| Basic Information | |
|---|---|
| Family ID | F056036 |
| Family Type | Metagenome |
| Number of Sequences | 138 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MSTLWKDLLVGLVVSVLALAGAYWQAERTAAFERQDGTGETLRLVCPLH |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 18.12 % |
| % of genes near scaffold ends (potentially truncated) | 25.36 % |
| % of genes from short scaffolds (< 2000 bps) | 94.20 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.783 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (23.188 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.609 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.652 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 41.56% β-sheet: 5.19% Coil/Unstructured: 53.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF07690 | MFS_1 | 26.81 |
| PF03458 | Gly_transporter | 11.59 |
| PF08309 | LVIVD | 10.14 |
| PF13581 | HATPase_c_2 | 5.07 |
| PF01638 | HxlR | 2.17 |
| PF00005 | ABC_tran | 1.45 |
| PF07883 | Cupin_2 | 0.72 |
| PF12832 | MFS_1_like | 0.72 |
| PF01547 | SBP_bac_1 | 0.72 |
| PF12695 | Abhydrolase_5 | 0.72 |
| PF12680 | SnoaL_2 | 0.72 |
| PF08031 | BBE | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG2860 | Uncharacterized membrane protein YeiH | Function unknown [S] | 11.59 |
| COG5276 | Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain | Function unknown [S] | 10.14 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 2.17 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.78 % |
| Unclassified | root | N/A | 15.22 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005093|Ga0062594_100231392 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300005327|Ga0070658_10976040 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300005332|Ga0066388_105941409 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300005337|Ga0070682_100481007 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300005339|Ga0070660_101938954 | Not Available | 502 | Open in IMG/M |
| 3300005341|Ga0070691_10080525 | All Organisms → cellular organisms → Bacteria | 1594 | Open in IMG/M |
| 3300005367|Ga0070667_100887431 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 830 | Open in IMG/M |
| 3300005438|Ga0070701_10592297 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300005456|Ga0070678_101014358 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 763 | Open in IMG/M |
| 3300005456|Ga0070678_101944763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 556 | Open in IMG/M |
| 3300005466|Ga0070685_10421391 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300005544|Ga0070686_101301256 | Not Available | 607 | Open in IMG/M |
| 3300005614|Ga0068856_101030366 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300005937|Ga0081455_10889982 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 554 | Open in IMG/M |
| 3300006049|Ga0075417_10157134 | Not Available | 1061 | Open in IMG/M |
| 3300006169|Ga0082029_1739523 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300006169|Ga0082029_1739648 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300006358|Ga0068871_100567324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1029 | Open in IMG/M |
| 3300006755|Ga0079222_10937499 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300006845|Ga0075421_102579778 | Not Available | 528 | Open in IMG/M |
| 3300006846|Ga0075430_100566638 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300006846|Ga0075430_101496501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 555 | Open in IMG/M |
| 3300006904|Ga0075424_100807655 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300006918|Ga0079216_11164985 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 615 | Open in IMG/M |
| 3300006918|Ga0079216_11944371 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300009094|Ga0111539_10273772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1965 | Open in IMG/M |
