| Basic Information | |
|---|---|
| Family ID | F055055 |
| Family Type | Metagenome |
| Number of Sequences | 139 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MKRLSFLVSLTNNDNDYQQEQAAAAEKAARRLGVDVKI |
| Number of Associated Samples | 122 |
| Number of Associated Scaffolds | 139 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 76.81 % |
| % of genes near scaffold ends (potentially truncated) | 98.56 % |
| % of genes from short scaffolds (< 2000 bps) | 87.77 % |
| Associated GOLD sequencing projects | 118 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.842 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.791 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.338 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.273 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.76% β-sheet: 9.09% Coil/Unstructured: 65.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 139 Family Scaffolds |
|---|---|---|
| PF00294 | PfkB | 11.51 |
| PF02633 | Creatininase | 8.63 |
| PF00793 | DAHP_synth_1 | 4.32 |
| PF05402 | PqqD | 2.16 |
| PF14748 | P5CR_dimer | 2.16 |
| PF00171 | Aldedh | 1.44 |
| PF13407 | Peripla_BP_4 | 0.72 |
| PF02254 | TrkA_N | 0.72 |
| PF03725 | RNase_PH_C | 0.72 |
| PF07311 | Dodecin | 0.72 |
| PF01977 | UbiD | 0.72 |
| PF00004 | AAA | 0.72 |
| PF00675 | Peptidase_M16 | 0.72 |
| PF13620 | CarboxypepD_reg | 0.72 |
| PF06831 | H2TH | 0.72 |
| PF01451 | LMWPc | 0.72 |
| PF00696 | AA_kinase | 0.72 |
| PF01523 | PmbA_TldD | 0.72 |
| PF04055 | Radical_SAM | 0.72 |
| PF14907 | NTP_transf_5 | 0.72 |
| PF13561 | adh_short_C2 | 0.72 |
| PF00106 | adh_short | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 139 Family Scaffolds |
|---|---|---|---|
| COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 8.63 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 1.44 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 1.44 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 1.44 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 0.72 |
| COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 0.72 |
| COG0312 | Zn-dependent protease PmbA/TldA or its inactivated homolog | General function prediction only [R] | 0.72 |
| COG0689 | Ribonuclease PH | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG1185 | Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG2123 | Exosome complex RNA-binding protein Rrp42, RNase PH superfamily | Intracellular trafficking, secretion, and vesicular transport [U] | 0.72 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.84 % |
| Unclassified | root | N/A | 2.16 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459019|G14TP7Y01CLL24 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300000955|JGI1027J12803_107894965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1169 | Open in IMG/M |
| 3300001471|JGI12712J15308_10211774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 511 | Open in IMG/M |
| 3300001593|JGI12635J15846_10057174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2942 | Open in IMG/M |
| 3300001661|JGI12053J15887_10434579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300002917|JGI25616J43925_10274946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 629 | Open in IMG/M |
| 3300004091|Ga0062387_101782350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 502 | Open in IMG/M |
| 3300004480|Ga0062592_100698774 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300005167|Ga0066672_10112281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1676 | Open in IMG/M |
| 3300005332|Ga0066388_100085598 | All Organisms → cellular organisms → Bacteria | 3549 | Open in IMG/M |
| 3300005332|Ga0066388_105041571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
| 3300005454|Ga0066687_10239496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 1008 | Open in IMG/M |
| 3300005533|Ga0070734_10774237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300005542|Ga0070732_10171732 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
