_10125139All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1209Open in IMG/M
3300020221|Ga0194127_10692213All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum639Open in IMG/M
3300020221|Ga0194127_10949020All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum519Open in IMG/M
3300020535|Ga0208228_1041049All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum720Open in IMG/M
3300021133|Ga0214175_1039106All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum573Open in IMG/M
3300021336|Ga0210307_1050459All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2832Open in IMG/M
3300021336|Ga0210307_1064985All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2629Open in IMG/M
3300021376|Ga0194130_10493583All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum628Open in IMG/M
3300021961|Ga0222714_10508468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum617Open in IMG/M
3300021962|Ga0222713_10063209All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2770Open in IMG/M
3300021962|Ga0222713_10071171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2570Open in IMG/M
3300021963|Ga0222712_10704926All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum568Open in IMG/M
3300021964|Ga0222719_10638219All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum613Open in IMG/M
3300023179|Ga0214923_10594791All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
(restricted) 3300023276|Ga0233410_10071471All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1054Open in IMG/M
3300024239|Ga0247724_1025878All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum852Open in IMG/M
3300024343|Ga0244777_10246229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1138Open in IMG/M
3300024343|Ga0244777_10745700All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum582Open in IMG/M
3300024346|Ga0244775_10080351All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2785Open in IMG/M
3300025357|Ga0208383_1003460All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2232Open in IMG/M
3300025385|Ga0207956_1003795All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2817Open in IMG/M
3300025389|Ga0208257_1010521All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1549Open in IMG/M
3300025449|Ga0208106_1006409All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2562Open in IMG/M
3300025451|Ga0208426_1065786All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea558Open in IMG/M
3300025570|Ga0208660_1065881All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum860Open in IMG/M
3300025701|Ga0209771_1137947All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum765Open in IMG/M
3300025732|Ga0208784_1106917All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum837Open in IMG/M
3300025849|Ga0209603_1200922All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum762Open in IMG/M
3300025872|Ga0208783_10033337All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2436Open in IMG/M
3300025887|Ga0208544_10034561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2561Open in IMG/M
3300025887|Ga0208544_10161055All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum955Open in IMG/M
3300025896|Ga0208916_10185350All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum899Open in IMG/M
3300025897|Ga0209425_10384936All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum676Open in IMG/M
3300027159|Ga0208020_1004529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2714Open in IMG/M
3300027687|Ga0209710_1097132All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1173Open in IMG/M
3300027720|Ga0209617_10365664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum531Open in IMG/M
3300027780|Ga0209502_10051109All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2274Open in IMG/M
3300027833|Ga0209092_10510512All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum613Open in IMG/M
3300027896|Ga0209777_10998837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum572Open in IMG/M
3300027899|Ga0209668_10029035All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2816Open in IMG/M
3300027899|Ga0209668_10032594All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2686Open in IMG/M
