| Basic Information | |
|---|---|
| Family ID | F053280 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 141 |
| Average Sequence Length | 47 residues |
| Representative Sequence | VEKQIMQQAPWAPWSNRVFPEFFSKKMGCIHIQRLYGIDLARLCRK |
| Number of Associated Samples | 124 |
| Number of Associated Scaffolds | 141 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.55 % |
| % of genes near scaffold ends (potentially truncated) | 95.74 % |
| % of genes from short scaffolds (< 2000 bps) | 96.45 % |
| Associated GOLD sequencing projects | 122 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.15 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.050 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (18.440 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.241 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.284 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.78% β-sheet: 0.00% Coil/Unstructured: 66.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 141 Family Scaffolds |
|---|---|---|
| PF12911 | OppC_N | 91.49 |
| PF00005 | ABC_tran | 2.13 |
| PF00528 | BPD_transp_1 | 2.13 |
| PF00496 | SBP_bac_5 | 2.13 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.05 % |
| Unclassified | root | N/A | 26.95 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459015|G14TP7Y01AJR86 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 551 | Open in IMG/M |
| 3300000891|JGI10214J12806_11075696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 2073 | Open in IMG/M |
| 3300000953|JGI11615J12901_10081109 | Not Available | 586 | Open in IMG/M |
| 3300000956|JGI10216J12902_104608767 | Not Available | 634 | Open in IMG/M |
| 3300000956|JGI10216J12902_107269423 | Not Available | 554 | Open in IMG/M |
| 3300000956|JGI10216J12902_112301216 | Not Available | 1283 | Open in IMG/M |
| 3300000956|JGI10216J12902_123761765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 582 | Open in IMG/M |
| 3300002568|C688J35102_118630746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 579 | Open in IMG/M |
| 3300004156|Ga0062589_100576301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 970 | Open in IMG/M |
| 3300004157|Ga0062590_101513087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 674 | Open in IMG/M |
| 3300004463|Ga0063356_102647205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 771 | Open in IMG/M |
| 3300004480|Ga0062592_101051363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 749 | Open in IMG/M |
| 3300005093|Ga0062594_102491026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 568 | Open in IMG/M |
| 3300005172|Ga0066683_10421120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 823 | Open in IMG/M |
| 3300005176|Ga0066679_10343293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 975 | Open in IMG/M |
| 3300005181|Ga0066678_10636340 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300005184|Ga0066671_10696646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 657 | Open in IMG/M |
| 3300005294|Ga0065705_11012297 | Not Available | 544 | Open in IMG/M |
| 3300005329|Ga0070683_100418692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1278 | Open in IMG/M |
| 3300005330|Ga0070690_100511857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 900 | Open in IMG/M |
| 3300005330|Ga0070690_100604653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 833 | Open in IMG/M |
| 3300005336|Ga0070680_101344234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 618 | Open in IMG/M |
| 3300005341|Ga0070691_10270898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 917 | Open in IMG/M |
| 3300005526|Ga0073909_10650584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 524 | Open in IMG/M |
| 3300005556|Ga0066707_10539473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 754 | Open in IMG/M |
| 3300005560|Ga0066670_10368016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 877 | Open in IMG/M |
| 3300005566|Ga0066693_10225359 | Not Available | 737 | Open in IMG/M |