| 3300005544|Ga0070686_101118406 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300005545|Ga0070695_100764139 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300005554|Ga0066661_10855491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 532 | Open in IMG/M |
| 3300005561|Ga0066699_10138278 | All Organisms → cellular organisms → Bacteria | 1650 | Open in IMG/M |
| 3300005587|Ga0066654_10747229 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 551 | Open in IMG/M |
| 3300005591|Ga0070761_10408884 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300005591|Ga0070761_10992813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 532 | Open in IMG/M |
| 3300006052|Ga0075029_101118956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 547 | Open in IMG/M |
| 3300006175|Ga0070712_100963914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300006175|Ga0070712_101166333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 670 | Open in IMG/M |
| 3300006237|Ga0097621_101677442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 605 | Open in IMG/M |
| 3300006796|Ga0066665_10196022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1564 | Open in IMG/M |
| 3300006800|Ga0066660_10889346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 725 | Open in IMG/M |
| 3300006847|Ga0075431_101883860 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300006854|Ga0075425_101693951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300009088|Ga0099830_10206060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1541 | Open in IMG/M |
| 3300009089|Ga0099828_11101473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
| 3300009521|Ga0116222_1495103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300009522|Ga0116218_1089257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1404 | Open in IMG/M |
| 3300009524|Ga0116225_1474326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300009545|Ga0105237_12744757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 504 | Open in IMG/M |
| 3300009635|Ga0116117_1163273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300009683|Ga0116224_10175025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1030 | Open in IMG/M |
| 3300009683|Ga0116224_10566352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300009839|Ga0116223_10831753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 527 | Open in IMG/M |
| 3300010321|Ga0134067_10359016 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300010358|Ga0126370_11371358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300010359|Ga0126376_12203500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 596 | Open in IMG/M |
| 3300010362|Ga0126377_10106284 | All Organisms → cellular organisms → Bacteria | 2570 | Open in IMG/M |
| 3300010376|Ga0126381_103591583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 608 | Open in IMG/M |
| 3300010398|Ga0126383_10199119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1921 | Open in IMG/M |
| 3300011271|Ga0137393_10102741 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2336 | Open in IMG/M |
| 3300011271|Ga0137393_10713935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 858 | Open in IMG/M |
| 3300011271|Ga0137393_11534942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300011411|Ga0153933_1045286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 972 | Open in IMG/M |
| 3300012211|Ga0137377_11027790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
| 3300012351|Ga0137386_10089656 | All Organisms → cellular organisms → Bacteria | 2163 | Open in IMG/M |
| 3300012362|Ga0137361_11937822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 506 | Open in IMG/M |
| 3300014167|Ga0181528_10281967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 898 | Open in IMG/M |
| 3300015242|Ga0137412_10994686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 601 | Open in IMG/M |
| 3300015265|Ga0182005_1095785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 828 | Open in IMG/M |