(restricted) 3300027997|Ga0255057_10232160All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum895Open in IMG/M
3300028412|Ga0306910_1006106All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2634Open in IMG/M
3300028595|Ga0272440_1028108All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2596Open in IMG/M
3300031569|Ga0307489_10039559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida2593Open in IMG/M
3300031569|Ga0307489_10510723All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum818Open in IMG/M
3300031569|Ga0307489_10520212All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum812Open in IMG/M
3300031638|Ga0302125_10013739All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2969Open in IMG/M
3300032050|Ga0315906_11220224All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum543Open in IMG/M
3300032734|Ga0314706_10011201All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2465Open in IMG/M
3300034096|Ga0335025_0559284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum569Open in IMG/M
3300034120|Ga0335056_0418912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum718Open in IMG/M
3300034355|Ga0335039_0658648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum508Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine10.14%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous10.14%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine8.70%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater6.52%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh6.52%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater4.35%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine4.35%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.62%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.62%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water3.62%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment2.90%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine2.90%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine2.90%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine2.90%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater2.17%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine2.17%
Marine Subseafloor AquiferEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine Subseafloor Aquifer2.17%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment1.45%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine1.45%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.45%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake1.45%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond1.45%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.72%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.72%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment0.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.72%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.72%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.72%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.72%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.72%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.72%
Marine SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment0.72%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.72%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.72%
SeawaterEnvironmental → Aquatic → Marine → Gulf → Unclassified → Seawater0.72%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.72%
Beach Aquifer PorewaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater0.72%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.72%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.72%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000128Marine microbial communities from chronically polluted sediments in Adventfjord, Norway : sample - Svalbard Archipelago station 1 sample NOR 08_45mEnvironmentalOpen in IMG/M
3300000130Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 15_50mEnvironmentalOpen in IMG/M
3300000736Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011EnvironmentalOpen in IMG/M
3300001263Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY83Host-AssociatedOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003216Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNAEnvironmentalOpen in IMG/M
