NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F053350

Metagenome / Metatranscriptome Family F053350

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F053350
Family Type Metagenome / Metatranscriptome
Number of Sequences 141
Average Sequence Length 53 residues
Representative Sequence MLTLLDLRERGGRLEPTKLEIDPATAETVREILQRVFVEGDEVLVELAA
Number of Associated Samples 132
Number of Associated Scaffolds 141

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 97.87 %
% of genes from short scaffolds (< 2000 bps) 91.49 %
Associated GOLD sequencing projects 130
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (80.851 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(28.369 % of family members)
Environment Ontology (ENVO) Unclassified
(28.369 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(39.007 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 31.17%    β-sheet: 0.00%    Coil/Unstructured: 68.83%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 141 Family Scaffolds
PF02511Thy1 17.02
PF00144Beta-lactamase 14.89
PF07963N_methyl 7.09
PF00005ABC_tran 7.09
PF00216Bac_DNA_binding 6.38
PF13544Obsolete Pfam Family 2.13
PF03793PASTA 1.42
PF01844HNH 1.42
PF09594GT87 0.71
PF00072Response_reg 0.71
PF13302Acetyltransf_3 0.71
PF00155Aminotran_1_2 0.71
PF07287AtuA 0.71
PF13633Obsolete Pfam Family 0.71

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 141 Family Scaffolds
COG1351Thymidylate synthase ThyX, FAD-dependent familyNucleotide transport and metabolism [F] 17.02
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 14.89
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 14.89
COG2367Beta-lactamase class ADefense mechanisms [V] 14.89
COG0776Bacterial nucleoid DNA-binding protein IHF-alphaReplication, recombination and repair [L] 6.38


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms81.56 %
UnclassifiedrootN/A18.44 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908009|FWIRA_GRAM18401EY2J1Not Available515Open in IMG/M
3300002988|FeGlu_10637766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium → unclassified Microbacterium → Microbacterium sp. 8M666Open in IMG/M
3300003319|soilL2_10065261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1589Open in IMG/M
3300004013|Ga0055465_10002323All Organisms → cellular organisms → Bacteria2823Open in IMG/M
3300004071|Ga0055486_10088798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi686Open in IMG/M
3300004156|Ga0062589_100212750All Organisms → cellular organisms → Bacteria1409Open in IMG/M
3300005045|Ga0071328_157080All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5077Open in IMG/M
3300005176|Ga0066679_10558301All Organisms → cellular organisms → Bacteria → Proteobacteria746Open in IMG/M
3300005332|Ga0066388_104083108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium744Open in IMG/M
3300005353|Ga0070669_100882592All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300005445|Ga0070708_101936672All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300005451|Ga0066681_10150931All Organisms → cellular organisms → Bacteria1366Open in IMG/M
3300005455|Ga0070663_101617465Not Available578Open in IMG/M
3300005456|Ga0070678_100577926All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300005458|Ga0070681_10315526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1473Open in IMG/M
3300005467|Ga0070706_102173522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria501Open in IMG/M
3300005546|Ga0070696_101544554Not Available569Open in IMG/M
3300005549|Ga0070704_101054325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium737Open in IMG/M
3300005560|Ga0066670_10442083All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300005564|Ga0070664_101179782All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300005564|Ga0070664_101839854Not Available574Open in IMG/M
3300005578|Ga0068854_101022148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia733Open in IMG/M
3300005616|Ga0068852_102040707All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300005719|Ga0068861_101992040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia579Open in IMG/M