| 3300015372|Ga0132256_100033977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4637 | Open in IMG/M |
| 3300016319|Ga0182033_10532662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1013 | Open in IMG/M |
| 3300017822|Ga0187802_10442873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 516 | Open in IMG/M |
| 3300017935|Ga0187848_10138504 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1079 | Open in IMG/M |
| 3300017948|Ga0187847_10660606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300017961|Ga0187778_10725754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300017975|Ga0187782_11557452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300018007|Ga0187805_10032983 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2306 | Open in IMG/M |
| 3300018007|Ga0187805_10412951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 627 | Open in IMG/M |
| 3300018034|Ga0187863_10291729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 907 | Open in IMG/M |
| 3300018047|Ga0187859_10181328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1121 | Open in IMG/M |
| 3300018058|Ga0187766_10165742 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1380 | Open in IMG/M |
| 3300018468|Ga0066662_10814321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 908 | Open in IMG/M |
| 3300020150|Ga0187768_1140313 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300020581|Ga0210399_10341151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1251 | Open in IMG/M |
| 3300020582|Ga0210395_11377450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 515 | Open in IMG/M |
| 3300021178|Ga0210408_11255649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300021180|Ga0210396_10139616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2180 | Open in IMG/M |
| 3300021180|Ga0210396_11425640 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300021401|Ga0210393_11371227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 565 | Open in IMG/M |
| 3300021406|Ga0210386_11341490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 601 | Open in IMG/M |
| 3300021420|Ga0210394_10946534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
| 3300021433|Ga0210391_10501776 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 952 | Open in IMG/M |
| 3300021474|Ga0210390_11234733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300021475|Ga0210392_10836452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
| 3300021478|Ga0210402_11730841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 551 | Open in IMG/M |
| 3300021559|Ga0210409_10020596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6414 | Open in IMG/M |
| 3300022731|Ga0224563_1012111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300024227|Ga0228598_1012344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 1697 | Open in IMG/M |
| 3300025320|Ga0209171_10065631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2339 | Open in IMG/M |
| 3300025434|Ga0208690_1044215 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300025915|Ga0207693_10834379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300025929|Ga0207664_10837575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
| 3300025939|Ga0207665_10239227 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1337 | Open in IMG/M |
| 3300026014|Ga0208776_1018464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 588 | Open in IMG/M |
| 3300026304|Ga0209240_1197354 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300026305|Ga0209688_1049773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 790 | Open in IMG/M |
| 3300026514|Ga0257168_1048418 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300026723|Ga0208342_100668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 841 | Open in IMG/M |
| 3300027297|Ga0208241_1012160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1222 | Open in IMG/M |