| 3300009094|Ga0111539_13331656 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300009100|Ga0075418_10925263 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300009100|Ga0075418_12692646 | Not Available | 543 | Open in IMG/M |
| 3300009176|Ga0105242_11395705 | Not Available | 728 | Open in IMG/M |
| 3300009789|Ga0126307_10152673 | All Organisms → cellular organisms → Bacteria | 1848 | Open in IMG/M |
| 3300009789|Ga0126307_10318284 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
| 3300009789|Ga0126307_10348891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1192 | Open in IMG/M |
| 3300009789|Ga0126307_10521872 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 959 | Open in IMG/M |
| 3300009789|Ga0126307_11541929 | Not Available | 539 | Open in IMG/M |
| 3300009840|Ga0126313_10005501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7570 | Open in IMG/M |
| 3300009840|Ga0126313_10021672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4285 | Open in IMG/M |
| 3300010036|Ga0126305_10232613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1179 | Open in IMG/M |
| 3300010036|Ga0126305_10275588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 1087 | Open in IMG/M |
| 3300010036|Ga0126305_11244401 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300010039|Ga0126309_10036844 | All Organisms → cellular organisms → Bacteria | 2267 | Open in IMG/M |
| 3300010039|Ga0126309_10279746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 957 | Open in IMG/M |
| 3300010040|Ga0126308_10017228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 3822 | Open in IMG/M |
| 3300010040|Ga0126308_10666263 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 713 | Open in IMG/M |
| 3300010040|Ga0126308_11094090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Salsipaludibacterales → Salsipaludibacteraceae → Salsipaludibacter → Salsipaludibacter albus | 561 | Open in IMG/M |
| 3300010041|Ga0126312_10619773 | Not Available | 778 | Open in IMG/M |
| 3300010042|Ga0126314_10219494 | Not Available | 1343 | Open in IMG/M |
| 3300010042|Ga0126314_10934524 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300010044|Ga0126310_10082258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1900 | Open in IMG/M |
| 3300010044|Ga0126310_10973861 | Not Available | 666 | Open in IMG/M |
| 3300010045|Ga0126311_10813300 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 754 | Open in IMG/M |
| 3300010045|Ga0126311_11430784 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 577 | Open in IMG/M |
| 3300010166|Ga0126306_10222845 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300010166|Ga0126306_10561214 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300010166|Ga0126306_11669840 | Not Available | 531 | Open in IMG/M |
| 3300011119|Ga0105246_11556439 | Not Available | 623 | Open in IMG/M |
| 3300012045|Ga0136623_10079642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1430 | Open in IMG/M |
| 3300012093|Ga0136632_10144780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1094 | Open in IMG/M |
| 3300012186|Ga0136620_10189887 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300012529|Ga0136630_1358577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
| 3300012897|Ga0157285_10084568 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300014745|Ga0157377_11099411 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 609 | Open in IMG/M |
| 3300014969|Ga0157376_13026404 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300017649|Ga0182741_1139314 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 674 | Open in IMG/M |
| 3300017651|Ga0182742_1026054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3200 | Open in IMG/M |
| 3300017787|Ga0183260_10163079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1582 | Open in IMG/M |