3300003409Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNAEnvironmentalOpen in IMG/M
3300003860Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PLEnvironmentalOpen in IMG/M
3300003909Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_133SG_5_DNAEnvironmentalOpen in IMG/M
3300004687Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul08 (version 2)EnvironmentalOpen in IMG/M
3300004692Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (version 2)EnvironmentalOpen in IMG/M
3300004796Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005043Mid-Atlantic Ridge North Pond Expedition - Sample 1382AEnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300006037Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNAEnvironmentalOpen in IMG/M
3300006117Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE08Jun09EnvironmentalOpen in IMG/M
3300006118Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07EnvironmentalOpen in IMG/M
3300006125Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE13Jul09EnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007543Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3EnvironmentalOpen in IMG/M
3300007550Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3EnvironmentalOpen in IMG/M
3300007551Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3EnvironmentalOpen in IMG/M
3300007623Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MGEnvironmentalOpen in IMG/M
3300007632Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3EnvironmentalOpen in IMG/M
3300007954Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_0.2umEnvironmentalOpen in IMG/M
3300008263Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTREnvironmentalOpen in IMG/M
3300008952Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7umEnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009059Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009182Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaGEnvironmentalOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009445Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331EnvironmentalOpen in IMG/M
3300009466Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009470Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009505Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523EnvironmentalOpen in IMG/M
3300009538Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - H-2WEnvironmentalOpen in IMG/M
3300009684Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaGEnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012036Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #698EnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012966Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300016742Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011511BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016771Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017952Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017957Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017962Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020083Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300mEnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020179Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0mEnvironmentalOpen in IMG/M
3300020221Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100mEnvironmentalOpen in IMG/M
3300020535Freshwater microbial communities from Lake Mendota, WI - 25JUL2011 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021133Freshwater microbial communities from Trout Bog Lake, WI - 09AUG2007 epilimnionEnvironmentalOpen in IMG/M
3300021336Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021376Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surfaceEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300023179Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510EnvironmentalOpen in IMG/M
3300023276 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MGEnvironmentalOpen in IMG/M
3300024239Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-EEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025357Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 (SPAdes)EnvironmentalOpen in IMG/M