3300005985|Ga0081539_10175864All Organisms → cellular organisms → Bacteria1008Open in IMG/M
3300006041|Ga0075023_100370275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria611Open in IMG/M
3300006237|Ga0097621_101759246All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300006579|Ga0074054_11746161All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300006603|Ga0074064_11077763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1189Open in IMG/M
3300006791|Ga0066653_10295674All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300006797|Ga0066659_10306494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1214Open in IMG/M
3300009012|Ga0066710_101029580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1271Open in IMG/M
3300009012|Ga0066710_104095198All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300009075|Ga0105090_10981548Not Available515Open in IMG/M
3300009090|Ga0099827_11278929Not Available638Open in IMG/M
3300009094|Ga0111539_12065485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium661Open in IMG/M
3300009098|Ga0105245_11960247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium639Open in IMG/M
3300009167|Ga0113563_12011697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium691Open in IMG/M
3300009873|Ga0131077_10320134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2417Open in IMG/M
3300010036|Ga0126305_10873028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium614Open in IMG/M
3300010039|Ga0126309_10739993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria635Open in IMG/M
3300010044|Ga0126310_11177455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium614Open in IMG/M
3300010047|Ga0126382_11656246Not Available596Open in IMG/M
3300010109|Ga0127497_1004902All Organisms → cellular organisms → Eukaryota741Open in IMG/M
3300010325|Ga0134064_10092099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium987Open in IMG/M
3300010371|Ga0134125_11297342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium795Open in IMG/M
3300010396|Ga0134126_11034774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia918Open in IMG/M
3300010399|Ga0134127_10625526All Organisms → cellular organisms → Bacteria1108Open in IMG/M
3300011412|Ga0137424_1132956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria525Open in IMG/M
3300012356|Ga0137371_10060940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2922Open in IMG/M
3300012357|Ga0137384_10774321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium777Open in IMG/M
3300012359|Ga0137385_10356467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1251Open in IMG/M
3300012527|Ga0136633_1082697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1329Open in IMG/M
3300012914|Ga0157297_10136398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium783Open in IMG/M
3300012916|Ga0157310_10249281Not Available671Open in IMG/M
3300012957|Ga0164303_10888091Not Available623Open in IMG/M
3300012958|Ga0164299_11525298Not Available522Open in IMG/M
3300014488|Ga0182001_10419573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria589Open in IMG/M
3300014497|Ga0182008_10678538Not Available586Open in IMG/M
3300014969|Ga0157376_12247733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium584Open in IMG/M
3300015373|Ga0132257_101455207All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300017944|Ga0187786_10083432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1041Open in IMG/M
3300018027|Ga0184605_10147144All Organisms → cellular organisms → Bacteria1058Open in IMG/M
3300018066|Ga0184617_1169662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium646Open in IMG/M
3300018071|Ga0184618_10380029Not Available600Open in IMG/M
3300018429|Ga0190272_12049383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria608Open in IMG/M
3300018432|Ga0190275_12375511All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria608Open in IMG/M
3300018465|Ga0190269_11638121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria539Open in IMG/M
3300018466|Ga0190268_10076073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1459Open in IMG/M
3300018481|Ga0190271_11073943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria929Open in IMG/M