| 3300018422|Ga0190265_10220878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1923 | Open in IMG/M |
| 3300018422|Ga0190265_11138061 | Not Available | 900 | Open in IMG/M |
| 3300018422|Ga0190265_12754503 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300018429|Ga0190272_10376648 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300018429|Ga0190272_11513623 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300018432|Ga0190275_10132093 | All Organisms → cellular organisms → Bacteria | 2271 | Open in IMG/M |
| 3300018432|Ga0190275_10272162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1645 | Open in IMG/M |
| 3300018432|Ga0190275_10292009 | All Organisms → cellular organisms → Bacteria | 1594 | Open in IMG/M |
| 3300018432|Ga0190275_10884455 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300018432|Ga0190275_11462681 | Not Available | 760 | Open in IMG/M |
| 3300018432|Ga0190275_11665216 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300018432|Ga0190275_12115799 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 641 | Open in IMG/M |
| 3300018466|Ga0190268_10104928 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300018466|Ga0190268_10386585 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300018466|Ga0190268_11670527 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300018469|Ga0190270_10230890 | All Organisms → cellular organisms → Bacteria | 1592 | Open in IMG/M |
| 3300018469|Ga0190270_10632327 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1049 | Open in IMG/M |
| 3300018469|Ga0190270_11565043 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 710 | Open in IMG/M |
| 3300018469|Ga0190270_11891123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 653 | Open in IMG/M |
| 3300018469|Ga0190270_13197419 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300018476|Ga0190274_11499027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 766 | Open in IMG/M |
| 3300018481|Ga0190271_11517204 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300018481|Ga0190271_11690126 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300018920|Ga0190273_11338064 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 621 | Open in IMG/M |
| 3300019356|Ga0173481_10509364 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300019377|Ga0190264_10546009 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 809 | Open in IMG/M |
| 3300019377|Ga0190264_10746811 | Not Available | 733 | Open in IMG/M |
| 3300020181|Ga0196958_10021886 | Not Available | 1838 | Open in IMG/M |
| 3300020181|Ga0196958_10080460 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300024430|Ga0196962_10042085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1377 | Open in IMG/M |
| 3300025901|Ga0207688_10057967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2178 | Open in IMG/M |
| 3300025907|Ga0207645_10688457 | Not Available | 695 | Open in IMG/M |
| 3300025917|Ga0207660_11147583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 633 | Open in IMG/M |
| 3300025932|Ga0207690_11583503 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
| 3300025933|Ga0207706_10796333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 803 | Open in IMG/M |
| 3300025940|Ga0207691_11061013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 675 | Open in IMG/M |
| 3300025972|Ga0207668_10364035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1213 | Open in IMG/M |
| 3300025972|Ga0207668_11238064 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 671 | Open in IMG/M |
| 3300025986|Ga0207658_11428256 | Not Available | 633 | Open in IMG/M |
| 3300026023|Ga0207677_10314937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1298 | Open in IMG/M |
| 3300026121|Ga0207683_10407803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1251 | Open in IMG/M |