3300025385Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul07 (SPAdes)EnvironmentalOpen in IMG/M
3300025389Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 (SPAdes)EnvironmentalOpen in IMG/M
3300025449Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul08 (SPAdes)EnvironmentalOpen in IMG/M
3300025451Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025570Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025701Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025849Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes)EnvironmentalOpen in IMG/M
3300025872Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300027159Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 (SPAdes)EnvironmentalOpen in IMG/M
3300027687Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027780Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027896Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027997 (restricted)Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_6EnvironmentalOpen in IMG/M
3300028412Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #698 (v2)EnvironmentalOpen in IMG/M
3300028595Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-MMB-Aug17EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031638Marine microbial communities from Western Arctic Ocean, Canada - CB4_surfaceEnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032734Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300034096Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098EnvironmentalOpen in IMG/M
3300034120Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172EnvironmentalOpen in IMG/M
3300034355Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
SA_S1_NOR08_45mDRAFT_1003478463300000128MarineMEATNNGDRIELIDDKILNNEEFKKNVAIPYFKDIFKDLVSQSDDKNKGINKITLLTYTSLPGIIGERFFAVLDLSKNEYIDLREFVHGFFKVYYSNLETKIKLSFDM*
SA_S2_NOR15_50mDRAFT_1002218253300000130MarineMEATSNGDRIELIDDKILNNEEFKKNVAIPYFKDIFKDLVSQSDDKNKGINKITLLTYTSLPGIIGERFFAVLDLSKNEYIDLREFVHGFFKVYYSNLETKIKLSFDM*
JGI12547J11936_100847653300000736Freshwater And SedimentLVAQSDDKNKGVNKITLLTYTNLPGIIGERFFAVLDLSKNDYVDLREFVHGFFKVYYSNLETKIKLSFDV*
BBAY83_1469034913300001263Macroalgal SurfaceMQTLSAEDKIELVDDAILKNEEFKKNVAIPYFKDIYKDLVNQSDDKNKGINRITMLTYCNLPGIIGERFVSVLDLSKTEYIDLREFVHGFFKIYYSTLETKIKLSFDM*
B570J40625_10021283643300002835FreshwaterVIPYFKDIFKDLVAQSDDKNKGVNKITLLTYTNLPGIIGERFFAVLDLSKNDYVDLREFVHGFFKVYYSNLETKIKLSFDVYVPFIFASIFLLQL*
JGI26079J46598_101004233300003216MarineMDATNNGDRIELVDDKILNNEEFKKNVAIPYFKDIFKDLVSQSDDKNKGINKITLLTYTSLPGIIGERFFAVLDLSKNEYIDLREFVHGFFKVYYSNLETKIKLSFDM*
JGI26088J50261_106024213300003409MarineLVDDKILNNEEFKKNVAIPYFKDIFKDLVSQSDDKNKGINKITLLTYTSLPGIIGERFFAVLDLSKNEYIDLREFVHGFFKVYYSNLETKIKLSFDM*
Ga0031658_101775643300003860Freshwater Lake SedimentQNEEFKKNVVIPYFKDIFKDLVAQSDDKNKGVNKITLLTYTNLPGIIGERFFAVLDLSKNEYVDLREFVHGFFKVYYSNLETKIKLSFDVYVPF*
JGI26087J52781_100241113300003909MarineTTYCIMDATNNGDRIELVDDKILNNEEFKKNVAIPYFKDIFKDLVSQSDDKNKGINKITLLTYTSLPGIIGERFFAVLDLSKNEYIDLREFVHGFFKVYYSNLETKIKLSFDM*
Ga0065174_100588013300004687FreshwaterEKKKMEGATQNGDRIELVDEAILQNEEFKKNVVIPYFKDIFKDLVAQSDDKNKGINKITLLTYTNLPGIIGERFFAVLDLSKNDYVDLREFVHGFFKVYYSNLETKIKLSFDV*
Ga0065171_100418453300004692FreshwaterMEGATQNGDRIELVDEAILQNEEFKKNVVIPYFKDIFKDLVAQSDDKNKGINKITLLTYTNLPGIIGERFFAVLDLSKNDYVDLREFVHGFFKVYYSNLETKIKLSFDV*
Ga0007763_1158579813300004796Freshwater LakeSNLILLKNS*KCKAIQNCDRLELVDESILNNEDFKKNVVIAYFKDIFKDLVAQSDNKAKGVHKNTFLTYTNLPGVIGDRFFAVCDLNKTDYIELREFIHGFFKVYYSNLETKMKLSFDIYDFDRDGLIS*
Ga0071100_102375013300005043Marine Subseafloor AquiferNMLFGIALDELEDNEEFKKNVAIPYFKDIYKDLVAQSDDKNKGINKITMLTYSNLPGIIGERFVSVLDLSKTEYIDLREFVHGFFKVYYSNLETKIKLSFDM*
Ga0071100_110093513300005043Marine Subseafloor AquiferLIDDKILNNEEFKKNVAIPYFKDIYKDLVAQSDDKNKGINKITLLTYTNLPGIIGERFFAVLDLSKNEYIDLREFVHGFFKVYYSNLEAKIKLSFDV*
Ga0071100_115073423300005043Marine Subseafloor AquiferLVDDKILNNEEFKKNVAIPYFKDIYKDLVAQSDDKNKGINKITLLTYTNLPGIIGERFFAVLDLSKNEYIDLREFVHGFFKVYYSNLEAKIKLSFDV*
Ga0070743_1004558613300005941EstuarineVAIPYFKDIYKDLVAQSDDKNKGINKVTMLTYTNLPGIIGERFVSVLDLSKTDYIDLREFVHGFFKVYYSNLETKIKLSFDM*
Ga0070743_1015909533300005941EstuarineTYCIMDATNNGDRIELVDDKILNNEEFKKNVAIPYFKDIFKDLVSQSDDKSKGINKITLLTYTSLPGIIGERFFAVLDLSKNEYIDLREFVHGFFKVYYSNLETKIKLSFDM*