| 3300027537|Ga0209419_1066338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300027565|Ga0209219_1073672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 847 | Open in IMG/M |
| 3300027604|Ga0208324_1035302 | All Organisms → cellular organisms → Bacteria | 1493 | Open in IMG/M |
| 3300027727|Ga0209328_10143549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300027729|Ga0209248_10039468 | Not Available | 1463 | Open in IMG/M |
| 3300027824|Ga0209040_10531215 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300027842|Ga0209580_10168528 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300027842|Ga0209580_10235566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 910 | Open in IMG/M |
| 3300027842|Ga0209580_10432182 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300027842|Ga0209580_10451812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 640 | Open in IMG/M |
| 3300027867|Ga0209167_10358729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 793 | Open in IMG/M |
| 3300027867|Ga0209167_10456780 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300027879|Ga0209169_10751898 | Not Available | 503 | Open in IMG/M |
| 3300027903|Ga0209488_10338945 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1119 | Open in IMG/M |
| 3300027908|Ga0209006_10071393 | All Organisms → cellular organisms → Bacteria | 3096 | Open in IMG/M |
| 3300027908|Ga0209006_10407537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 1144 | Open in IMG/M |
| 3300027908|Ga0209006_10630626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 883 | Open in IMG/M |
| 3300028552|Ga0302149_1204334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300028906|Ga0308309_11808727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 516 | Open in IMG/M |
| 3300029911|Ga0311361_10178505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2685 | Open in IMG/M |
| 3300029913|Ga0311362_10171626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2571 | Open in IMG/M |
| 3300030494|Ga0310037_10141491 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300031028|Ga0302180_10122628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1466 | Open in IMG/M |
| 3300031573|Ga0310915_10858448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 637 | Open in IMG/M |
| 3300031708|Ga0310686_116499133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300031715|Ga0307476_10275308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1232 | Open in IMG/M |
| 3300031715|Ga0307476_10907369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300031718|Ga0307474_10072140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2564 | Open in IMG/M |
| 3300031718|Ga0307474_10256982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1339 | Open in IMG/M |
| 3300031753|Ga0307477_10921594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300031754|Ga0307475_10425641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1067 | Open in IMG/M |
| 3300031820|Ga0307473_10394381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 905 | Open in IMG/M |
| 3300031823|Ga0307478_10050905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3071 | Open in IMG/M |
| 3300031962|Ga0307479_11539153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300032180|Ga0307471_103927947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300032782|Ga0335082_10150938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2250 | Open in IMG/M |
| 3300032783|Ga0335079_12133503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 536 | Open in IMG/M |
| 3300032897|Ga0335071_10672123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 986 | Open in IMG/M |
| 3300033134|Ga0335073_10517416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1357 | Open in IMG/M |
| 3300033158|Ga0335077_11214704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300033402|Ga0326728_10351907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1297 | Open in IMG/M |