| 3300027761|Ga0209462_10071750 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300027761|Ga0209462_10137009 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
| 3300028578|Ga0272482_10134624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 723 | Open in IMG/M |
| 3300028587|Ga0247828_10120613 | Not Available | 1273 | Open in IMG/M |
| 3300028597|Ga0247820_11288201 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300028812|Ga0247825_10253626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1224 | Open in IMG/M |
| 3300028812|Ga0247825_11175655 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 560 | Open in IMG/M |
| 3300030336|Ga0247826_10175521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium LSUCC0115 | 1441 | Open in IMG/M |
| 3300030336|Ga0247826_10840459 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300031229|Ga0299913_10186665 | All Organisms → cellular organisms → Bacteria | 2051 | Open in IMG/M |
| 3300031548|Ga0307408_102369200 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
| 3300031731|Ga0307405_12063509 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300031731|Ga0307405_12071558 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
| 3300031824|Ga0307413_11621732 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300031901|Ga0307406_11918745 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300031903|Ga0307407_10516792 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300031903|Ga0307407_11016369 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 641 | Open in IMG/M |
| 3300031903|Ga0307407_11525967 | Not Available | 529 | Open in IMG/M |
| 3300031995|Ga0307409_100188191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1835 | Open in IMG/M |
| 3300031995|Ga0307409_101199540 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300032002|Ga0307416_100438591 | Not Available | 1355 | Open in IMG/M |
| 3300032005|Ga0307411_11535374 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 613 | Open in IMG/M |
| 3300032005|Ga0307411_11671425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 589 | Open in IMG/M |
| 3300032005|Ga0307411_11912931 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
| 3300032013|Ga0310906_10824326 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300032080|Ga0326721_10251811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 961 | Open in IMG/M |
| 3300032080|Ga0326721_10327621 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 864 | Open in IMG/M |
| 3300032080|Ga0326721_10439564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 764 | Open in IMG/M |
| 3300032080|Ga0326721_10514526 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 715 | Open in IMG/M |
| 3300032126|Ga0307415_100765455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter pauli | 878 | Open in IMG/M |
| 3300032126|Ga0307415_101485707 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 23.19% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 18.12% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 11.59% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.07% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 3.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.90% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.17% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 2.17% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 2.17% |
| Compost | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost | 1.45% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.45% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.45% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.45% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.72% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
| 3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
| 3300012186 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06) | Environmental | Open in IMG/M |