| 3300005566|Ga0066693_10313765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 628 | Open in IMG/M |
| 3300005569|Ga0066705_10511412 | Not Available | 751 | Open in IMG/M |
| 3300005614|Ga0068856_100651792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1073 | Open in IMG/M |
| 3300005618|Ga0068864_101592856 | Not Available | 657 | Open in IMG/M |
| 3300005713|Ga0066905_100236698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 1393 | Open in IMG/M |
| 3300005719|Ga0068861_101669530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 629 | Open in IMG/M |
| 3300005764|Ga0066903_100549530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1980 | Open in IMG/M |
| 3300005764|Ga0066903_102828841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 941 | Open in IMG/M |
| 3300006034|Ga0066656_10806509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 601 | Open in IMG/M |
| 3300006046|Ga0066652_100923882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 832 | Open in IMG/M |
| 3300006046|Ga0066652_100975696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 805 | Open in IMG/M |
| 3300006048|Ga0075363_100996952 | Not Available | 516 | Open in IMG/M |
| 3300006575|Ga0074053_11924101 | Not Available | 559 | Open in IMG/M |
| 3300006806|Ga0079220_10517659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 821 | Open in IMG/M |
| 3300006806|Ga0079220_12125453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 503 | Open in IMG/M |
| 3300006852|Ga0075433_10102626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2533 | Open in IMG/M |
| 3300006954|Ga0079219_11229913 | Not Available | 652 | Open in IMG/M |
| 3300009012|Ga0066710_100562844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1726 | Open in IMG/M |
| 3300009098|Ga0105245_10425644 | Not Available | 1331 | Open in IMG/M |
| 3300009101|Ga0105247_10934787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 672 | Open in IMG/M |
| 3300009553|Ga0105249_12198859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 624 | Open in IMG/M |
| 3300010044|Ga0126310_10041962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2486 | Open in IMG/M |
| 3300010047|Ga0126382_11459779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 627 | Open in IMG/M |
| 3300010147|Ga0126319_1212339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 628 | Open in IMG/M |
| 3300010147|Ga0126319_1492756 | All Organisms → cellular organisms → Bacteria | 2784 | Open in IMG/M |
| 3300010322|Ga0134084_10454432 | Not Available | 511 | Open in IMG/M |
| 3300010326|Ga0134065_10318772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 601 | Open in IMG/M |
| 3300010336|Ga0134071_10557238 | Not Available | 596 | Open in IMG/M |
| 3300010362|Ga0126377_10116472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2462 | Open in IMG/M |
| 3300010364|Ga0134066_10219005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 642 | Open in IMG/M |
| 3300010366|Ga0126379_10564935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1219 | Open in IMG/M |
| 3300010366|Ga0126379_12583298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 606 | Open in IMG/M |
| 3300010398|Ga0126383_10417683 | Not Available | 1382 | Open in IMG/M |
| 3300010999|Ga0138505_100050537 | Not Available | 599 | Open in IMG/M |
| 3300011106|Ga0151489_1166641 | Not Available | 694 | Open in IMG/M |
| 3300011119|Ga0105246_10236500 | Not Available | 1441 | Open in IMG/M |
| 3300012014|Ga0120159_1117393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 749 | Open in IMG/M |
| 3300012200|Ga0137382_10818232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 671 | Open in IMG/M |
| 3300012200|Ga0137382_11077225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 575 | Open in IMG/M |
| 3300012200|Ga0137382_11083601 | Not Available | 573 | Open in IMG/M |
| 3300012285|Ga0137370_10847834 | Not Available | 566 | Open in IMG/M |
| 3300012349|Ga0137387_10628462 | Not Available | 778 | Open in IMG/M |
| 3300012354|Ga0137366_11004304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 580 | Open in IMG/M |