3300018481|Ga0190271_11841240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium716Open in IMG/M
3300018481|Ga0190271_11883832Not Available709Open in IMG/M
3300018482|Ga0066669_10635430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria938Open in IMG/M
3300018920|Ga0190273_10488740Not Available897Open in IMG/M
3300018920|Ga0190273_11000077All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300019362|Ga0173479_10045955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1408Open in IMG/M
3300019377|Ga0190264_11196596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria631Open in IMG/M
3300019875|Ga0193701_1056855All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium785Open in IMG/M
3300021080|Ga0210382_10143525All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300025327|Ga0209751_11321923All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300025899|Ga0207642_10600076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium685Open in IMG/M
3300025899|Ga0207642_11111862Not Available511Open in IMG/M
3300025901|Ga0207688_10399113Not Available853Open in IMG/M
3300025905|Ga0207685_10022843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2120Open in IMG/M
3300025910|Ga0207684_10334397All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1305Open in IMG/M
3300025936|Ga0207670_10419100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1074Open in IMG/M
3300025937|Ga0207669_10068841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2212Open in IMG/M
3300025938|Ga0207704_11677822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium546Open in IMG/M
3300025951|Ga0210066_1038473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia793Open in IMG/M
3300026009|Ga0208530_1006607All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300026014|Ga0208776_1004180All Organisms → cellular organisms → Bacteria1204Open in IMG/M
3300026062|Ga0208654_1000419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6583Open in IMG/M
3300026142|Ga0207698_11850273Not Available619Open in IMG/M
3300026537|Ga0209157_1082533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1573Open in IMG/M
3300027458|Ga0207602_100938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium921Open in IMG/M
3300028380|Ga0268265_12109748Not Available571Open in IMG/M
3300028587|Ga0247828_10135337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1216Open in IMG/M
3300028597|Ga0247820_11183410Not Available551Open in IMG/M
3300028608|Ga0247819_11038416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia520Open in IMG/M
3300028707|Ga0307291_1084620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium783Open in IMG/M
3300028717|Ga0307298_10225283All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium555Open in IMG/M
3300028720|Ga0307317_10100084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria961Open in IMG/M
3300028722|Ga0307319_10086384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria999Open in IMG/M
3300028778|Ga0307288_10341034Not Available602Open in IMG/M
3300028796|Ga0307287_10177081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria810Open in IMG/M
3300028802|Ga0307503_10473352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium669Open in IMG/M
3300028814|Ga0307302_10407817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria672Open in IMG/M
3300028819|Ga0307296_10616097Not Available594Open in IMG/M
3300028819|Ga0307296_10743254Not Available535Open in IMG/M
3300028828|Ga0307312_11072434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria533Open in IMG/M
3300028872|Ga0307314_10080952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium861Open in IMG/M
3300028872|Ga0307314_10275895Not Available529Open in IMG/M
3300028875|Ga0307289_10386970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium575Open in IMG/M
3300028876|Ga0307286_10357648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium544Open in IMG/M
3300028878|Ga0307278_10163984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria994Open in IMG/M
3300028881|Ga0307277_10419434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria599Open in IMG/M