| 3300012529 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ568 (21.06) | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017649 | Enriched Organic Plus compost microbial communities from Emeryville, California, USA - eDNA 5th pass 37_C BE-Lig OP (version 2) | Environmental | Open in IMG/M |
| 3300017651 | Enriched Miracle-Growth compost microbial communities from Emeryville, California, USA - eDNA 5th pass 37_C BE-Lig MG (version 2) | Environmental | Open in IMG/M |
| 3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300020181 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_10 | Environmental | Open in IMG/M |
| 3300024430 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20 | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027761 | Agave microbial communities from Guanajuato, Mexico - As.Sf.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028578 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT160D0 | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032080 | Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062594_1002313922 | 3300005093 | Soil | MSTLKFDLAVGLVVTLLALAGAYWQAERTAAFDRQDRTGETLRLVCPLH* |
| Ga0070658_109760402 | 3300005327 | Corn Rhizosphere | MSTLKFDLAVGLVVTLLALAGAYWQAERTSAFDRQDRTGETLRLVCPLH* |
| Ga0066388_1059414091 | 3300005332 | Tropical Forest Soil | ARMSARLKRELSVGLALTALALGGAYWQAERTAAFEKSETLRLVCPLH* |
| Ga0070682_1004810071 | 3300005337 | Corn Rhizosphere | MSTLKFDLAVGLVVTLLALAGAYWQAERTAAFDRQDRTGETL |
| Ga0070660_1019389541 | 3300005339 | Corn Rhizosphere | MSTLKFDLAVGLVVTLLALAGAYWQAERTAAFDRQDRTGETLRLVCP |
| Ga0070691_100805252 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTLKFDLAVGAVVTVLAIAGAYWQAERTAAFERQDGTGETLRLVCPLH* |
| Ga0070667_1008874312 | 3300005367 | Switchgrass Rhizosphere | MSTLKFDLAVGLVVTLLALGGAYWQAERTAAFDRQDRTGETLRLVCPLH* |
| Ga0070701_105922972 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTLKFDLAVGAVVTVLAIAGAYWQAERTAAFDRQDGTGETLRLVCPLH* |
| Ga0070678_1010143582 | 3300005456 | Miscanthus Rhizosphere | MSRRQLLIDLAVGLVVGLLALAGAYWQAERTAAFDRQDRTGETLRLVCPLH* |
| Ga0070678_1019447632 | 3300005456 | Miscanthus Rhizosphere | GAVVTVLAIAGAYWQAERTAAFDRQDGTGETLRLVCPLH* |
| Ga0070685_104213912 | 3300005466 | Switchgrass Rhizosphere | MSTLKFDLAVGLVVTLLALAGAYWQAERTAAFDRKDGTGETLRLVCPLH* |
| Ga0070686_1013012561 | 3300005544 | Switchgrass Rhizosphere | GAGAGMSTLKFDLAVGLVVTLLALAGAYWQAERTAAFDRQDRTGETLRLVCPLH* |
| Ga0068856_1010303662 | 3300005614 | Corn Rhizosphere | MSTLKFDLAVGLVVTLLALAGAYWQAERTSAFDRQDRTGETLR |
| Ga0081455_108899821 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSTRLKRELSVGLALTALALGGAYWQAERTAAFEKSETLRLVCPL |
| Ga0075417_101571341 | 3300006049 | Populus Rhizosphere | MSLRRELAIGLVLLLVAVAGAYWQAERTAAFERQDGTGEALRLVCPLH* |
| Ga0082029_17395232 | 3300006169 | Termite Nest | MSTLKFDLAVGLVVTLLALGGAYWQAERTAAFDRQDGTGKTLRLVCPLH* |
| Ga0082029_17396482 | 3300006169 | Termite Nest | MSLRRELTVGLVLVVLAVLGAYWQAERTAAFERRDGTGETLRLVCPLH* |
| Ga0068871_1005673242 | 3300006358 | Miscanthus Rhizosphere | GLVVTLLALAGAYWQAERTAAFDRQDRTGETLRLVCPLH* |
| Ga0079222_109374992 | 3300006755 | Agricultural Soil | MSTLKFDLAVGLVVTLLALAGAYWQAERTSAFDRHDRTGETLRLVCPLH* |
| Ga0075421_1025797781 | 3300006845 | Populus Rhizosphere | MKTLMFDLAVGAVVTVLAIAGAYWQAERTAAFERQDGTGETLRLVCPLH* |
| Ga0075430_1005666381 | 3300006846 | Populus Rhizosphere | MSLRRELAIGVVLLVLAVAGAYWQAERTAAFEREDGTGETLRLVCPLH* |
| Ga0075430_1014965012 | 3300006846 | Populus Rhizosphere | GAGTGMSLRRELAIGLVLLLVAVAGAYWQAERTAAFERRDGTGETLRLVCPLH* |
| Ga0075424_1008076551 | 3300006904 | Populus Rhizosphere | MSTLKFDLAVGLVVTLLALAGAYWQAERTAAFDRQDRTGETLRL |
| Ga0079216_111649851 | 3300006918 | Agricultural Soil | MSLRHELAIGLVLVVLAVAGAYWQAERTAAFERKDGTGEALRLVCPLH* |
| Ga0079216_119443711 | 3300006918 | Agricultural Soil | VRLRSELAVGAVLTVLAVGGAYWQAERTAAFERQDGTGEALRLVCPLH* |