| 3300012378|Ga0134025_1183911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 644 | Open in IMG/M |
| 3300012390|Ga0134054_1202903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1656 | Open in IMG/M |
| 3300012400|Ga0134048_1115334 | Not Available | 587 | Open in IMG/M |
| 3300012409|Ga0134045_1275874 | Not Available | 511 | Open in IMG/M |
| 3300012506|Ga0157324_1027446 | Not Available | 623 | Open in IMG/M |
| 3300012896|Ga0157303_10121828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 662 | Open in IMG/M |
| 3300012907|Ga0157283_10364979 | Not Available | 525 | Open in IMG/M |
| 3300012951|Ga0164300_11065554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 525 | Open in IMG/M |
| 3300012957|Ga0164303_11108820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 572 | Open in IMG/M |
| 3300012957|Ga0164303_11448852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300012971|Ga0126369_10375683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. | 1452 | Open in IMG/M |
| 3300012972|Ga0134077_10577773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 506 | Open in IMG/M |
| 3300012977|Ga0134087_10176331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 945 | Open in IMG/M |
| 3300012984|Ga0164309_10437046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 986 | Open in IMG/M |
| 3300012986|Ga0164304_11059444 | Not Available | 646 | Open in IMG/M |
| 3300014497|Ga0182008_10480146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 680 | Open in IMG/M |
| 3300014968|Ga0157379_10663256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 977 | Open in IMG/M |
| 3300015359|Ga0134085_10485066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 564 | Open in IMG/M |
| 3300015372|Ga0132256_100816258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1049 | Open in IMG/M |
| 3300015374|Ga0132255_103022796 | Not Available | 718 | Open in IMG/M |
| 3300018031|Ga0184634_10450351 | Not Available | 581 | Open in IMG/M |
| 3300018073|Ga0184624_10234504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 822 | Open in IMG/M |
| 3300018076|Ga0184609_10517509 | Not Available | 542 | Open in IMG/M |
| 3300018433|Ga0066667_10222935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 1406 | Open in IMG/M |
| 3300018482|Ga0066669_12009869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 542 | Open in IMG/M |
| 3300019362|Ga0173479_10020601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1873 | Open in IMG/M |
| 3300019887|Ga0193729_1265369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
| 3300020004|Ga0193755_1206160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 557 | Open in IMG/M |
| 3300021344|Ga0193719_10237481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 773 | Open in IMG/M |
| 3300021951|Ga0222624_1120074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 833 | Open in IMG/M |
| 3300022756|Ga0222622_10117641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1664 | Open in IMG/M |
| 3300022756|Ga0222622_11258801 | Not Available | 544 | Open in IMG/M |
| 3300024178|Ga0247694_1028146 | Not Available | 630 | Open in IMG/M |
| 3300024232|Ga0247664_1115214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 625 | Open in IMG/M |
| 3300024251|Ga0247679_1022519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1069 | Open in IMG/M |
| 3300025911|Ga0207654_11003763 | Not Available | 607 | Open in IMG/M |
| 3300025920|Ga0207649_10566219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 871 | Open in IMG/M |
| 3300025928|Ga0207700_11650421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 566 | Open in IMG/M |
| 3300025929|Ga0207664_10645388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 951 | Open in IMG/M |
| 3300025960|Ga0207651_11011060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 743 | Open in IMG/M |
| 3300025960|Ga0207651_11291355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 656 | Open in IMG/M |