3300028885|Ga0307304_10101794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1149Open in IMG/M
3300030006|Ga0299907_10964550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria629Open in IMG/M
3300031170|Ga0307498_10271317Not Available623Open in IMG/M
3300031199|Ga0307495_10043425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium890Open in IMG/M
3300031200|Ga0307496_10135043Not Available514Open in IMG/M
3300031226|Ga0307497_10364236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium681Open in IMG/M
3300031562|Ga0310886_10475691All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300031740|Ga0307468_101514526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia622Open in IMG/M
3300031847|Ga0310907_10883936Not Available504Open in IMG/M
3300031965|Ga0326597_10401489All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1523Open in IMG/M
3300032012|Ga0310902_10880820All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria615Open in IMG/M
3300032143|Ga0315292_10648631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium889Open in IMG/M
3300032163|Ga0315281_12215751All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria520Open in IMG/M
3300032177|Ga0315276_10147740All Organisms → cellular organisms → Bacteria2437Open in IMG/M
3300032180|Ga0307471_103162012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia584Open in IMG/M
3300032397|Ga0315287_11897679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium660Open in IMG/M
3300032770|Ga0335085_10315470All Organisms → cellular organisms → Bacteria1846Open in IMG/M
3300033004|Ga0335084_10440057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1341Open in IMG/M
3300033407|Ga0214472_10157643All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2220Open in IMG/M
3300033417|Ga0214471_10358161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1180Open in IMG/M
3300033433|Ga0326726_10125111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2325Open in IMG/M
3300033550|Ga0247829_10105046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2132Open in IMG/M
3300033551|Ga0247830_10650951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia835Open in IMG/M
3300033551|Ga0247830_10807293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium746Open in IMG/M
3300034155|Ga0370498_008324All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2152Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil28.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil6.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.26%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.26%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment2.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.84%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.84%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.13%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.13%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.13%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.13%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.13%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.13%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.13%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.13%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.42%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.42%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.42%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.42%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.71%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.71%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.71%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.71%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.71%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.71%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.71%