| 3300033402|Ga0326728_10497500 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300034163|Ga0370515_0502898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 511 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.79% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.19% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.19% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.19% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.76% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.60% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.60% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.88% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.88% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.16% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.16% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.16% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.16% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.44% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.44% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.44% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.44% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.72% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.72% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.72% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.72% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.72% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.72% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.72% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.72% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.72% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011411 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ017 MetaG | Host-Associated | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022731 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU4 | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025434 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026014 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026723 | Grasslands soil microbial communities from Chapel Hill, North Carolina, USA that are Nitrogen fertilized - NN357 (SPAdes) | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028552 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4MG_02480060 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | QFPLKRLRFLVSLTNDTNDYQIEQAVAAQEAARRLDVDVRIFGR |
| JGI1027J12803_1078949651 | 3300000955 | Soil | MKRLSFLVSLTNNDNDYQQEQAAAADRAARRFGVEIKIIH |
| JGI12712J15308_102117743 | 3300001471 | Forest Soil | MKKLSFLISLTNNDNDYQQEQAAAAEKAARKLGVDVQ |
| JGI12635J15846_100571741 | 3300001593 | Forest Soil | MKRLTFVVSLTNNDNDYQQEQAVAAEKAARRLGVDVKIIHAGNDALTQSQQ |
| JGI12053J15887_104345791 | 3300001661 | Forest Soil | MKKLSFLISLTNDDNDYQQEQASAAATAARRLDVDIKIIHAGNDAVTQ |
| JGI25616J43925_102749461 | 3300002917 | Grasslands Soil | MKKLSFVVSLTNNDNDYQQEQASAAEKAARRLGVDLKIVHANN |
| Ga0062387_1017823501 | 3300004091 | Bog Forest Soil | MKRLSFLVSLTNNDNDYQQEQAAAAEKAGRRLGVDVKIIHAN |
| Ga0062592_1006987742 | 3300004480 | Soil | MKKPSVLVSLTTKDNDYQQEQAAAAEQTARRLGVDLQILFADNDAI |
| Ga0066672_101122811 | 3300005167 | Soil | MKRLSFLVSLTNNDNDYQQEQAAAAEKAARRLGVDVKIIHANNDAVAQSQQ |
| Ga0066388_1000855985 | 3300005332 | Tropical Forest Soil | MKGVMKKLSFLLSLTNNDNDYQKEQAAAADRAARRLGVDIQIVNAENDSI |
| Ga0066388_1050415713 | 3300005332 | Tropical Forest Soil | MKKLKFVLSLTNNDNDYQLEQATSAEETAQRLGVELQIFSADN |
| Ga0066687_102394963 | 3300005454 | Soil | MKRLSFVVSLTNNDNDYQLEQAAAAEKAARRWGVDVKIIHAGND |
| Ga0070734_107742372 | 3300005533 | Surface Soil | MKRLNFLVSLTNNDNDYQQEQAAAAEKAGRRLGVD |
| Ga0070732_101717323 | 3300005542 | Surface Soil | MKRLSFVVSLTNNDNDYQLEQAAAAEKAARRCGVDVKIIHANNDALAQSQ |
| Ga0070686_1011184062 | 3300005544 | Switchgrass Rhizosphere | MKKPSVLVSLTTKDNDYQQEQAAAAEQTARRLGVDLQILFADNDA |
| Ga0070695_1007641391 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKPSVLVSLTTKDNDYQQEQAAAAEQTSRRLGVDLQILF |
| Ga0066701_104877211 | 3300005552 | Soil | MKKLNFLVSLTTNDNDYQMEQAVDTEAAARRLGVDV |