| 3300025972|Ga0207668_10563291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 988 | Open in IMG/M |
| 3300026023|Ga0207677_11110161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 721 | Open in IMG/M |
| 3300026078|Ga0207702_11307468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 719 | Open in IMG/M |
| 3300026088|Ga0207641_11310221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 725 | Open in IMG/M |
| 3300026300|Ga0209027_1288029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 529 | Open in IMG/M |
| 3300026301|Ga0209238_1187862 | Not Available | 606 | Open in IMG/M |
| 3300026552|Ga0209577_10347692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1092 | Open in IMG/M |
| 3300026806|Ga0207546_102643 | Not Available | 621 | Open in IMG/M |
| 3300027485|Ga0207635_1000337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 1511 | Open in IMG/M |
| 3300027775|Ga0209177_10049741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1183 | Open in IMG/M |
| 3300028716|Ga0307311_10098672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 814 | Open in IMG/M |
| 3300028719|Ga0307301_10156482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 734 | Open in IMG/M |
| 3300028719|Ga0307301_10158013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 731 | Open in IMG/M |
| 3300028771|Ga0307320_10110556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1049 | Open in IMG/M |
| 3300028796|Ga0307287_10154509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 872 | Open in IMG/M |
| 3300028819|Ga0307296_10171770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1174 | Open in IMG/M |
| 3300028828|Ga0307312_10406312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 895 | Open in IMG/M |
| 3300028828|Ga0307312_10753095 | Not Available | 645 | Open in IMG/M |
| 3300028875|Ga0307289_10078667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1335 | Open in IMG/M |
| 3300028880|Ga0307300_10359222 | Not Available | 504 | Open in IMG/M |
| 3300028889|Ga0247827_10324852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 908 | Open in IMG/M |
| 3300031058|Ga0308189_10506079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 521 | Open in IMG/M |
| 3300031198|Ga0307500_10165959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 640 | Open in IMG/M |
| 3300031421|Ga0308194_10080524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 900 | Open in IMG/M |
| 3300031716|Ga0310813_12193607 | Not Available | 523 | Open in IMG/M |
| 3300031938|Ga0308175_102427068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 587 | Open in IMG/M |
| 3300032075|Ga0310890_10515106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 912 | Open in IMG/M |
| 3300032205|Ga0307472_101263434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 709 | Open in IMG/M |
| 3300032783|Ga0335079_10739186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1024 | Open in IMG/M |
| 3300033412|Ga0310810_10476205 | Not Available | 1253 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 18.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.48% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.80% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.26% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.55% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.84% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.13% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.13% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.13% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.13% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.42% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.42% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.42% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.42% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.71% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.71% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.71% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.71% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.71% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.71% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.71% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.71% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.71% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.71% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459015 | Litter degradation PV4 | Engineered | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