Ga0070742_1000963043300005942EstuarineFKDLVSQSDDKSKGINKITLLTYTSLPGIIGERFFAVLDLSKNEYIDLREFVHGFFKVYYSNLETKIKLSFDM*
Ga0075465_1006231113300006037AqueousMVDAKKGQGLNDLSGKIELGDDAITLNEEFKKNVAIPYFKDIYRDLVAQSDSKSKGINRNTFLGYTSLPGIIGERFFNVIDLNTSGYIDLKEFVHGLFKVY*
Ga0007818_100651943300006117FreshwaterVVIPYFKDIFKDLVAQSDDKNKGINKITLLTYTNLPGIIGERFFAVLDLSKNDYVDLREFVHGFFKVYYSNLETKIKLSFDV*
Ga0007859_107578113300006118FreshwaterEEKKKMEGATQNGDRIELVDEAILQNEEFKKNVVIPYFKDIFKDLVAQSDDKNKGINKITLLTYTNLPGIIGERFFAVLDLSKNDYVDLREFVHGFFKVYYSNLETKIKLSFDV*
Ga0007825_109953913300006125FreshwaterILQNEEFKKNVVIPYFKDIFKDLVAQSDDKNKGINKITLLTYTNLPGIIGERFFAVLDLSKNDYVDLREFVHGFFKVYYSNLETKIKLSFDV*
Ga0075443_1014134933300006165MarineNVAIPYFKDIFKDLVAQSDDKSKGINKITLLTYTNLPGIIGERFFAVLDLSKNEYIDLREFVHGFFKVYYSNLETKIKLSFDM*
Ga0075471_1003960113300006641AqueousVETLELVDDAILKNEEFKKNVAIPYFKDIYKDLVAQSDNKEKGINKITMLNYCNLPGLIGERFVSVIDLSKTDYIDLREFVHGFFKVYYSNLETKIKLTFDLLVDYFPLLTFL*
Ga0075471_1020331113300006641AqueousMEANQVADRLELVDDAILKNEEFKKNVAIPYFKDIYKDLVAQSDDKSKGINKITMLNYCNLPGLIGERFVNVIDLSKTEYIDLREFVHGFFKVYYSNLETKIKLTFDM*
Ga0075467_1005043613300006803AqueousMATNSDRIELVDDAILNNEEFKKNVAIPYFKDIYKDLVGQSDDKNKGINKITMLTYSNLPGIIGERFVSVLDLSKNDYIDLREFVHGLFKVYYSNLETKIKLSFDM*
Ga0075467_1005154253300006803AqueousVAVPYFKDIYKDLVSQSDDKNKGINKITMLTYTNLPGIIGERFVTVLDLSKTGFIDLREFVHGFFKIYYSNLETKIKLSFDV*
Ga0075473_1017951823300006875AqueousFIQNKLRMEQPQQVETLELVDDAILKNEEFKKNVAIPYFKDIYKDLVAQSDNKEKGINKITMLNYCNLPGLIGERFVSVIDLSKTDYIDLREFVHGFFKVYYSNLETKIKLTFDLLVDYFPLLTFL*
Ga0105019_103193743300007513MarineMEGTTQAGDRIELVDDKILNNEEFKKNVAIPYFKDIFKDLVAQSEDKNKGINRVTLLTYTNLPGIIGERFFAVLDLSKNDYIDLREFVHGFFKVYYSNLETKIKLSFDM*
Ga0105019_103857953300007513MarineVAIPYFKDIYKDLVAQSDDKAKGINKVTILTYANLPGIIGERFFSLLDLSKTDYIDLREFVHGFFKVYYSNLETKIKLSFDM*
Ga0105019_107291413300007513MarineMTDASDRIELVDESILNNEEFKKNVAIPYFKDIYKDLVSQSDDKNKGINKITMLNYSNLPGIIGERFVALLDLSKSDYIDLREFVHGFFKVYYSNLETKIKLSFDM*
Ga0102853_109284413300007543EstuarineMQATQNNLTDKIELVDDAILKNEEFKKNVAVPYFKDIYKDLVSQSDDKNKGINKITMLTYSNLPGIIGERFFTVLDLSKTEFIDLREFVHGFFMVYYSNLETKIKLSFDM*
Ga0102880_103629013300007550EstuarineEFKKNVAIPYFKDIFKDLVSQSDDKSKGINKITLLTYTSLPGIIGERFFAVLDLSKNEYIDLREFVHGFFKVYYSNLETKIKLSFDM*
Ga0102881_100877843300007551EstuarineMDATNNGDRIELVDDKILNNEEFKKNVAIPYFKDIFKDLVSQSDDKSKGINKITLLTYTSLPGIIGERFFAVLDLSKNEYIDLREFVHGFFKVYYSNLETKIKLSFDM*
Ga0102948_107290823300007623WaterMQALGPADKIELVDDAILKNEEFKKNVAIPYFKDIYKDLVNQSDDKTKGINRITMLTYCNLPGIIGERFVNVLDLSKTDYIDLREFVHGFFKIYYSTLETKIKLSFDM*
Ga0102894_100871863300007632EstuarineVAIPYFKDIYKDLVAQSDDKNKGINKVTMLTYTNLPGIIGERFVSVLDLSKTDYIDLREFVHGFFKVYYSNLETKIKLSFEM*
Ga0105739_112589213300007954Estuary WaterMQATQNNLTDKIELVDDAILKNEEFKKNVAVPYFKDIYKDLVSQSDDKNKGINKITMLTYSNLPGIIGERFFTVLDLSKTEFIDLREFVHGFFKVYYSNLETKIKLSFDM*
Ga0114349_103888383300008263Freshwater, PlanktonEEFKKNVVIPYFKDIFKDLVAQSDDKNKGVNKITLLTYTNLPGIIGERFFAVLDLSKNDYVDLREFVHGFFKVYYSNLETKIKLSFDVYVPFIFASIFLLQL*
Ga0115651_105949143300008952MarineMEGAVMDGDRIELVDEKILNNEEFKKNVAIPYFKDIFKDLVGQSDDKAKGINKISMLTYTNLPGIIGERFFAVMDLSKNEFIDLREFVHGIFKVYYSNLETKIKLTFDM*
Ga0102810_101454843300009002EstuarineLVSQSDDKSKGINKITMLTYSNLPGIIGERFVAVLDLSKTDYIDLREFVHGFFKVYYSNLETKIKLSFDM*
Ga0102830_119978813300009059EstuarineVAMPYFKDIYKDLVAQSDDKNKGINKVTMLTYTNLPGIIGERFVSVLDLSKTDYIDLREFVHGFFKVYYSNLETKIKLSFDM*
Ga0115566_1005900513300009071Pelagic MarineQADVIELVDDAILNNEEFKKNVAIPYFKDIYKDLVAQSDDKSKGINKITMLSYTNLPGIIGERFVTVLDLSKSDYIDLREFVHGFFKVYYSNLETKIKLSFDM*
Ga0115552_104646043300009077Pelagic MarineMDGQAPTDKIELVDDKILNNEEFKKNVAIPYFKDIFKDLAAQSDDKSKGINKVTLLTYCALPGIIGERFFAVMDLSKSEYIDLREFVHGFFKIYYSNLETKIKLSFDM*
Ga0102814_1077346013300009079EstuarineMERIELVDDAILKNEEFKKNVAIPYFKDIYKDLVAQSDNKTKGINKITMLTYSNLPGIIGERFVAVLDLSKTDYIDLREFVHGFFKVYYSNLETKIKLSFDM*
Ga0114995_1003010213300009172MarineMAMINNDKIELVDDKIVNNEEFKKNVAIPYFKDIYKDLVAQSDDKTKGINRITLLTYTKLPGIIGERFFSVLDLSKTDYIDLREFVHGFFKVYYSNLETKIKLSFDM*
Ga0114995_1003407923300009172MarineMSFSILIGLLWDNCNLIFIIKKRMEGSTQNGDRIELVDDKILNNEEFKKNVAIPYFKDIFKDLVAQSDDKNKGINKVTLLTYTNLPGIIGERFFAVLDLSKTDYIDLREFVHGFFKVYYSNLETKIKLSFDV*
Ga0114959_1029402613300009182Freshwater LakeLVAQSDDKNKGVNKITLLTYTNLPGIIGERFFAVLALSKNDYVDLREFVHGFFKVYYSNLETKIKLSFDVYVMFFSFFLPS*
Ga0114959_1048115213300009182Freshwater LakeVAIPYFKDIFKDLVGQSDEKAKGVNKVTFLSYTNLPGIIGERFFAVLDLSKNDYIDLREFVHGFFKVYYSNLETKIKLTFDM*