Wetland SedimentEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Wetland Sediment0.71%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.71%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.71%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.71%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.71%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.71%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.71%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.71%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.71%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.71%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.71%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.71%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.71%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.71%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.71%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.71%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.71%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.71%
WastewaterEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater0.71%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908009Soil microbial communities from sample at FACE Site Metagenome WIR_Amb2EnvironmentalOpen in IMG/M
3300002988Fe-reducing enrichment culture from wetland sample 1EnvironmentalOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300004013Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2EnvironmentalOpen in IMG/M
3300004071Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005045Permafrost microbial communities from Fox Tunnel, Fairbanks, Alaska, USAEnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006603Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009075Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009873Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plantEngineeredOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010109Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011412Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2EnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012527Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ83 (22.06)EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300014488Bulk soil microbial communities from Mexico - San Felipe (SF) metaGEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019875Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300025327Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025951Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026009Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401 (SPAdes)EnvironmentalOpen in IMG/M
3300026014Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 (SPAdes)EnvironmentalOpen in IMG/M
3300026062Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300027458Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE17-B (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028608Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6EnvironmentalOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031200Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033407Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175EnvironmentalOpen in IMG/M
3300033417Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034155Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FWIRA_061471302124908009SoilMLRILDLRERGERLEATRFEIDPTVTETVSGILQRVFVEGDDILVELAQRFDGADLSETGILVTD
FeGlu_1063776623300002988Wetland SedimentVLEFLDLRERGERLEATRLEIDPTVADTVTRILQRVFVEGDEVLIE
soilL2_1006526133300003319Sugarcane Root And Bulk SoilVLELLDLRERGERLEAVRPEIDPTVSETVQRILQRVFVEGDDVLIEFAQRFDDADL
Ga0055465_1000232353300004013Natural And Restored WetlandsMLELLDLRERGERLDATRLETDPTVADTVAGILQRVFVEGDDVLIELAHRFDGADLGDGGVLV
Ga0055486_1008879833300004071Natural And Restored WetlandsVLEFLDLRERGERLEATRLEIDPTVADTVTRILQRVFVEGDEVLIELALRF
Ga0062589_10021275013300004156SoilMLTLLDLRERGGRLEPTKLEIDPATAETVREILQRVFVEGDEVLVELAAKFDGVELPEGG
Ga0071328_15708053300005045PermafrostVLELLDLRERGERLEAIRPEIDPTVFETVQSILQRVFVEGDEVLIELAQRFD
Ga0066679_1055830113300005176SoilMLELLDLRERGGRLEPSKLEIDPGTTETVRQILQRVFVEGDDVLIELSKQFDGADLSRSGIL
Ga0066388_10408310833300005332Tropical Forest SoilMLELLDLRERGGRLEPSKLEIDPATTETVREILQRVFVEG
Ga0070669_10088259223300005353Switchgrass RhizosphereMLALLDLRERGGRLEPTKLEIDPATAETVRQILQRVFVEGDEVLIELAVKFDGVDLSGCGVLVSEDE
Ga0070708_10193667213300005445Corn, Switchgrass And Miscanthus RhizosphereVLELLDLRERGERLEPNRLEIDPTVAETVRAILQRVFVEGDEVLIELCRRFDGA