| Ga0111539_102737723 | 3300009094 | Populus Rhizosphere | VVTVLAIAGAYWQAERTAAFDRQDGTGETLRLVYPLH* |
| Ga0111539_133316562 | 3300009094 | Populus Rhizosphere | MKTLMFDLAVGAVVTVLAIAGAYWQAERTAAFDRQDGTGETLRLVCPLH* |
| Ga0075418_109252631 | 3300009100 | Populus Rhizosphere | MSTLKFDLAVGLVVTLIALAGAYWQAERTAAFERQDGTGQTLRLVCPLH* |
| Ga0075418_126926462 | 3300009100 | Populus Rhizosphere | GAVVTVLAIAGAYWQAERTAAFERQDGTGETLRLVCPLH* |
| Ga0105242_113957052 | 3300009176 | Miscanthus Rhizosphere | MSTLKFDLAVGLVVALLALAGAYWQAERTAAFDRKDGTGETLRLVCPLH* |
| Ga0126307_101526732 | 3300009789 | Serpentine Soil | MNRRQLLLDLAVGLVVGMLALAGAYWQAERTASFERKDGTGQTLRLVCPLH* |
| Ga0126307_103182842 | 3300009789 | Serpentine Soil | MSLRRELAVGLVLLVLAVAGAYWQAERTAAFEREDGTGEALRLVCPLH* |
| Ga0126307_103488912 | 3300009789 | Serpentine Soil | VSTLSKDLLVGLVVSVLALAGAYWQAERTAAFERQDGTGETLRLVCPLH* |
| Ga0126307_105218722 | 3300009789 | Serpentine Soil | LGAGAGMSTLWKDLLVGLVVSVLALAGAYGQAERTAAFERQDGTGEALRLVCPLH* |
| Ga0126307_115419292 | 3300009789 | Serpentine Soil | VSTLSKDLLVGLVVSVLALALAGAYWQAERTAPFERQDGTGETLRLVCPLH* |
| Ga0126313_100055013 | 3300009840 | Serpentine Soil | MSTLWKDLLVGLVVTVLALGGAYWQAERTAAFERHDGTGETLRLVCPLH* |
| Ga0126313_100216722 | 3300009840 | Serpentine Soil | MKLWQELLAGLIVTVLALGGAYWQAARTAAFDRRDGTGETLRLVCPLH* |
| Ga0126305_102326132 | 3300010036 | Serpentine Soil | LVVSVLALGGAYWQAERTAAFERQDGTGETLRLVCPLH* |
| Ga0126305_102755882 | 3300010036 | Serpentine Soil | MSRLGKDLVVTAVVSVFALAGAYWQAERTASFERQDGTGQTLRLVCPLH* |
| Ga0126305_112444011 | 3300010036 | Serpentine Soil | VSTLWKDLVVGLVVSVLALGGAYWQAERTAAFDRQDGTGKTLRLVCPLH* |
| Ga0126309_100368442 | 3300010039 | Serpentine Soil | MSTLWKDLLVGLVVSVLALGGAYWQAERTAAFERRDGTGETLRLVCPLH* |
| Ga0126309_102797461 | 3300010039 | Serpentine Soil | LLVGLVVSVLALGGAYWQAERTAAFERQDGTGETLRLVCPLH* |
| Ga0126308_100172284 | 3300010040 | Serpentine Soil | VSTRLRHELAAGLVLTALAVGGAYWQAERTAAFDRQDGTGETLRLVCPLH* |
| Ga0126308_106662632 | 3300010040 | Serpentine Soil | VRLRTELAIGALLAVLALAGAYWQAERTAAFERRDGTGEALRLVCPLH* |
| Ga0126308_110940902 | 3300010040 | Serpentine Soil | MSRLGKDLVVTAVVSVFALAGAYWQADRTASFERQEGTGQTLRLVCPLH* |
| Ga0126312_106197732 | 3300010041 | Serpentine Soil | VSTLSKDLLVGVVVSVLALGAAYWQVERTAAFDRQDGTGETLRLVCPLH* |
| Ga0126314_102194941 | 3300010042 | Serpentine Soil | MSTLWKDLLVGLVVTVLALGGAYWQAERTAAFERHDGTGETLRLV |
| Ga0126314_109345242 | 3300010042 | Serpentine Soil | VSVLALGGAYWQAERTAAFDRQDGTGKTLRLVCPLH* |
| Ga0126310_100822582 | 3300010044 | Serpentine Soil | VSTLSKDLLVGVVVSVLALGAAYWQAERTAAFDRQDGTGETLRLVCPLH* |
| Ga0126310_109738612 | 3300010044 | Serpentine Soil | MSTLAKDLLVGLVVSVLALGGAYWQAERTAAFERHDGTGETLRLVCPLH* |
| Ga0126311_108133001 | 3300010045 | Serpentine Soil | VSTRLRQELAAGLVLTALAVGGAYWQAERTAAFDRQDGTGETLRLVCPLH* |
| Ga0126311_114307842 | 3300010045 | Serpentine Soil | MNRRQLLLDLAVGLVVGMLALAGAYWQAERTASFEREDGTGQTLRLVCPLH* |
| Ga0126306_102228452 | 3300010166 | Serpentine Soil | VSTLSKDLLVDLVVSVLALALAGAYWQAERTAPFERQDGTGETLRLVCPLH* |
| Ga0126306_105612142 | 3300010166 | Serpentine Soil | VRTLWKDLVVGLVVSVLALGGAYWQAERTAAFDRQDGTGKTLRLVCPLH* |
| Ga0126306_116698402 | 3300010166 | Serpentine Soil | MSTLWKDLLVGLVVSVLALAGAYWQAERTASFERQDGTGQTLRLVCPLH* |
| Ga0105246_115564392 | 3300011119 | Miscanthus Rhizosphere | MSALKFDLAVGLVVTLLALAGAYWQAERTAAFDRQDRTGETLRLVCPLH* |
| Ga0136623_100796422 | 3300012045 | Polar Desert Sand | MSRRLRRELGAGLAVAAVALAGAFWQAERTSAFESRSQSGQTLRLVCPLH* |
| Ga0136632_101447802 | 3300012093 | Polar Desert Sand | MSRRLRRELGAGLAVAAVALAGAFWQAERTAAFDGDSQSGQTLRLVCPLH* |
| Ga0136620_101898871 | 3300012186 | Polar Desert Sand | MGPGARMTRRLRRELGAGLAVAAVALAGAFWQAERTSAFESRSQSGQTLRLVCPLH* |
| Ga0136630_13585771 | 3300012529 | Polar Desert Sand | MNRRLRRELGVGLAVALIALTGAFWQAERTTAFDNQTETGRTLRLVCPLH* |
| Ga0157285_100845682 | 3300012897 | Soil | MMSRRQLMIDLAIGLVVGLLALAGAYWQAERTAAFDRQDGTGRTLRLVCPLH* |