Ga0114976_1035983613300009184Freshwater LakeMEGATQNGDRIELVDEAILQNEEFKKNVVIPYFKDIFKDLVAQSDDKNKGINKITLLTYTNLPGIIGERFFAVLDLSENDYVDLREFVHGFFKVYYSNLETKIKLSFDV*
Ga0115005_1092235813300009432MarineLNNEEFKKNVAIPYFKDIFKDLVAQSDDKSKGINKVTLLTYTNLPGIIGERFFAVLDLSKNEYIDLREFVHGFFKVYYSNLETKIKLSFDV*
Ga0115008_1068885423300009436MarineMDGQAPTDKIELVDDKILNNEEFKKNVAIPYFKDIFKDLAAQSDDKSKGINKVTLLTYCALPGIIGERFFAVMDLSKSEYIDLREFVHGFFK
Ga0115008_1073493813300009436MarinePVMTSQPAAAESTTQGGESLQDLTGKIELIDDNIILNEEFKKNVAIPYFRDIFKDLVAHSDNKQKGINKVTLLTYTNLPGIIGERFFAVMDLSKSEYVDIREFVHGFFKIYYSNLETKIKLSFDM*
Ga0115008_1086281013300009436MarineMGWVKWQPGELPQDERIEFIDDKILNNEEFKKNVAIPYFKDIYKDLVAQSDDKQKGINKVTILTYANLPGIIGERFFALLDLSKTDFIDLREFVHGFFKVYYS
Ga0115008_1103428713300009436MarineVAIPYFKDIYKDLVAQSDDKQKGINKVTILTYANLPGIIGERFFALLDLSKTDFIDLREFVHGFFKVYYSNLETKIKLSFDL*
Ga0115007_1007000653300009441MarineMDQGNDKIELVDEAILHNEDFKKNVAIPYFKDIFKDLVAQSDDKAKGINKVTFLTYTNLPGMIGDRFFAVLDLSKTEYIDLREFVHGFFKVYYSNLDTKMKMTFDV*
Ga0115563_121608813300009442Pelagic MarineMESDRIELVDDKILNNEEFKKNVAIPYFKDIFKDLVAQSDDKSKGINKITLLTYTNLPGIIGERFFAVLDLSKNEYIDLREFVHGFFKVYYSNLETKIKLSFDM*
Ga0115553_128351813300009445Pelagic MarineMEGSTQNGDRIELVDDKILNNEEFKKNVAIPYFKDIFKDLVAQSDDKNKGINKVTLLTYTNLPGIIGERFFAVLDLSKTDYIDLREFVHGFFKVYYSNLETKIKLSFDV*
Ga0126448_100966763300009466Meromictic PondLVAQSDDKSKGINKVTMLTYTNLPGIIGERFVAVLDLSKTDYIDLREFVHGFFKVYYSNLETKIKLSFDM*
Ga0126447_100915253300009470Meromictic PondDVIELVDDAILNNEEFKKNVAIPYFKDIYKDLVAQSDDKSKGINKVTMLTYTNLPGIIGERFVAVLDLSKTDYIDLREFVHGFFKVYYSNLETKIKLSFDM*
Ga0115564_1017162213300009505Pelagic MarineDLVAQSDDKSKGINKITLLTYTNLPGIIGERFFAVLDLSKNEYIDLREFVHGFFKVYYSNLETKIKLSFDM*
Ga0129287_1002595213300009538Beach Aquifer PorewaterKIELVDDAILKNEEFKKNVAIPYFKDIYKDLVNQSDDKNKGINRITMLTYCNLPGIIGERFVSVLDLSKSDYIDLREFVHGFFKIYYSTLETKIKLSFDM*
Ga0114958_1033595423300009684Freshwater LakeVIPYFKDIFKDLVAQSDDKNKGVNKITLLTYTNLPGIIGERFFAVLDLSKNEYVDLREFVHGFFKVYYSNLETKIKLSFDVYVPFWCHYIFLILIQLSDYCIF*
Ga0115001_1071697723300009785MarineMINNDKIELVDDKIVNNEEFKKNVAIPYFKDIYKDLVAQSDDKTKGINRITLLTYTKLPGIIGERFFSVLDLSKTDYIDLREFVHGFFKVYYSNLETKIKLSFDM*
Ga0133547_1095342933300010883MarineMETAPQNERIELHDDQILHDEDFKKNVAIPYFKDVYKDLVAQSDNKPKGINKITMLTYTNLPGILGERFFAVLDLSKTDYIDLREFVFGFFKVFFSNLETKMKLCFDV*
Ga0133913_1164478813300010885Freshwater LakeMEGTVQNGDRIELVDDKILNNEEFKKNVAIPYFKDIFKDLVAQSDDKNKGVNKVTFLTYTNLPGIIGERFFAVLDLSKNDYIDLREFVHGFFKVYYSNLETKLKLSFDM*
Ga0136600_101062843300012036Saline LakeMQALPEVDKIELVDDAILKNEEFKKNVAIPYFKDIYKDLVNQSDEKNKGINRITMLTYCNLPGIIGERFVAVLDLSKTDYIDLREFVHGFFKIYYSTLETKIKLSFDM*
Ga0163179_1213776013300012953SeawaterQSDDKQKGINKVTILTYAELPGIIGERFFALLDLSKTDYIDLREFVHGFFKVYYSNLETKIKLSFDM*
Ga0129341_132799113300012966AqueousVAIPYFKDIFKDLAAQSDSKSKGINKVSILAYSCLPGIIGERFFGVLDLNNSGYVDLKEFVHGFFKIYYSNTETKLKFAFDM*
Ga0164293_1022644213300013004FreshwaterVIPYFKDIFKDLVAQSDDKNKGINKITLLTYTNLPGIIGERFFAVLDLSKNDYVDLREFVHGFFKVYYSNLETKIKLSFDV*
Ga0182052_122483213300016742Salt MarshIELVDDAILNNEEFKKNVAIPYFKDIYKDLVAQSDDKSKGINKITMLTYTNLPGIIGDRFVSVLDLSKTDYIDLREFVHGFFKVYYSNLETKIKLSFDMSVFLLNLTNL
Ga0182082_157393013300016771Salt MarshQNPKTPNLKVENILLMVDKKAQQETLKLANLTGKIELAEDRLVLSEEFRKNVAIPYFKDIYRDLVTQSDNKNKGVNKITLLQYSRLPGIIGERLFDVLDLKEQGYIDLKEFVHGCFKIYYSTLEVKMKLAFDM
Ga0180120_1019411613300017697Freshwater To Marine Saline GradientMETAPQNERIELHDDQILHDEDFKKNVAIPYFKDVYKDLVAQSDNKPKGINKITMLTYTNLPGILGERFFAVLDLSKTDYIDLREFVFGFFKVFYSNLETKMKLCFDV
Ga0181388_116600213300017724SeawaterMDAKQAGNNKIELIDDRILNNEEFKTNVAIPYFKDIFKDLAAQSDDKSKGINKVTLLTYTNLPGIIGERFFSVLDLSKTDYIDLREFVHGFFKIYYSNLETKIKLSFD
Ga0187221_124627813300017769SeawaterMDAKQAGNDKIELIDDRILNNEEFKKNVAIPYFKDIFKDLAAQSDDKSKGINKVTLLTYTNLPGIIGERFFSVLDLSKTDYIDLREFVHGFFKIYYSNL
Ga0169931_1010855963300017788FreshwaterLVDDKILNNEEFKKNVAIPYFKDIFKDLVAQSDDKNKGVNKVTFLTYTNLPGIIGERFFAVLDLSKNDYIDLREFVHGFFKVYYSNLETKLKLSFEM
Ga0181565_1067109823300017818Salt MarshMDATNNGDRIELVDDKILNNEEFKKNVAIPYFKDIFKDLVSQSDDKNKGINKITLLTYTSLPGIIGERFFAVLDLSKNEYIDLRAFVHGFFKVYYSNLETKIKLSFDM
Ga0181607_1014269013300017950Salt MarshVDDAILNNEEFKKNVAIPYFKDIYKDLVAQSDDKSKGINKITMLTYTNLPGIIGDRFVSVLDLSKTDYIDLREFVHGFFKVYYSNLETKIKLSFDM
Ga0181583_1008863543300017952Salt MarshFKDLVAQSDDKNKGINKITLLTYTNLPGIIGERFFAVLDLSKNEYIDLREFVHGFFKVYYSNLETKIKLSFDM