| 3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012378 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012390 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012400 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012409 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Host-Associated | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021951 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024178 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35 | Environmental | Open in IMG/M |
| 3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026806 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A4a-10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027485 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A3w-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4PV_01293740 | 2170459015 | Switchgrass, Maize And Mischanthus Litter | VLTPAVNKRWATVEKQIMQQAPWAPWSNRVFPEFFTKKMGCIHIQRLYGVDLMRLCRK |
| JGI10214J12806_110756961 | 3300000891 | Soil | KVEKQIMQQAPWAPWSNRVFPEFFGKNMSCIHTQLLYGIDLARLCKK* |
| JGI11615J12901_100811091 | 3300000953 | Soil | IMQQAPWAPWSNRVFPEFFSKNMSCIHTQLLYGIDLARLCKK* |
| JGI10216J12902_1046087671 | 3300000956 | Soil | QAPWAPWSNRVFPEFFSKKMGCIHIQRLYGIDLARLCRK* |
| JGI10216J12902_1072694232 | 3300000956 | Soil | KQIMQQAPWAPWSNRVWPEFFSKKIGCIHLQPLFGVDLLRLCKK* |
| JGI10216J12902_1123012162 | 3300000956 | Soil | WAPWSNRVFPEFFTKKIGCIHNQRLYGIDWMRLCRK* |
| JGI10216J12902_1237617652 | 3300000956 | Soil | ARWAKVEKQIMQQAPWAPWSNRVFPEFFNKNMSCIHVQLLYGIDLARLCKK* |
| C688J35102_1186307462 | 3300002568 | Soil | RWAKVEKEIMSQAPWAPWSNRVFPEFFSKKMGCIHIQRLYGIDLARLCKK* |
| Ga0062589_1005763011 | 3300004156 | Soil | QIMQQAPWAPWSNRVFPEFFSKKMGCIHIQRLYGIDLARLCRK* |
| Ga0062590_1015130871 | 3300004157 | Soil | VEKQIMQQAPWAPWSNRVFPEFFSKKMGCIHIQRLYGIDLARLCRK* |
| Ga0063356_1026472051 | 3300004463 | Arabidopsis Thaliana Rhizosphere | QIMQQAPWAPWSNRVFPEFFSKKMGCIHIQRLYGVDLMRLCRK* |
| Ga0062592_1010513631 | 3300004480 | Soil | WASVEQTIMKDAPWAPWSNRVFPEFFTKKMGCIHVQLLYGIDLARLCKK* |
| Ga0062594_1024910261 | 3300005093 | Soil | AVNARWAKVEKQIMQQAPWAPWSNRVFPEFFNKNMSCIHVQLLYGIDLARLCKK* |
| Ga0066683_104211201 | 3300005172 | Soil | WAKVEKQIMQQAPWAPWSNRVFPEFFKKKIGCIHTQRLYGIDWMRLCRK* |
| Ga0066679_103432931 | 3300005176 | Soil | ALTPAVNARWANVEKLIMQQAPWVPWSNRTFPEFFSKQMGCIGIQRLYGVDFMRLCRK* |
| Ga0066678_106363401 | 3300005181 | Soil | PAVNSKWAKVEKQIMRQAPWAPWSNRVFPEFFKKKIGCIHTQRLYGIDWMRLCRK* |
| Ga0066671_106966462 | 3300005184 | Soil | PPALTPAVNKRWANVEKLIMQQAPWAPWSNRTFPEFFSKNMGCISIQRLYGIDFMKACRK |
| Ga0065705_110122971 | 3300005294 | Switchgrass Rhizosphere | PILTPAVNARWAKVEKQIMQQAPWAPWSNRVFPEFFGKNMSCIHTQLLYGIDLARLCKK* |
| Ga0070683_1004186921 | 3300005329 | Corn Rhizosphere | RWAKVEKQIMQQAPWAPWSNRVFPEFFSKKMGCIHTQRLYGIDALRLCKK* |
| Ga0070690_1005118571 | 3300005330 | Switchgrass Rhizosphere | VEKQIMQQAPWAPWSNRVFPEFFSKKIGCIHVQRLYGIDALRLCRK* |
| Ga0070690_1006046531 | 3300005330 | Switchgrass Rhizosphere | QAPWAPWSNRVFPEFFSKKMGCIHTQRLYGIDALRLCKK* |
| Ga0070680_1013442341 | 3300005336 | Corn Rhizosphere | WATVEKQIMAQAPWAPWSNRVFPEYFSKKMGCIHVQRLYGIDALRLCRK* |
| Ga0070691_102708981 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | EKQIMAQAPWAPWSNRVFPEYFSKKMGCIHVQRLYGIDLARLCKK* |
| Ga0073909_106505842 | 3300005526 | Surface Soil | QAPWAPWSNRVFPEFFSKKMGCIHVQRLYGIDALRLCKK* |
| Ga0066707_105394732 | 3300005556 | Soil | EKQIMQQAPWAPWSNRVFPEFFTKQIGCIHIQRLYGIDLARLCRK* |
| Ga0066670_103680161 | 3300005560 | Soil | WAKVEKQIMMQAPWAPWSNRVFPEFFNKSIPAKCIHVQRLYGIDLARLCK* |
| Ga0066693_102253592 | 3300005566 | Soil | VEKQIMQQAPWAPWSNRVFPEFFTKKIGCIHTQRLYGIDWMRLCRK* |