| Ga0066661_108554911 | 3300005554 | Soil | MKRLSFLVSLTNNDNDYQQEQAAAAEKAGRRLGVDVKIIHASNDALAQSQQL |
| Ga0066699_101382783 | 3300005561 | Soil | MKKPSFLISLTTDANDYQQEQASAATQAAQRLGVDIQILYAENDAI |
| Ga0066654_107472292 | 3300005587 | Soil | MKRLTFVVSLTNNNNDYQQEQAAAAEKAARRLGVELKI |
| Ga0070761_104088841 | 3300005591 | Soil | MKKLSFVVSLTNNENDYQQEQAAAAEKAARRLGVDVKIIQA |
| Ga0070761_109928132 | 3300005591 | Soil | MKKLNFVVSLTNNENDYQQEQAAAAEKAARRLGVDVKII |
| Ga0075029_1011189562 | 3300006052 | Watersheds | MKRLSFLISLTNNDNDYQQEQAAAAEKAGRRLGVD |
| Ga0070712_1009639141 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRLTFVVSLTNDDNDYQQEQAAAEKAGRRLGVNVKIIHANNDALAQSE |
| Ga0070712_1011663332 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRLSFVVSLTNNDNDYQLEQAAAAEKAARRWGVDVKIIHAGNDAL |
| Ga0097621_1016774421 | 3300006237 | Miscanthus Rhizosphere | MKRLSFLVSLTNNDNDYQQEQAAAAEKAARRLGVDVKI |
| Ga0066665_101960221 | 3300006796 | Soil | MKKLRFLVSLTNDENDYQIEQAAAAREAARQLDVDI |
| Ga0066660_108893461 | 3300006800 | Soil | MEKYNFLVSLTNTDNDYQREQETSAKEAARRLGISVQIV |
| Ga0075431_1018838602 | 3300006847 | Populus Rhizosphere | MQKLSFLISLTTGDNDYQLEQAEAAKKSARELGVDLQVIHADND |
| Ga0075425_1016939512 | 3300006854 | Populus Rhizosphere | MKRLSFLVSLTNDDNDYQQEQATAAEKAARRLGVDVKIIH |
| Ga0099830_102060603 | 3300009088 | Vadose Zone Soil | MKKLSFVVSLTNNDNDYQQEQAAAAEKAARRLGVDLKIVHASNDAVT |
| Ga0099828_111014732 | 3300009089 | Vadose Zone Soil | MKKLRFLLSLTNNDNDYQTEQAAAAEAAAHRLGVELQIIHADND |
| Ga0116222_14951032 | 3300009521 | Peatlands Soil | MKRCRIVVSLTNDDNDYQQAQAVAADKAGRRLDAE |
| Ga0116218_10892571 | 3300009522 | Peatlands Soil | MKKLSFLVSLTNNDNDYQQEQAAAAEKAARRLDVGVKIVHANNDAV |
| Ga0116225_14743261 | 3300009524 | Peatlands Soil | MKKLSFLLSLTNDDNDYQQEQAAAAEKAARHLGVDLKIIHA |
| Ga0105237_127447571 | 3300009545 | Corn Rhizosphere | MKRLSFVVSLTNNDNDYQLEQAAAAEKAARRWGVDVKII |
| Ga0116117_11632731 | 3300009635 | Peatland | MKKLSFLISLTNDDNDYQQEQAAAAEKAGRRLGVDVQIIHASND |
| Ga0116224_101750253 | 3300009683 | Peatlands Soil | MAAGVTKRLSFLVSLTNNDNDYQQEQAAAAEKAGRRLGVDVKIIHANNDALVQS |
| Ga0116224_105663522 | 3300009683 | Peatlands Soil | MKRLSFLVSLTNNDNDYQQEQAAVAEKAARRLGVDVTIIQ |
| Ga0116223_108317531 | 3300009839 | Peatlands Soil | MKRLSFLVSLTNDDNDYQQEQAAVAEKAARRLGVEVKIIHANN |
| Ga0134067_103590162 | 3300010321 | Grasslands Soil | MKKPSFLISLTTDANDYQQEQASAATQAAQRLGVDIQILY |
| Ga0126370_113713582 | 3300010358 | Tropical Forest Soil | MIAMREFLFMKHLSFLVSLTNNDNDYQQEQAAAAAKAARRLGVDVQ |
| Ga0126376_122035001 | 3300010359 | Tropical Forest Soil | MKRLSFVVSLTNNDNDYQQEQAAVAEKTARRLGVDVKIVHANNDALVQSQQL |
| Ga0126377_101062841 | 3300010362 | Tropical Forest Soil | MTKLRFLVSLTNNDNDYQIEQAAATEEAARRLGIS |
| Ga0126381_1035915832 | 3300010376 | Tropical Forest Soil | MKRLSFLVSLTTNDNDYQQEQAAAAEKAARRFGVEVKIIHANNDPLTQSQQ |
| Ga0126383_101991193 | 3300010398 | Tropical Forest Soil | MKRLSFLISLTNNDNDYQQEQAALAEKTARRLGVDVKIVHANN |
| Ga0137393_101027411 | 3300011271 | Vadose Zone Soil | MKKLSFVISLTNDDNDYQQEQATAAETAARRLDVDLKIIHAGNDAVTQSQQL |
| Ga0137393_107139351 | 3300011271 | Vadose Zone Soil | VDYDSSKGVVMKRLSFVVSLTNDDNDYQQEQAAAADKAARRLGVDVKI |
| Ga0137393_115349421 | 3300011271 | Vadose Zone Soil | MKKLRFLLSLTNNDNDYQTEQAAAGEAAAHRLGVELQIIHADNDTITQSQQ |
| Ga0153933_10452861 | 3300011411 | Attine Ant Fungus Gardens | MKKLSFLVSLTNNDNDYQQEQAAAAEKTARRLGVDVQI |
| Ga0137377_110277902 | 3300012211 | Vadose Zone Soil | MKRLSFLVSLTNNDNDYQQEQAAAAEKAGRRLGVDVKIIHASNDALAESQQLLH |
| Ga0137386_100896561 | 3300012351 | Vadose Zone Soil | MKKLKFLVSLTNNDNDYQIEQASATNEAAGRLGVAAQ |
| Ga0137361_119378221 | 3300012362 | Vadose Zone Soil | MKRLSFVLSLTNNDNDYQQEQAAAAEKSARRLGVDLKIIHANNDS |
| Ga0181528_102819671 | 3300014167 | Bog | MKRLNFVVSLTNNDNDYQQEQAAVAEKAARRLGVDVKIIH |
| Ga0137412_109946861 | 3300015242 | Vadose Zone Soil | MIGTGEGMKKLSFLVSLTNNSNDYQQEQAAAAEKAAVTS* |
| Ga0182005_10957852 | 3300015265 | Rhizosphere | MKRLSFVVSLTNNDNDYQLEQAAAAEKAARRWGVDVKIIHANNDALA |
| Ga0132256_1000339778 | 3300015372 | Arabidopsis Rhizosphere | MKRLRFLVSLTNDTNDYQIEQAVAAQEAVRRLDVDVQIIAA |