| Ga0157377_110994112 | 3300014745 | Miscanthus Rhizosphere | MSGLKLDLAVGLVVALLALAGAYWQAERTSAFDRQDRTGETLRLVCPLH* |
| Ga0157376_130264042 | 3300014969 | Miscanthus Rhizosphere | MSTLKFDLAVGLVVALLALAGAYWQAERTAAFDRQDRTGETLRLVCPLH* |
| Ga0182741_11393141 | 3300017649 | Compost | VSARLKRELGAGVAVALLALGGAYWQAERTNAFEADTRTGETLRLV |
| Ga0182742_10260544 | 3300017651 | Compost | VSARLKRELGAGVAVALLALGGAYWQAERTNAFEADTRTGETLRLVCPLH |
| Ga0183260_101630792 | 3300017787 | Polar Desert Sand | MSRRLRRELGAGLAVAAVALAGAFWQAERTAAFDGDSQSGQTLRLVCPLH |
| Ga0190265_102208783 | 3300018422 | Soil | MSSRLKRELSVGAVVVAAALGGGYWQAERTAAFEADSRTGETLRLVCPLH |
| Ga0190265_111380611 | 3300018422 | Soil | SLWRDLAVGLVVAALAAAGAYWQAERTAAFERKDGTGETLRLVCPLH |
| Ga0190265_127545032 | 3300018422 | Soil | MSLRRELAVGAVLTVLAVAGAYWQAERTAAFERQDGTGETLRLVCPLH |
| Ga0190272_103766482 | 3300018429 | Soil | MSARLKRELGVGLGVIVLALGGGYWQAERTAAFEADGRTGETLRLVCPLH |
| Ga0190272_115136232 | 3300018429 | Soil | MNRRQLLLDLAVGLVVGVLALAGAYWQAERTAAFERQDGTGETLRLVCPLH |
| Ga0190275_101320932 | 3300018432 | Soil | MSSRLKRELSVGVVVVAAALGGGYWQADRTAAFEADSRTGETLRLVCPLH |
| Ga0190275_102721623 | 3300018432 | Soil | MSLWRDLAVGLVVAALAAAGAYWQAERTAAFERKDGTGETLRLVCPLH |
| Ga0190275_102920092 | 3300018432 | Soil | VSTLRKDLLVGLVVSVLAVAGAYWQAERTAAFERQDDTGQTLRLVCPLH |
| Ga0190275_108844552 | 3300018432 | Soil | EAGVGLAVALAAMAGAFWQAERTGAFAQESRDGATLRLVCPLH |
| Ga0190275_114626812 | 3300018432 | Soil | MSTLWKDLLVGLVVSVLALGGAYWQAERTAAFERRDGTGETSRLVCPLH |
| Ga0190275_116652162 | 3300018432 | Soil | MSTRLKRELGVGLGVVVLALGGGYWQAERTAAFEGDGRTGETLRLVCPLH |
| Ga0190275_121157991 | 3300018432 | Soil | VSTLSKDLLVGLVVSVLALGGAYWQAERTAAFDRQDGTGETLRLVCPLH |
| Ga0190268_101049282 | 3300018466 | Soil | MSLRRELAIGVVLLVLAVAGAYWQAERTAAFDRQDGTGETLRLVCPLH |
| Ga0190268_103865851 | 3300018466 | Soil | MSSRLRRELSVGVVVVAAALGGGYWQAERTAAFEADSRTGETLRLVCPLH |
| Ga0190268_116705272 | 3300018466 | Soil | VRLRTELAIGLVLLLVAVAGAYWQAERTAAFERRDGTGETLRLVCPLH |
| Ga0190270_102308902 | 3300018469 | Soil | VRLRTELAIGAVLAVLALAGAYWQAERTAAFERQDGTGEALRLVCPLH |
| Ga0190270_106323272 | 3300018469 | Soil | VSPRLRRELAVGLALAVLAVAGAYWQAERTAAFERDDGTGETLRLVCPLH |
| Ga0190270_115650431 | 3300018469 | Soil | MSGRLKRELSVGLAVVIAAIGGGYWQAERTAAFEADSRTGETL |
| Ga0190270_118911231 | 3300018469 | Soil | MSARLKRELGVGLGVIVLALGGGYWQAERTAAFDADSRTG |
| Ga0190270_131974191 | 3300018469 | Soil | VRLRTELAIGALLAVLALAGAYWQAERTAAFERRDGTGETLRLVCPLH |
| Ga0190274_114990271 | 3300018476 | Soil | GAGMSTLWKDLLVGLVVSVLALGGAYWQAERTAAFERRDGTGETLRLVCPLH |
| Ga0190271_115172041 | 3300018481 | Soil | VRLRTELAIGALLAVLALGGAYWQAERTAAFERRDGTGETLRLVWPLH |
| Ga0190271_116901262 | 3300018481 | Soil | MSARLKRELGVGLVVIVAALGGGYWQAERTAAFEADGRTGETLRLVCPLH |
| Ga0190273_113380641 | 3300018920 | Soil | VSTRLKRELGVGLAVVVAAVGGGYWQAERTAAFEADSRSGETLRLVCPLH |
| Ga0173481_105093642 | 3300019356 | Soil | MKTLKFDLAVGAVVTLLAIAGAYWQAERTAAFDRQDGTGETLRLVCPLH |
| Ga0190264_105460092 | 3300019377 | Soil | MSSRLKRELGVGLGVIVLALGGGYWQAERTAAFEADGRTGETLRLVCPLH |
| Ga0190264_107468112 | 3300019377 | Soil | MSLRRELAVGAVLAVLAVAGAYWQAERTAAFERQDGTGETLRLVCPLH |
| Ga0196958_100218862 | 3300020181 | Soil | MSARLRRELGAGLAVAVLAVAGAYWQAERTAAFERQDGTGETLRLVCPLH |
| Ga0196958_100804602 | 3300020181 | Soil | VSLRSELAVGAVLAVLAVGGAYWQAERTAAFERQDGTGEALRLVCPLH |
| Ga0196962_100420852 | 3300024430 | Soil | VSRRLKRELSVGLAVTVAALGGGYWQAERTAAFEAHSSTGHTLRLVCPLH |
| Ga0207688_100579672 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTLKFDLAVGAVVTVLAIAGAYWQAERTAAFDRQDGTGETLRLVCPLH |
| Ga0207645_106884572 | 3300025907 | Miscanthus Rhizosphere | MSTLKFDLAVGLVVTLLALAGAYWQAERTAAFDRQDRTGETLRLVCPLH |
| Ga0207660_111475831 | 3300025917 | Corn Rhizosphere | TLLALAGAYWQAERTAAFDRQDRTGETLRLVCPLH |
| Ga0207690_115835031 | 3300025932 | Corn Rhizosphere | MSTLKFDLAVGLVVTLLALAGAYWQAERTAAFDRQDR |