Ga0066681_1015093133300005451SoilMLELLDLRERGGRLEPSKLEIDPATTETVRQILQRVFVEGDDVLIELSKQFDGADLS
Ga0070663_10161746533300005455Corn RhizosphereMLALLDLRERGGRLEPTKLEIDPATAETVREILQRVFVEGDEVLIELAVQFDGVDLSGRGVLVT
Ga0070678_10057792613300005456Miscanthus RhizosphereVLGLLDLRERGERLEPSRFESDPTVTETVRGILQRVREQGDP
Ga0070681_1031552643300005458Corn RhizosphereMLTLLDLRERGGRLEPTKLEIDPATAETVREILQRVFVEGDEVLVELAAKFD
Ga0070706_10217352213300005467Corn, Switchgrass And Miscanthus RhizosphereVLELLDLRERGERLEAVRPEIDPTVSETVQRILQRVFVEGDEVLVE
Ga0070696_10154455413300005546Corn, Switchgrass And Miscanthus RhizosphereVLGLLDLRERGERLEPSRFESDPTVTETVRGILQRVRDQGDPVLIELARRFDGADLSS
Ga0070704_10105432513300005549Corn, Switchgrass And Miscanthus RhizosphereMLTLLDLRERGGRLEPTKLEIDPATAETVREILQRVFVEGDEVLVALA
Ga0066670_1044208313300005560SoilMLELLDLRERGGRLEPSKLEIDPATTETVRQILQRVFVEGDDVLIELSKQFDGADLSRSGILVTEREFAH
Ga0070664_10117978213300005564Corn RhizosphereMLELLDLRERGERLEPTAFEIDPTVADTVRDILARVRADGDAALLELAE
Ga0070664_10183985413300005564Corn RhizosphereVLGLLDLRERGERLEPSRFESDPTVTETVRGILQRVREQGDPVL
Ga0068854_10102214833300005578Corn RhizosphereMLTLLDLRERGGRLEPTKLEIDPATAETVREILQRVFVEGDEVLVELAA
Ga0068852_10204070713300005616Corn RhizosphereMLELLDLRERGGRLEPSKLEIDPATTEIVRQILQRVFVEGDDVLVELSKLFDGADLSRSG
Ga0068861_10199204033300005719Switchgrass RhizosphereMLTLLDLRERGGRLEPTKLEIDPATAETVREILQRVFVEGDEVL
Ga0081539_1017586413300005985Tabebuia Heterophylla RhizosphereMLTTLDLRERGGRLEPTKLEIDPATAETVREILQRVFVEGDEVLIELAAKFDGVDLSDAGILV
Ga0075023_10037027523300006041WatershedsMLGLLDLRERGERLEPLRFEPDPTVIETVSGILQRVRTEERA*
Ga0097621_10175924633300006237Miscanthus RhizosphereMLTLLDLRERGGRLEPTKLEIDPATAETVREILQRVFVEG
Ga0074054_1174616133300006579SoilMLEFLDLRERGERLEPTRLETDPTVAESVSGILQRVFVEGDDVLVELCHRFDGADLGETGILV
Ga0074064_1107776313300006603SoilMLELLDLRERGGRLEPSKLEIDPATTETVRSILQSVFIEGDD
Ga0066653_1029567413300006791SoilMLGLLDLRERGGRLEPSKLEIDPATTEIVRQILQRVFVEGDDVLVELSKLFDGADLSRSGILVTEREFAHA
Ga0066659_1030649413300006797SoilMLELLDLRERGGRLEPSKLEIDPAITETVRQILQRV
Ga0066710_10102958033300009012Grasslands SoilMLELLDLRERGGRLEPSKLEIDPATTETVRQILQRVFVEGDDVLVELSKLFDGADLARSGILVTEREFAHAERETPAE
Ga0066710_10409519813300009012Grasslands SoilVLELLDLRERGERLESNRLEIDPTVVETGRAIPQRVFVEGDEVPIE
Ga0105090_1098154813300009075Freshwater SedimentMLEVLDLRERGGRLEPSRLEIDPATSETVRSILQRVFVEGDDVLVELAQRFDGADLSGGVLVTDEEF
Ga0099827_1127892933300009090Vadose Zone SoilMLEVLDLRERGERLEPTRLEIDPTVSETVRGILQRVFVEGDDVLVEL
Ga0111539_1206548513300009094Populus RhizosphereMLELLDLRERGGRLEPSKLEIDPATTETVREILQRVFVEGDEVLVELSKQFDGADLSRS
Ga0105245_1196024733300009098Miscanthus RhizosphereMLELLDLRERGGRLEPSKLEIDPATTEIVRQILQRVFVEGDDVLVELSKLFDGADLSRSGILVTEREFAHAERETP
Ga0113563_1201169713300009167Freshwater WetlandsMLEVLDLRERGGRLEPSRLEIDPATSETVRSILQRVFVEGDDVLV
Ga0131077_1032013453300009873WastewaterMLRLLDLRERGERLQPSKLDTDPTVAETVREILQRVFVEGDAVMVELAQRFDGADLSGGL
Ga0126305_1087302813300010036Serpentine SoilMIALLDLRKRGGRLEPTRLEIDPATAETVRQILQRVFVE
Ga0126309_1073999313300010039Serpentine SoilMLELLDLRERGERLEAVRPEIDPTVSETVQRILQRVFVEGDDVLLELAHRFDGAH
Ga0126310_1117745533300010044Serpentine SoilMIALLDLRKRGGRLEPTRLEIDPATAETVRQILQRVFVEGDEVLIELAAQFDKVDLS
Ga0126382_1165624613300010047Tropical Forest SoilMLTLLDLRERGGRLEPTKLEIDPATAETVREILQRVFVEGDEVLVELAVEFDKA
Ga0127497_100490213300010109Grasslands SoilMLELLDLRERGEQRLEPSRFESDPSVIGTVREIIERVRTDGDRVLVELARHFDGADLAP
Ga0134064_1009209933300010325Grasslands SoilMLELLDLRERGGRLEPSKLEIDPATTETVREILQRVFVEGDDVLIEVEE*
Ga0134125_1129734213300010371Terrestrial SoilMLELLDLRERGGRLEPSKLEIDPATTEIVRQILQRV
Ga0134126_1103477413300010396Terrestrial SoilMLTLLDLRERGGRLEPTKLEIDPATAETVRDILQRVFVEGDEVLISL
Ga0134127_1062552613300010399Terrestrial SoilVLGLLDLRERGERLEPSRFESDPTVTETVRGILHRVRNQGDPVLIELAQRFDGADLA
Ga0137424_113295613300011412SoilVLELLDLRERGERLEAVRPEIDPTVSETVQRILQRVFVEGDEVLVELAQRFDDADLSEIGLMVRREE
Ga0137371_1006094013300012356Vadose Zone SoilMLELLDLRERGGRLEPSKLEIDPATTETVRQILQRVFVEGDDV
Ga0137384_1077432133300012357Vadose Zone SoilMLELLDLRERGGRLEPSKLEIDPATTETVRQILQRVFV
Ga0137385_1035646713300012359Vadose Zone SoilMLELLDLRERGGRLEPSKLEIDPATTETVRQILQRVFVEGDDVLVELSKQFDGADLARSDILVTER