Ga0181583_1017794333300017952Salt MarshVDEKILNNEEFKKNVAIPYFKDIYKDLVAQSDDKNKGINKITLLTYSNLPGIIGERFFAVLDLSKNEYVDLREFVHGFFKVYYSNVDTKIKLSFDL
Ga0181571_1075563723300017957Salt MarshMDATNNGDRIELVDDKILNNEEFKKNVAIPYFKDIFKDLVSQSDDKNKGINKITLLTYTSLPGIIGERFFAVLDLSKNEYIDLREFVHGFFKVYYSNLETKIKLSFDM
Ga0181581_1039025213300017962Salt MarshMEATANGDRIELVDEKILNNEEFKKNVAIPYFKDIFKDLVAQSDDKNKGINKITLLTYTNLPGIIGERFFAVLDLSKNEYIDLREFVHGFFKVYYSNLETKIKLSFDM
Ga0181563_1009723243300018420Salt MarshMDATNNGDRIELIDDKILNNEEFKKNVAIPYFKDIFKDLVSQSDDKNKGINKITLLTYTSLPGIIGERFFAVLDLSKNEYIDLREFVHGFFKVYYSNLETKIKLSFDM
Ga0207193_111647313300020048Freshwater Lake SedimentELVDEAILQNEEFKKNVVIPYFKDIFKDLVAQSDDKNKGVNKITLLTYTNLPGIIGERFFAVLDLSKNEYVDLREFVHGFFKVYYSNLETKIKLSFDVYVPF
Ga0194111_1044646113300020083Freshwater LakeLIDDKILNNEEFKKNVAIPYFKDIFKDLVAQSDDKNKGVNKVTFLTYTNLPGIIGERFFAVLDLSKNDYIDLREFVHGFFKVYYSNLETKLKLSFDM
Ga0211734_1108445013300020159FreshwaterVIPYFKDIFKDLVAQSDDKNKGVNKITLLTYTNLPGIIGERFFAVLDLSKNDYVDLREFVHGFFKVYYSNLETKIKLSFDVYVPFIFASIFLLHL
Ga0194134_1012513923300020179Freshwater LakeVAIPYFKDIFKDLVAQSDDKNKGVNKVTFLIYANLPGIIGERFFAVLDLSKNDYIDLREFVHGFFKVYYSNLETKLKLSFDM
Ga0194127_1069221313300020221Freshwater LakeYFKDIFKDLVAQSDDKNKGVNKVTFLIYANLPGIIGERFFAVLDLSKNDYIDLREFVHGFFKVYYSNLETKLKLSFDM
Ga0194127_1094902013300020221Freshwater LakeILNNEEFKKNVAIPYFKDIFKDLVAQSDDKNKGVNKVTFLTYTNLPGIIGERFFAVLDLSKNDYIDLREFVHGFFKVYYSNLETKLKLSFDM
Ga0208228_104104913300020535FreshwaterELVDEAILQNEEFKKNVVIPYFKDIFKDLVAQSDDKNKGVNKITLLTYTNLPGIIGERFFAVLDLSKNDYVDLREFVHGFFKVYYSNLETKIKLSFDVYVPFIFASIFLLRL
Ga0214175_103910613300021133FreshwaterYFKDIFKDLVAQSDDKNKGINKITLLTYTNLPGIIGERFFAVLDLSKNDYVDLREFVHGFFKVYYSNLETKIKLSFDV
Ga0210307_105045913300021336EstuarineMDATNNGDRIELVDDKILNNEEFKKNVAIPYFKDIFKDLVSQSDDKSKGINKITLLTYTSLPGIIGERFFAVLDLSKNEYIDLREFVHGFFKVYYSNLETKIKLSFDM
Ga0210307_106498513300021336EstuarineMVDNSTKSDTLAQANVTGKIELQEDSIILNEEFKKNVAIPYFKDIYRDLVTQSDNKTKGINRVTLLCYSQLPGIIGERLFDVMDLKGQGYIDLKEFVHGFFKVYFSNLDTKLKLCFDM
Ga0194130_1049358313300021376Freshwater LakeNEEFKKNVAIPYFKDIFKDLVAQSDDKNKGVNKVTFLTYTNLPGIIGERFFAVLDLSKNDYIDLREFVHGFFKVYYSNLETKLKLSFDM
Ga0222714_1050846813300021961Estuarine WaterVDDKILNNEEFKKNVAIPYFKDIFKDLVSQSDDKNKGINKITLLTYTNLPGIIGERFFAVLDLSKNDYVDLREFVHGFFKVYYSNLETKIKLSFDV
Ga0222713_1006320913300021962Estuarine WaterMNTDKLEFVDDAILKNEEFKKNVAIPYFKDIYKDLVAQSDDKSKGINRITMLTYCNLPGIIGERFVSILDLSKTEYIDLREFVHGFFKVYYSNLETKIKLSFDM
Ga0222713_1007117163300021962Estuarine WaterMQPATDRIELVDDAILNNEEFKKNVAIPYFKDIYKDLVSQSDDKNKGINKVTMLTYSNLPGIIGERFVSVLDLSKSDYIDLREFVHGFFKVYYSNLETKIKLSFDM
Ga0222712_1070492623300021963Estuarine WaterVVIPYFKDIFKDLVAQSDDKNKGINKITLLTYTNLPGIIGERFFAVLDLSKNDYVDLREFVHGFFKVYYSNLETKIKLSFDV
Ga0222719_1063821913300021964Estuarine WaterVAIPYFKDIYKDLVAQSDDKSKGINKITMLTYTNLPGIIGERFVSVLDLSKTDYIDLREFVHGFFKVYYSNLETKIKLSFDM
Ga0214923_1059479113300023179FreshwaterMEGTVQNGDRIELVDDKILNNEEFKKNVAIPYFKDIFKDLVAQSDDKNKGVNKVTFLTYTNLPGIIGERFFAFLDLSKNDYVDLREFVHGFFKVYYSNLETKLKLSFDM
(restricted) Ga0233410_1007147113300023276SeawaterMEGTTQNGDKIELVDDKILNNEEFKKNVAIPYFKDIYKDLVAHSDDKNKGINKVSLMTYCNLPGIIGERFFAVLDLSKSGYVDLREFVHGFFKVYYSNLETKIKLSFDL
Ga0247724_102587823300024239Deep Subsurface SedimentYFKDIYKDLVAQSDDKNKGINKVTMLTYTNLPGIIGERFVNVLDLSKTDYIDLREFVHGFFKVYYSNLETKIKLSFDM
Ga0244777_1024622933300024343EstuarineVAIPYFKDIYKDLVAQSDDKNKGINKVTMLTYTNLPGIIGERFVSVLDLSKTDYIDLREFVHGFFKVYYSNLETKIKLSFDM
Ga0244777_1074570023300024343EstuarineLVSQSDDKSKGINKITMLTYSNLPGIIGERFVAVLDLSKTDYIDLREFVHGFFKVYYSNLETKIKLSFDM
Ga0244775_1008035113300024346EstuarineTYCIMDATNNGDRIELVDDKILNNEEFKKNVAIPYFKDIFKDLVSQSDDKSKGINKITLLTYTSLPGIIGERFFAVLDLSKNEYIDLREFVHGFFKVYYSNLETKIKLSFDM
Ga0208383_100346043300025357FreshwaterNEEFKKNVVIPYFKDIFKDLVAQSDDKNKGINKITLLTYTNLPGIIGERFFAVLDLSKNDYVDLREFVHGFFKVYYSNLETKIKLSFDV
Ga0207956_100379543300025385FreshwaterMEGATQNGDRIELVDEAILQNEEFKKNVVIPYFKDIFKDLVAQSDDKNKGINKITLLTYTNLPGIIGERFFAVLDLSKNDYVDLREFVHGFFKVYYSNLETKIKLSFDV
Ga0208257_101052113300025389FreshwaterNGDRIELVDEAILQNEEFKKNVVIPYFKDIFKDLVAQSDDKNKGINKITLLTYTNLPGIIGERFFAVLDLSKNDYVDLREFVHGFFKVYYSNLETKIKLSFDV
Ga0208106_100640943300025449FreshwaterKKMEGATQNGDRIELVDEAILQNEEFKKNVVIPYFKDIFKDLVAQSDDKNKGINKITLLTYTNLPGIIGERFFAVLDLSKNDYVDLREFVHGFFKVYYSNLETKIKLSFDV