| Ga0182033_105326622 | 3300016319 | Soil | MKRLSFLVSLTNDDNDYQQEQAAAAEKAARRLGVDVKIIHANNDALAQSQQ |
| Ga0187802_104428731 | 3300017822 | Freshwater Sediment | MKRLSFLVSLTNNDNDYQQEQAAAAEKTARRLGVDVKIIHASNDALAQSEQ |
| Ga0187848_101385043 | 3300017935 | Peatland | MKKLSFLISLTNDDNDYQQEQAAAAEKAGRRLGVDVQI |
| Ga0187847_106606061 | 3300017948 | Peatland | MKRLSFLVSLTNDDNDYQQEQAAMAEKAARRMGVD |
| Ga0187778_107257541 | 3300017961 | Tropical Peatland | MKRLNLVLSLTNNDNDYQLEQAATAEDAAKRLGVDLQILYADNDA |
| Ga0187782_115574521 | 3300017975 | Tropical Peatland | MKKIRFLISLTNDDNDYQQEQAAAAKKAARRLDVGIEIIHANNDAVTQSQ |
| Ga0187805_100329835 | 3300018007 | Freshwater Sediment | MKRLSFLVSLTNNDNDYQQEQAAAAEKAARRFGVDVKIV |
| Ga0187805_104129511 | 3300018007 | Freshwater Sediment | MKRLSFLVSLTNNDNDYQQEQAAAAEKAARRLGVEVKIIHANNDAL |
| Ga0187863_102917291 | 3300018034 | Peatland | MKKLSFLVSLTNDDNDYQQEQAAAAEKAVRRLGVDLKIVHANNDAVTQSQQ |
| Ga0187859_101813283 | 3300018047 | Peatland | MKRLSFLVSLTNDDNDYQQEQAAMAEKAARRMGVDVKVIHA |
| Ga0187766_101657423 | 3300018058 | Tropical Peatland | MKKLHLALSLTNKDNDYQLEQAAAAEEAAKRLGVDLQILDAEN |
| Ga0066662_108143211 | 3300018468 | Grasslands Soil | MKKLSFLVSLTNDDNDYQQEQAAAAEKAARRLGVDVKIIHADNDAVGQS |
| Ga0187768_11403132 | 3300020150 | Tropical Peatland | MKKKLTFLVSLTTNDNDYQLEQAAAAEKAGRGAGVTVQVIYAGNDAI |
| Ga0210399_103411512 | 3300020581 | Soil | MIKVGAVMKKLSFLISLTNNDNDYQQEQAAAAEKAARRLGVDLKIVH |
| Ga0210395_113774502 | 3300020582 | Soil | MKKLSFLISLTNDDNDYQQEQASAAEKAARRLGVDFKIIHANND |
| Ga0210408_112556492 | 3300021178 | Soil | MKRLSFVVSLPTNDNDYQQEQAAAAEKAARRLGVDLKIVNAN |
| Ga0210396_101396164 | 3300021180 | Soil | MQRLSFLISLTNDDNDYQQEQAAAAEKTARRLGVDVKIIHASND |
| Ga0210396_114256402 | 3300021180 | Soil | MKKLSFLVSLTNNDNDYQREQAGAAEKAAGRLGVD |
| Ga0210393_113712272 | 3300021401 | Soil | VMKKLSFLVSLTNDDNDYQQEQAAAADKAARRLGVDLKIIHAN |
| Ga0210386_113414902 | 3300021406 | Soil | MKRLSFLVSLTNNDNDYQQEQAAMAEKAGRRLGIDVKIIHA |
| Ga0210394_109465342 | 3300021420 | Soil | MKKLSFLVSLTNDENDYQQEQQAAAEKAARRLGID |
| Ga0210391_105017762 | 3300021433 | Soil | MKKLSFLVSLTNDENDYQQEQQAAAEKAARRLGIDL |
| Ga0210390_112347331 | 3300021474 | Soil | MKKLSFLVSLTNDENDYQQEQQAAAEKAARRLGIDLKIVH |
| Ga0210392_108364522 | 3300021475 | Soil | MKRLRFLVSLTNDDNDYQQEQAAAAEKAGRRLGVDVK |
| Ga0210402_117308411 | 3300021478 | Soil | MKRLSFLVSLTNNDNDYQQEQAAAAEKAARRLGVDVKIIHANNDAV |
| Ga0210409_100205961 | 3300021559 | Soil | MQRLGFLISLTNDDNDYQQEQAAAAEKTARRLGVDVKIIHAS |
| Ga0224563_10121112 | 3300022731 | Soil | MKKLSFLVSLTNDDNDYQQEQAAAAEKAARRLGVDVKIV |
| Ga0228598_10123443 | 3300024227 | Rhizosphere | MKKLSFLVSLTNDDNDYQQEQAAAAEKAARRLGVD |
| Ga0209171_100656316 | 3300025320 | Iron-Sulfur Acid Spring | MKRLSFVVSLTNNDNDYQQEQAAAVEKAARRLGVDVKI |
| Ga0208690_10442152 | 3300025434 | Peatland | MKRLSFLVSLTNDDNDYQQEQAAMAEKAARRMGVDVKVIHANNDALAQ |
| Ga0207693_108343791 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRLTFVVSLTNDDNDYQQEQAAAEKAGRRLGVNVKIIHA |
| Ga0207664_108375752 | 3300025929 | Agricultural Soil | MKRLTFVVSLTNNDNDYQQEQATAAEKAARRLGVDVKIIHANNDALTQ |
| Ga0207665_102392273 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRLSFLVSLTTNDNDYQQEQASAAEKAARRFGVEVKIIHANND |
| Ga0208776_10184642 | 3300026014 | Rice Paddy Soil | MKRLTFVVSLTNNDNDYQQEQAAAAEKAARRLGVDVKIIHADND |
| Ga0209240_11973541 | 3300026304 | Grasslands Soil | MKKLKFLVSLTNNDNDYQIEQASATNEAAGRLGVSAQVIYAG |
| Ga0209688_10497731 | 3300026305 | Soil | MKKFRFLVALTTRDNDYQQEQEAAARETARRLGVDV |
| Ga0257168_10484182 | 3300026514 | Soil | MIGMGEGMKKLSFLVSLTNNDNDYQQEQAAAAEKAARR |
| Ga0208342_1006683 | 3300026723 | Soil | MKRLSFLVSLTNNDNDYQQEQAAAAEKTARRLGVEVKIIHANNDA |
| Ga0208241_10121601 | 3300027297 | Forest Soil | MKKLSFLVSLTNNENDYQQEQQAAAEKAARRLGVELKIV |
| Ga0209419_10663381 | 3300027537 | Forest Soil | MKRLSFVVSLTNNDNDYQQEQAAAAEKAGRRCGVDVK |
| Ga0209219_10736722 | 3300027565 | Forest Soil | MKKLSFLVSLTNNDNDYQQEQASAAEKAARRLGVELNIVHANNDAVTQSQQL |