Ga0136633_108269733300012527Polar Desert SandMLELLDLRERGERLEAIRPEIDPTVFETVQRILQRVFVEGDEV
Ga0157297_1013639833300012914SoilMLALLDLRERGGRLEPTKLEIDPATAETVREILQRVFVEG
Ga0157310_1024928133300012916SoilVLQFLDLRERGERLEATRLETDPTVADTVTGILQRVFVE
Ga0164303_1088809113300012957SoilMLTLLDLRERGGRLEPTKLEIDPATAETVREILQRVFVEGDEVLIALASEFDHADL
Ga0164299_1152529813300012958SoilMLTLLDLRERGGRLEPTKLVIDPATAETVREILQRVFVEGDEVLIA
Ga0182001_1041957313300014488SoilMLELLDLRERGERLEAVRPEIDPTVSETVQRILQRVFVEGDDVLLELAHR
Ga0182008_1067853813300014497RhizosphereMLTLLDLRERGGRLEPTKLEIDPATAETVREILQRVFVEGDEVLVELAAEFDKADLSGTG
Ga0157376_1224773333300014969Miscanthus RhizosphereVLQFLDLRERGERLEATRLETDPTVADTVTGILQRVFVEGDDVL
Ga0132257_10145520733300015373Arabidopsis RhizosphereVLGLLDLRERGERLEPSRFESDPTVTETVRGIIERVRAEGDAVLVELAERF
Ga0187786_1008343233300017944Tropical PeatlandMLELLDLRERGGRLEPSKLEIDPATTETVRSILQSVFIEGDDVLI
Ga0184605_1014714413300018027Groundwater SedimentVLGLLDLRERGERLEPSRFESDPTVIGTVRQILERVRAEGDLVLIELARE
Ga0184617_116966233300018066Groundwater SedimentMLELLDLRERGGRLEPSKLEIDPATTEIVRQILQRVFVEGDDVLVELSKLFDGADLSRSGILVT
Ga0184618_1038002933300018071Groundwater SedimentVLGLLDLRERGERLEPSRFESDPTVTETVRGILQRVREQGDPVLIELAARF
Ga0190272_1204938313300018429SoilMLELLDLRERGGRLEPSKLEIDPAVSETVRSILQRVFVEGDDVL
Ga0190275_1237551133300018432SoilVLELLDLRERGERLEAIRPEIDPTVFETVQRILQRVFVEGDEVLVELAQRFDDADLSDIGLMVRREEFAVAEHETP
Ga0190269_1163812133300018465SoilVLELLDLRERGERLEAIRPEIDPTVFETVQRILQRVFVEGDEVLIELAQRFDDADLTRTG
Ga0190268_1007607313300018466SoilMLELLDLRERGERLDATRLETDPTVADTVAGILQRVFVEGDEVLIELAHRFDGADL
Ga0190271_1107394313300018481SoilVLELLDLRERGERLEAVRPEIDPTVSETVQRILQRVFVEGDEVLVELAQRFDDADLSEIGLMVRREEF
Ga0190271_1184124033300018481SoilMLELLDLRERGGRLEPSRFETDPAVTEAVREILRR
Ga0190271_1188383233300018481SoilMLELLDLRKRGERLDATRLETDPTVADTVAGILQRVFVEGDDVLIELA
Ga0066669_1063543033300018482Grasslands SoilVLELLDLRERGERLESNRLEIDPTVVETVRAILQRVFVE
Ga0190273_1048874013300018920SoilMLELLDLRKRGERLDATRLETDPTVADTVAGILQRVFVEGDEVLIELAHRFDGAE
Ga0190273_1100007713300018920SoilMLELLDLRERGGRLEPSRFETDPAVTEAVREILRRVFVEGDEVLI
Ga0173479_1004595543300019362SoilMLTLLDLRERGGRLEPTKLEIDPATAETVREILQRVFVEGDEVLVAL
Ga0190264_1119659633300019377SoilVLELLDLRERGERLEAGRPEIDPTVFETVQRILQRVFVEGDEVLIELAQRFDDADLTRTGLMVRREEFAV
Ga0193701_105685533300019875SoilMLELLDLRERGGRLEPSKLEIDPATTEIVRQILQRVFVEGDDVLVELSKLFDGADLSRSGILVTEREFAHAE
Ga0210382_1014352543300021080Groundwater SedimentVLGLLDLRERGERLEPSRFESDPTVTDTVRGILQRVREQGDPV
Ga0209751_1132192333300025327SoilMLELLDLRERGGRLEGSKLEFDPAISETVRGILQRVFVEGDDVLVEL
Ga0207642_1060007633300025899Miscanthus RhizosphereMLTLLDLRERGGRLEPTKLEIDPATAETVREILQRVFVEGD
Ga0207642_1111186213300025899Miscanthus RhizosphereMLTLLDLRERGGRLEPTKLEIDPATAETVREILQRVFVEGDEVLVELAAKFDGIELPEGGIL
Ga0207688_1039911313300025901Corn, Switchgrass And Miscanthus RhizosphereVLQFLDLRERGERLEATRLETDPTVADTVTGILQRVFVEGDDVLIELAHRFDGC
Ga0207685_1002284343300025905Corn, Switchgrass And Miscanthus RhizosphereMLTLLDLRERGGRLEPTKLEIDPATAETVREILQRVFV
Ga0207684_1033439733300025910Corn, Switchgrass And Miscanthus RhizosphereMLELLDLRERGGRLEPSKLEIDPATTETVREILQRVFVEGDDVLIELSKQFDGADLSRTGILVTE
Ga0207670_1041910033300025936Switchgrass RhizosphereMLALLDLRERGGRLEPSKLEIDPATTETVRQILQRVFVEGDEVLIELSKQFDGADL
Ga0207669_1006884113300025937Miscanthus RhizosphereMLTLLDLRERGGRLEPTKLEIDPATAETVREILQRVFVEGDEVLVELAAKFDG
Ga0207704_1167782213300025938Miscanthus RhizosphereMLELLDLRERGGRLEPSKLEIDPATTEIVRQILQRVFVEGDDVLVELSKLFDGADLSRSGILVTEREFAHAER
Ga0210066_103847313300025951Natural And Restored WetlandsVLEFLDLRERGERLEATRLEIDPTVADTVTRILQRV
Ga0208530_100660713300026009Rice Paddy SoilVLGLLDLRERGERLEPSRFEIDPTVTDTVRGILADVRDGGDRVLAELALRFDGADLSASGLVV
Ga0208776_100418043300026014Rice Paddy SoilVLGLLDLRERGERLEPSRFEIDPTVTDTVRGILADVRDGGDRVLAELALRFDG
Ga0208654_100041973300026062Natural And Restored WetlandsMLELLDLRERGERLDATRLETDPTVADTVAGILQRVFV
Ga0207698_1185027313300026142Corn RhizosphereMLTLLDLRERGGRLEPTKLEIDPATAETVREILQRVFVEGDEVLVALAAEFD
Ga0209157_108253313300026537SoilMLELLDLRERGGRLEPSKLEIDPATTETVRQILQR
Ga0207602_10093833300027458SoilMLELLDLRERGGRLEPSKLEIDPATTEIVRQILQRVFVEGDDVLIELSKLFDGADLSRSGILVTEREFAHAERETP
Ga0268265_1210974833300028380Switchgrass RhizosphereVLGLLDLREREKRLEPSRFESDPTVTETVRGILQRVREQGDPVLIELAERFDG