Ga0208426_106578623300025451AqueousMVDAKKGQGLNDLSGKIELGDDAITLNEEFKKNVAIPYFKDIYRDLVAQSDSKSKGINRNTFLGYTSLPGIIGERFFNVIDLNTSGYIDLKEFVHGLFKVY
Ga0208660_106588123300025570AqueousLNNEEFKKNVAIPYFKDIYKDLVGQSDDKNKGINKITMLTYSNLPGIIGERFVSVLDLSKNDYIDLREFVHGLFKVYYSNLETKIKLSFDM
Ga0209771_113794713300025701MarineLVDDKILNNEEFKKNVAIPYFKDIFKDLVAQSDDKNKGINKITFLTYTNLPGIIGERFFAVLDLSKNEYIDLREFVHGFFKVYYSNLETKIKLSFDM
Ga0208784_110691723300025732AqueousMEQPQQVETLELVDDAILKNEEFKKNVAIPYFKDIYKDLVAQSDNKEKGINKITMLNYCNLPGLIGERFVSVIDLSKTDYIDLREFVHGFFKVYYSNLETKIKLTFDLLVDYFPLLTFL
Ga0209603_120092213300025849Pelagic MarineLNNEEFKKNVAIPYFKDIFKDLVAQSDDKSKGINKVTLLTYTNLPGIIGERFFAVLDLSKNEYIDLREFVHGFFKVYYSNLETKIKLSFDV
Ga0208783_1003333713300025872AqueousNKEKGINKITMLNYCNLPGLIGERFVSVIDLSKTDYIDLREFVHGFFKVYYSNLETKIKLTFDLLVDYFPLLTFL
Ga0208544_1003456113300025887AqueousVAVPYFKDIYKDLVSQSDDKNKGINKITMLTYTNLPGIIGERFVTVLDLSKTGFIDLREFVHGFFKIYYSNLETKIKLSFDV
Ga0208544_1016105513300025887AqueousMATNSDRIELVDDAILNNEEFKKNVAIPYFKDIYKDLVGQSDDKNKGINKITMLTYSNLPGIIGERFVSVLDLSKNDYIDLREFVHGLFKVYYSNLETKIKLSFDM
Ga0208916_1018535023300025896AqueousLGDDAITLNEEFKKNVAIPYFKDIYRDLVAQSDSKSKGINRNTFLGYTSLPGIIGERFFNVIDLNTSGYIDLKEFVHGLFKVY
Ga0209425_1038493623300025897Pelagic MarineMEGSTQNGDRIELVDDKILNNEEFKKNVAIPYFKDIFKDLVAQSDDKNKGINKVTLLTYTNLPGIIGERFFAVLDLSKTDYIDLREFVHGFFKVYYSNLETKIKLSFDV
Ga0208020_100452943300027159EstuarineLVSQSDDKSKGINKITMLTYSNLPGIIGERFVAVLDLSKTDYIDLREFVHGFFKVYLQYLETKIKLSFDM
Ga0209710_109713223300027687MarineMAMINNDKIELVDDKIVNNEEFKKNVAIPYFKDIYKDLVAQSDDKTKGINRITLLTYTKLPGIIGERFFSVLDLSKTDYIDLREFVHGFFKVYYSNLETKIKLSFDM
Ga0209617_1036566413300027720Freshwater And SedimentVIPYFKDIFKDLVAQSDDKNKGVNKITLLTYTNLPGIIGERFFAVLDLSKNDYVDLREFVHGFFKVYYSNLETKIKLSFDVYVPFIFASIFLLRL
Ga0209502_1005110953300027780MarineMDGQAPTDKIELVDDKILNNEEFKKNVAIPYFKDIFKDLAAQSDDKSKGINKVTLLTYCALPGIIGERFFAVMDLSKSEYIDLREFVHGFFKIYYSNLETKIKLSFDM
Ga0209092_1051051213300027833MarineMGWVKWQPGELPQDERIEFIDDKILNNEEFKKNVAIPYFKDIYKDLVAQSDDKQKGINKVTILTYANLPGIIGERFFALLDLSKT
Ga0209777_1099883713300027896Freshwater Lake SedimentILQNEEFKKNVVIPYFKDIFKDLVAQSDDKNKGVNKITLLTYTNLPGIIGERFFAVLDLSKNEYVDLREFVHGFFKVYYSNLETKIKLSFDVYVPF
Ga0209668_1002903553300027899Freshwater Lake SedimentVIPYFKDIFKDLVAQSDDKNKGVNKITLLTYTNLPGIIGERFFAVLDLSKNEYVDLREFVHGFFKVYYSNLETKIKLSFDVYVPF
Ga0209668_1003259463300027899Freshwater Lake SedimentMEGTVQNGDRIELVDDKILNNEEFKKNVAIPYFKDIFKDLVAQSDDKNKGVNKVTFLTYTNLPGIIGERFFAVLDLSKNDYVDLREFVHGFFKVYYSNLETKLKLSFDM
(restricted) Ga0255057_1023216023300027997SeawaterMEATSANNGDRIELIDDKILNNEEFKKNVAIPYFKDIFKDLVSQSDDKNKGINKITLLTYTSLPGIIGERFFAVLDLSKNEYIDLREFVHGFFKVYYSNLETKIKLSFDM
Ga0306910_100610613300028412Saline LakeMQALPEVDKIELVDDAILKNEEFKKNVAIPYFKDIYKDLVNQSDEKNKGINRITMLTYCNLPGIIGERFVAVLDLSKTDYIDLREFVHGFFKIYYSTLETKIKLSFDM
Ga0272440_102810853300028595Marine SedimentMEGGNQNGDKIELIDDKILNNEEFKKNVAIPYFKDIYKDLVAQSDDKNKGINKITLLTYTNLPGIIGERFFAVLDLSKNEYIDLREFVHGFFKVYYSNLETKIKLSFDM
Ga0307489_1003955913300031569Sackhole BrineMIKNEDRIEMVDDAILKNEEFKKNVAIPYFKDIYKDLVSQSDEKSKGINKITMLTYSNLPGIIGERFVAVLDLSKTEYIDLREFVHGFFKVYYSNLETKIKLSFDM
Ga0307489_1051072323300031569Sackhole BrineIMEAVSNGDRIELVDDKILNNEEFKKNVAIPYFKDIFKDLVSQSDDKNKGINKITLLTYTNLPGIIGERFFAVLDLSKNDYIDLREFVHGFFKVYYSNLETKIKLSFDV
Ga0307489_1052021213300031569Sackhole BrineIELVDDKILNNEEFKKNVAIPYFKDIFKDLVSQSDDKNKGINKITLLTYTNLPGIIGERFFAVLDLSKNDYIDLREFVHGFFKVYYSNLETKIKLSFDV
Ga0302125_1001373923300031638MarineMSFSILIGLLWDNCNLIFIIKKRMEGSTQNGDRIELVDDKILNNEEFKKNVAIPYFKDIFKDLVAQSDDKNKGINKVTLLTYTNLPGIIGERFFAVLDLSKTDYIDLREFVHGFFKVYYSNLETKIKLSFDV
Ga0315906_1122022413300032050FreshwaterVIPYFKDIFKDLVAQSDDKNKGVNKITLLTYTNLPGIIGERFFAVLDLSKNDYVDLREFVHGFFKVYYSNLETKIKLSFDVYVPFIFASIFLLQLXF
Ga0314706_1001120113300032734SeawaterLNNEEFKKNVAIPYFKDIFKDLVAQSDDKSKGINKVTLLTYTNLPGIIGERFFAVLDLSKNEYIDLREFVHGFFKVYYSNLETKIKLSFDVYDFDRDVTLRKKTSD
Ga0335025_0559284_9_2963300034096FreshwaterVIPYFKDIFKDLVAQSDDKNKGVNKITLLTYTNLPGIIGERFFAVLDLSKNDYVDLREFVHGFFKVYYSNLETKIKLSFDVYVPFIFASIFLLQL
Ga0335056_0418912_383_7183300034120FreshwaterLVDEAILQNEEFKKNVVIPYFKDIFKDLVAQSDDKNKGVNKITLLTYTNLPGIIGERFFAVLDLSKNDYVDLREFVHGFFKVYYSNLETKIKLSFDVYVPFIFASIFLLRL
Ga0335039_0658648_1_2343300034355FreshwaterVIPYFKDIFKDLVAQSDDKNKGVNKITLLTYTNLPGIIGERFFAVLDLSKNDYVDLREFVHGFFKVYYSNLETKIKLS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.