| Ga0207706_107963332 | 3300025933 | Corn Rhizosphere | MKTLKFDLAVGAVVTVLAIAGAYWQAERTAAFDRQDGTGETLRLFCPLH |
| Ga0207691_110610131 | 3300025940 | Miscanthus Rhizosphere | TLKVDLAVGAVVTVLAIAGAYWQAERTAAFDRQDGTGETLRLVCPLH |
| Ga0207668_103640353 | 3300025972 | Switchgrass Rhizosphere | GLVVTLLALAGAYWQAERTAAFDRQDRTGETLRLVCPLH |
| Ga0207668_112380641 | 3300025972 | Switchgrass Rhizosphere | MSTLKFVLAVGLVVTLLALAGAYWQAERTAAFDRQDRTGETLRLVCPLH |
| Ga0207658_114282562 | 3300025986 | Switchgrass Rhizosphere | MSTLKFDLAVGLVVTLLALGGAYWQAERTAAFDRQDRTGETLRLVCPLH |
| Ga0207677_103149372 | 3300026023 | Miscanthus Rhizosphere | MSTLKFDLAVGLVVTLLALAGAYWQAERTSAFDRQDRTGETLRLVCPLH |
| Ga0207683_104078031 | 3300026121 | Miscanthus Rhizosphere | AVGLVVTLLALAGAYWQAERTAAFDRQDRTGETLRLVCPLH |
| Ga0209462_100717501 | 3300027761 | Agave | MSTLWKDLLVGLVVSVLALAGAYWQAERTAAFERQDGTGETLRLVCPLH |
| Ga0209462_101370092 | 3300027761 | Agave | MSGRLKRELGVGLGVIALALGGGYWQAERTAAFEADSKTGDTLRLVCPLH |
| Ga0272482_101346242 | 3300028578 | Soil | MSSRLKRELSVGVVVVAAALGGGYWQAERTAAFEADSRTGETLRLVCPLH |
| Ga0247828_101206132 | 3300028587 | Soil | MSGRLKRELGVGLVVVVAALGGGYWQAERTAAFEADSRTGETLRLVCPLH |
| Ga0247820_112882012 | 3300028597 | Soil | MSRRQLLIDLAVGLVVGLLALAGAYWQAERTAAFDRQDGTGETLRLVCPLH |
| Ga0247825_102536261 | 3300028812 | Soil | AVGLAAAVAALAGAYWQAERTAAFESESQTGETLRLVCPLH |
| Ga0247825_111756551 | 3300028812 | Soil | VSLRTELAIGVLLAVLALGGAYWQAERTAAFERQDGTGETLRLVCPLH |
| Ga0247826_101755212 | 3300030336 | Soil | MSLWRDLAVGLVVAALATAGAYWQAERTAAFDRKDGTGETLRLVCPLH |
| Ga0247826_108404592 | 3300030336 | Soil | MNRQLRRELAVGLAAAVAALAGAYWQAERTAAFESESQTGETLRLVCPLH |
| Ga0299913_101866652 | 3300031229 | Soil | MSLRRELSVGAVLTVLAVAGAYWQAERTAAFERQDGTGETLRLVCPLH |
| Ga0307408_1023692001 | 3300031548 | Rhizosphere | MSLRLELAVGAVLLVLAVAGAYWQAERIAAFDRQDGTGEALRLV |
| Ga0307405_120635092 | 3300031731 | Rhizosphere | MSLRLELAVGAVLLVLAVAGAYWQAERTAAFDRQDGTGEALRLVCPLH |
| Ga0307405_120715582 | 3300031731 | Rhizosphere | MNRRQLLLDLAVGLVVGMLALAGAYWQAERTASFEREDGTGQTLRLVCPLH |
| Ga0307413_116217322 | 3300031824 | Rhizosphere | MSSRLKRELSVGAVVVAAALGGGYWQAERTAAFEADSKTGETLRLVCPLH |
| Ga0307406_119187451 | 3300031901 | Rhizosphere | MSTLKFDLAVGLVITLLALAGAYWQAERTAAFDRQDGTGETLRLVCPLH |
| Ga0307407_105167921 | 3300031903 | Rhizosphere | MSLRLELAVGAVLLVLAVAGAYWQAERTAAFDRQDGTGETLRLVCPLH |
| Ga0307407_110163691 | 3300031903 | Rhizosphere | MSTLWKDLLVGLVVSVLALGGAYWQAERTAAFERRDGTGETLRLVCPLH |
| Ga0307407_115259672 | 3300031903 | Rhizosphere | HELLAGLVVTILALGGAYWQAERTAAFERQDGTGETLRLVCPLH |
| Ga0307409_1001881912 | 3300031995 | Rhizosphere | MSLRRELAVGVVLLVLAVAGAYWQAERTAAFERRDGTGETLRLVCPLH |
| Ga0307409_1011995402 | 3300031995 | Rhizosphere | MSTLWKDLLVGLVVSVLALAGAYWQAERTAAFERRDGTGETLRLVCPLH |
| Ga0307416_1004385912 | 3300032002 | Rhizosphere | MSTLWKDLLVGLVVSVLALGGAYWQAERTAAFERHDGAGETLRLV |
| Ga0307411_115353742 | 3300032005 | Rhizosphere | MSTLYKDLLVGLVVSALALAGAYWQAERTSAFERQDGTGETLRLVCPLH |
| Ga0307411_116714252 | 3300032005 | Rhizosphere | SRLKRELSVGAVVVAAALGGGYWQAERTAAFEADSKTGETLRLVCPLH |
| Ga0307411_119129312 | 3300032005 | Rhizosphere | MSLWRELAVGLVVAVLAIAGAYWQAERTSAFERRDG |
| Ga0310906_108243262 | 3300032013 | Soil | MSRRQLLIDLAVGLVVGLLALAGAYWQAERTAAFERQDGTGETLRLVCPLH |
| Ga0326721_102518112 | 3300032080 | Soil | MSSRVRRELGVGLVVIVAALGGGYWQAERTAAFEADSRTGETLRLVCPLH |
| Ga0326721_103276212 | 3300032080 | Soil | MSARLKRELGAGAVVVALALGGGYWQAERTAAFEAESRTG |
| Ga0326721_104395641 | 3300032080 | Soil | APEAPAAVSTLYKDLLVGLVVSVLALGAAYWQAERTAAFERQDATGQTLRLVCPLH |
| Ga0326721_105145262 | 3300032080 | Soil | MSTLWKDLLVGLVVSVLALAGAYWQAERTAAFERQDGTGETLRLV |
| Ga0307415_1007654553 | 3300032126 | Rhizosphere | MSLRRELAVGVALLVLAVAGAYWQAERTAAFERRDGTGETLRLVCPLH |
| Ga0307415_1014857072 | 3300032126 | Rhizosphere | VSSRLKRELSVGAVVIAAALGGGYWQAERTAAFEADSKTGDTLRLVCPLH |
| ⦗Top⦘ |