Ga0247828_1013533713300028587SoilMLTLLDLRERGGRLEPTKLEIDPATAETVREILQRVFVEGDEVLVALAAEFDKADLSETG
Ga0247820_1118341033300028597SoilMLTLLDLRERGGRLEPTKLEIDPATAETVREILQRVFVEGDEVLVALAAEFDKADL
Ga0247819_1103841613300028608SoilVLQFLDLRERGERLEATRLETDPTVADTVTGILQRVFVEGDDVLIELAHRFDG
Ga0307291_108462033300028707SoilMLELLDLRERGGRLEPSKLEIDPATTEIVRQILQRVFVE
Ga0307298_1022528313300028717SoilMLELLDLRERGERLEPTAFEIDPTVADTVRDILARVRAEGDAVLLELAERFD
Ga0307317_1010008433300028720SoilVLELLDLRERGERLEAIRPEIDPTVFETVQRILQRVFVEGDEVLIE
Ga0307319_1008638433300028722SoilVLELLDLRERGERLEAIRPEIDPTVFETVQSILQRVFV
Ga0307288_1034103413300028778SoilMLTLLDLRERGGRLEPTKLEIDPATAETVRDILQRVFVEGDEVLISLASEFDHADLTDTGILVDDEAYARAERET
Ga0307287_1017708113300028796SoilVLELLDLRERGERLEAIRPEIDPTVFETVQGILQRVFVEGDEVLIELAHRFDDADLSDAGLLVRR
Ga0307503_1047335213300028802SoilMLSLLDLRERGGRLEPTKLEIDPATAETVREILQRVFVEGDEVL
Ga0307302_1040781733300028814SoilVLELLDLRERGERLEAIRPEIDPTVFETVQGILQRVFVEGDEVLIELAHRFDDADLSDAG
Ga0307296_1061609713300028819SoilVLGLLDLRERGERLEPSRFESDPSVIGTVREILERVRTDGDDVLVEL
Ga0307296_1074325413300028819SoilMLELLDLRERGGRLEPSKLEIDPATTRAVREILQRVFVEGDDVLIELAARFDGADLSKQGVLVTDRELARGGEDTPGPLK
Ga0307312_1107243413300028828SoilMFELLDLRERGERLEPTHPEVDLGVAERVREILVRVRSEG
Ga0307314_1008095213300028872SoilMLALLDLRERGGRLEPTKLEIDPATAETVREILQRVFVEGDEVLIELAVKFDGVDLSGQGVLVTEE
Ga0307314_1027589533300028872SoilMLTLLDLRERGGRLEPTKLEIDPATAETVRDILQRVFVEGDEVLISLASEF
Ga0307289_1038697033300028875SoilVLQFLDLRERGERLEATRLETDPTVADTVTGILQRVFVEGDDVLI
Ga0307286_1035764833300028876SoilVLQFLDLRERGERLEATRLETDPTVADTVTGILQRVFVEGDDVLIELAHRFDGCDISETGVLVTEAE
Ga0307278_1016398413300028878SoilVLELLDLRERGERLEPNRLEIDPTVAETVRAILQRVFVEGDEVLIELCRRFDGAN
Ga0307277_1041943413300028881SoilMLELLDLRERGERLGPTAFEIDPTVADTVRDILARVRIQGDAVLLELAERFDGAH
Ga0307304_1010179433300028885SoilMLALLDLRERGGRLEPTKLEIDPATAETVREILQRVF
Ga0299907_1096455033300030006SoilMLELLDLRERGERLEAIRPEIDPTVSETVQRILQRVFVEGDEVLIELAQRFDDADLTVS
Ga0307498_1027131713300031170SoilMLALLDLRERGGRLEPTKLEIDPATAETVREILQRVFVEGDEVLIELAAQFDGVDLTGRGILVTDKEFAA
Ga0307495_1004342513300031199SoilMLELLDLRERGGRLEPSKLEIDPATTEIVRQILQRVFVEGDDVLVELSKLF
Ga0307496_1013504313300031200SoilMLALLDLRERGGRLEPTKLEIDPATAETVREILQRVFVEGDEVLIELAVKFDGVDLSGCGVLVGEEEFAAAD
Ga0307497_1036423613300031226SoilMLELLDLRERGGRLEPSKLEIDPATTEIVRQILQRVFVEGDDVLVELSKLFDGADLSRSGILVTEREFAHAERE
Ga0310886_1047569133300031562SoilVLGLLDLRERGERLEPSRFESDPTVTETVRGILQRVREQGDPVLIELA
Ga0307468_10151452613300031740Hardwood Forest SoilMLTLLDLRERGGRLEPTKLEIDPATAETVRDILQRV
Ga0310907_1088393623300031847SoilVLEFLDLRERGERLEATRLEIDPTVADTVTGILQRVFVEGDEVLIELALRFDGADLGEILVTDE
Ga0326597_1040148913300031965SoilMLGLLDLRERGERLEPSRFEVDPTVTETVRAILERVRVEGDP
Ga0310902_1088082013300032012SoilVLELLDLRERGERLEAVRPEIDPTVSETVQRILQRVFVEGDEVLIELAHRFDDADLAETGLM
Ga0315292_1064863113300032143SedimentVLGLLDLRERGERLEPSRFEVDPTVTETVCAILERVRAKGDPVLVELAARFDGADLSPDGLVAT
Ga0315281_1221575133300032163SedimentMLELLDLRERGGRLEPSKLEIDPAVAETVRGILQRVF
Ga0315276_1014774013300032177SedimentMLELLDLRERGGRLEPSRLEIDPATSETVRSILQRVFVEGDDVLVELAQRFDGADLSDTGVLVTD
Ga0307471_10316201213300032180Hardwood Forest SoilMLTLLDLRERGGRLEPSKLEIDPATTEIVRQILQRVFVEGDDVL
Ga0315287_1189767913300032397SedimentMLALLDLRERGGRLEPSRLEIDPATSETVRSILQRVFVEGDDVL
Ga0335085_1031547033300032770SoilMLELLDLRERGGRLEPSKLEIDPATTETVRSILQSVFIEGDEVLIELAKQFDGADLSER
Ga0335084_1044005733300033004SoilVLELLDLRERGERLEPSRFEADPTATETVRGILERVRLGKERA
Ga0214472_1015764333300033407SoilMNAPTRPKGPDVLELLDLRERGERLEAVRPEIDPTVSETVQRILQRVFVEGDEVLVELAQRFDDANLSEVGLMVRREEFTV
Ga0214471_1035816113300033417SoilMLELLDLRERGGRLESAKLEIDPVIAETVRGILQRVFV
Ga0326726_1012511113300033433Peat SoilMLEFLDLRERGERLEATRLETDPTVAESVSGILQRVFVEGDDVLVELCHRF
Ga0247829_1010504613300033550SoilMLTLLDLRERGGRLEPTKLEIDPATAETVREILQRVFVEGDEVLVALAAE
Ga0247830_1065095133300033551SoilVLEFLDLRERGERLEATRLEIDPTVADTVTGILQRVFVEGDEVLIELALRFDGADLGEIGPVE
Ga0247830_1080729313300033551SoilMLDVLDLRERGGRLEPTKLEIDPATTETVRDILQRVFVEGDEVLLALCAEFDKATVGEVL
Ga0370498_008324_1999_21513300034155Untreated Peat SoilMLGLLDLRERGERLEPSRFESDPTVTDTVRGILQRVRDEGDAVLVDLAERF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.