| Ga0208324_10353022 | 3300027604 | Peatlands Soil | MKKLKFILSLTNNDNDYQTEQAAAAEQAAKRLGVDV |
| Ga0209328_101435491 | 3300027727 | Forest Soil | MIRQEPRVMKKLSFLISLTNDDNDYQQEQATAAETAARRLDVDIKIIHAGNDAVTQS |
| Ga0209248_100394682 | 3300027729 | Bog Forest Soil | MAGMGGLGMKKLSFLVSLMTDKNAYQKDQAAAAKAAATRLGVDVRIFFADSDAVTQ |
| Ga0209040_105312152 | 3300027824 | Bog Forest Soil | MKKLSFLVSLTNNENDYQQEQQAAAEKAARRLGVE |
| Ga0209580_101685281 | 3300027842 | Surface Soil | MKRLNFLVSLTNDDNDYQQEQAAAAEKAARRLGVDVK |
| Ga0209580_102355662 | 3300027842 | Surface Soil | MKKLSFLVSLTNNENDYQQEQAAAAEKAARRLGVDL |
| Ga0209580_104321822 | 3300027842 | Surface Soil | MMRLRSPMKRLTFVVSLTNDDNDYQQEQAAAAEKAGRRL |
| Ga0209580_104518121 | 3300027842 | Surface Soil | MKRLNLLVSLTNNDNDYQQEQAAAAEKAARRLGVDVKIVHANNDPLAQSQQL |
| Ga0209167_103587292 | 3300027867 | Surface Soil | MKKLSFLVSLTNNENDYQQEQAAAAEKAARRLGVDLQIV |
| Ga0209167_104567801 | 3300027867 | Surface Soil | MKKLKFILSLTNNDNDYQLEQAAAAEQAAKRLGVE |
| Ga0209169_107518981 | 3300027879 | Soil | MLEHDYDYGGPRMKKLSFVLSLTNNDNDYQLEQAAAAEKAARRLDADLQIVHANNDAVTQSQQ |
| Ga0209488_103389451 | 3300027903 | Vadose Zone Soil | MKKLSFLVSLTNNDNDYQQEQASAAEKTARRLGVDVKIIHANND |
| Ga0209006_100713935 | 3300027908 | Forest Soil | MKKLSFLISLTNNDNDYQQEQAAAAEKAARKLGVDVQIIHAN |
| Ga0209006_104075371 | 3300027908 | Forest Soil | MKRLSFVVSLTNNDNDYQQEQAAAVEKAARRLGVEVKIIHANNDALAQS |
| Ga0209006_106306262 | 3300027908 | Forest Soil | MKNLSFLVSLTNNDNDYQREQAGAAEKAAGRLGVDVQIVHANND |
| Ga0302149_12043341 | 3300028552 | Bog | MGAGMKKLSFLISLTNDDNDYQQEQAAAAEKAGRRLGVDVQIIHAS |
| Ga0308309_118087271 | 3300028906 | Soil | MKRLSFVVSLTNNDNDYQQEQAAAAKKAGRRSGVDVKLIQ |
| Ga0311361_101785053 | 3300029911 | Bog | MRSFVVSLTTDDNDYQQEQAAAAEIAGRRLGVGIQVIHAG |
| Ga0311362_101716264 | 3300029913 | Bog | MGAGMKKLSFLISLTNDDNDYQQEQAAAAEKAGRRLGVDVQIIH |
| Ga0310037_101414911 | 3300030494 | Peatlands Soil | MKRLSFLVSLTNNDNDYQQEQAAVAEKAARRLGVDVTIIQA |
| Ga0302180_101226281 | 3300031028 | Palsa | MKRLSFLVSLTNDDNDYQQEQAAVAEKAARRLGVDVKVIHANN |
| Ga0310915_108584481 | 3300031573 | Soil | MKRLSFLVSLTNNDNDYQHEQAAAAEKAARRLGVEVKIIHANNDPLVQSQQ |
| Ga0310686_1164991331 | 3300031708 | Soil | MKKLSFLISLTNNDNDYQQEQASAAEKAGRRLGVEIMIVHA |
| Ga0307476_102753083 | 3300031715 | Hardwood Forest Soil | MKKLSFLVSLTNNENDYQQEQAAAAESAARRLGVDIKIIHADN |
| Ga0307476_109073692 | 3300031715 | Hardwood Forest Soil | MKKLSFLISLTNNDNDYQQEQAAAAEKAARKLGVDVQI |
| Ga0307474_100721404 | 3300031718 | Hardwood Forest Soil | MKKLSFLVSLTNNDNDYQQEQAAAAEKAARRLGVDVQVV |
| Ga0307474_102569821 | 3300031718 | Hardwood Forest Soil | MKKLSFLVSLTNNENDYQQEQQAAAEKAARRLGVDLKVVHA |
| Ga0307477_109215942 | 3300031753 | Hardwood Forest Soil | MKKLSFLVSLTNNENDYQQEQAAAAESAARRLGVDIKII |
| Ga0307475_104256412 | 3300031754 | Hardwood Forest Soil | MKKLSFLVSLTNNENDYQQEQAAAAEKAARRLGVGLQI |
| Ga0307473_103943811 | 3300031820 | Hardwood Forest Soil | MKKLSFLVSLTNDDNDYQQEQAMAAETAARRLDVDIKIIHAGNDAVTQSQQL |
| Ga0307478_100509054 | 3300031823 | Hardwood Forest Soil | MKKLSFLVSLTNNENDYQQEQQAAAEKAARRLGVELK |
| Ga0307479_115391532 | 3300031962 | Hardwood Forest Soil | MKRLSFLISLTNDDNDYQQEQATAAEKTARRLGVDVKIIHASNDPLV |
| Ga0307471_1039279471 | 3300032180 | Hardwood Forest Soil | MKRLSFVVSLTNNDNDYQQEQAAAAEKAARRLGVDIKIIHANN |
| Ga0335082_101509381 | 3300032782 | Soil | MKRLSFLVSLTNNDNDYQQEQAAAAEKAARRMGVDVKIIHANNDAL |
| Ga0335079_121335031 | 3300032783 | Soil | MKRLNFLLSLTNNDNDYQQEQAAAAEKTARRLGVDL |
| Ga0335071_106721233 | 3300032897 | Soil | MKRLSFLISLTTNDNDYQQEQAAAAEKAARRLGVEVK |
| Ga0335073_105174163 | 3300033134 | Soil | MKRLKFLVSLTNNDNDYQQEQAAAAEKAGRRLGVDVTIVHANNDALAQSQ |
| Ga0335077_112147041 | 3300033158 | Soil | MKRLRFLVSLTNDDNDYQQEQAAAAEKAARRLGVDVKIIHANNDAVSQSQ |
| Ga0326728_103519073 | 3300033402 | Peat Soil | MKRLSFLVSLTNDDNDYQQEQAAVAEKAARRLGVEVKII |
| Ga0326728_104975002 | 3300033402 | Peat Soil | MKQLHFLLSLTNDDNDYQQEQAAAADKAAHRLGVEVKIIHANND |
| Ga0370515_0502898_3_131 | 3300034163 | Untreated Peat Soil | MIRAGTQMKKLSFVVSLTNNENDYQQEQAAAAEKAARRLGVDV |
| ⦗Top⦘ |