| Ga0066693_103137652 | 3300005566 | Soil | NARWAKVEKQIMQQAPWAPWSNRVFPEFFNKSVPAKCIHVQRLYGIDLARLCK* |
| Ga0066705_105114122 | 3300005569 | Soil | PWSNRVFPEFFTKQIGCIHIQRLYGIDLARLCRK* |
| Ga0068856_1006517921 | 3300005614 | Corn Rhizosphere | PWSNRVFPEFFSKKIGCIHVQRLYGIDALRLCRK* |
| Ga0068864_1015928562 | 3300005618 | Switchgrass Rhizosphere | PWSNRVFPEFFSKKMGCIHTQRLYGIDALRLCKK* |
| Ga0066905_1002366981 | 3300005713 | Tropical Forest Soil | VEKQIMQQAPWAPWSNRVFPEYFTKQIGCIHIQRLYGIDLARLCRK* |
| Ga0068861_1016695301 | 3300005719 | Switchgrass Rhizosphere | PWSNRVFPEFFSKKMGCIHTQRLYGIDALRLCRK* |
| Ga0066903_1005495301 | 3300005764 | Tropical Forest Soil | VEKQIMQQAPWAPWSNRVFPEFFGKNMSCIHVQLLYGIDLARLCKK* |
| Ga0066903_1028288412 | 3300005764 | Tropical Forest Soil | PWSNRVFPEFFSRNMSCIHIQLLYGIDLARLCKK* |
| Ga0066656_108065092 | 3300006034 | Soil | QAPWAPWSNRVFPEFFKKKIGCIHTQRLYGIDWMRLCRK* |
| Ga0066652_1009238821 | 3300006046 | Soil | RWAKVEKQIMQQAPWAPWSNRVFPEFFNKSIPAKCIHVQRLYGIDLARLCK* |
| Ga0066652_1009756962 | 3300006046 | Soil | PVLTPAVNARWAKVEKQIMQQAPWAPWSNRVFPEFFTKKIGCIHTQRLYGIDWMRLCRK* |
| Ga0075363_1009969521 | 3300006048 | Populus Endosphere | KQIMQQAPWAPWSNRVFPEFFSKKMGCIHIQRLYGVDLMRLCRK* |
| Ga0074053_119241012 | 3300006575 | Soil | PWSNRVFPEFFGKNMSCIHTQLLYGIDLARLCKK* |
| Ga0079220_105176592 | 3300006806 | Agricultural Soil | WAPWSNRVFPEYFSKKMGCIHVQRLYGIDLARLCKK* |
| Ga0079220_121254531 | 3300006806 | Agricultural Soil | PWAPWSNRVFPEFFSKKIGCIHIQRLYGIDLARLCRK* |
| Ga0075433_101026261 | 3300006852 | Populus Rhizosphere | LTPAVNKRWATVEKQIMQQAPWAPWSNRVFPEFFSKKMGCIHIQRLYGVDLMRLCRK* |
| Ga0079219_112299131 | 3300006954 | Agricultural Soil | KSQVLTPAVNARWAKVEKEIMAQAPWAPWSNRVFPEFFSKKMGCIHVQRLYGIDLARLCKK* |
| Ga0066710_1005628443 | 3300009012 | Grasslands Soil | PWAPWSNRVFPEFFSKSMGCIHTQRLYGIDLARLCKH |
| Ga0105245_104256441 | 3300009098 | Miscanthus Rhizosphere | QVLTPAVNKKWATVEKQIMQQAPWAPWSNRVFPEYFSKKMGCIHVQRLYGIDALRLCRK* |
| Ga0105247_109347872 | 3300009101 | Switchgrass Rhizosphere | APWAPWSNRVFPEYFSKKMGCIHVQRLYGIDALRLCRK* |
| Ga0105249_121988592 | 3300009553 | Switchgrass Rhizosphere | MQQAPWAPWSNRVFPEFFTKKMGCIHVQRLYGIDLMRLCKK* |
| Ga0126310_100419621 | 3300010044 | Serpentine Soil | VEKQIMQQAPWAPWSNRVFPEFFSKKMGCIHVQRLYGIDALRLCRK* |
| Ga0126382_114597792 | 3300010047 | Tropical Forest Soil | LTPAVNARWAKVEKQIMQQAPWAPWSNRVFPEFFSKSMSCIHTQALYGIDFARLCKK* |
| Ga0126319_12123392 | 3300010147 | Soil | WAAVEKQIMQQAPWAPWSNRVFPEFFNKSIPAKCIHVQRLYGIDLARLCK* |
| Ga0126319_14927561 | 3300010147 | Soil | APWAPWSNRVFPEFFSKKMGCIHVQRLYGIDLARLCRK* |
| Ga0134084_104544321 | 3300010322 | Grasslands Soil | NAKWAKVEKQIMQQAPWAPWSNRVFPEFFKKKIGCIHTQRLYGIDWMRLCRK* |
| Ga0134065_103187722 | 3300010326 | Grasslands Soil | VNKKWATVEKKIMQQAPWAPWSNRVFPEFFTKQIGCIHIQRLYGIDLARLCRK* |
| Ga0134071_105572382 | 3300010336 | Grasslands Soil | TPAVNARWTKVEKQIMQKAPWAPWSNRVFPEFFSRNMSCIHIQLLYGIDLARLCKK* |
| Ga0126377_101164721 | 3300010362 | Tropical Forest Soil | PILTPAVNARWAKTEKQIMQQAPWAPWSNRVFPEFFSRNMSCIHIQLLYGIDLARLCKK* |
| Ga0134066_102190052 | 3300010364 | Grasslands Soil | MMQAPWAPWSNRVFPEFFNKSIPAKCIHVQRLYGIDLARLCK* |
| Ga0126379_105649351 | 3300010366 | Tropical Forest Soil | WATVEKQIMQQAPWAPWSNRVFPEFFSKKMGCIHIQRLYGVDLMRLCRK* |
| Ga0126379_125832982 | 3300010366 | Tropical Forest Soil | EKQIMANAPWAPWSNRVFPEFFSKKIGCIHVQRLYGIDFSRLCRK* |
| Ga0126383_104176831 | 3300010398 | Tropical Forest Soil | IMQQAPWAPWSNRVFPEFFSRSMGCIHIQLLYGIDLARLCKK* |
| Ga0138505_1000505371 | 3300010999 | Soil | TTPATAPWAPWSNRVFPEYFTKKMGCIHIQLLYGIDWTRLCRK* |
| Ga0151489_11666411 | 3300011106 | Soil | MAQAPWAPWSNRVFPEYFSKKMGCIHVQRLYGIDALRLCRK* |
| Ga0105246_102365001 | 3300011119 | Miscanthus Rhizosphere | QAPWAPWSNRVFPEFFSKKIGCIHVQRLYGIDALRLCRK* |
| Ga0120159_11173932 | 3300012014 | Permafrost | LKTEPNLTPAVNARWTKVEKEIMQQAPWAPWSNRVFPEFFTKQMGCIHMQALYGFDLARVCRK* |
| Ga0137382_108182322 | 3300012200 | Vadose Zone Soil | WSNRVFPEFFNKSIPAKCIHVQRLYGIDLARLCKK* |
| Ga0137382_110772251 | 3300012200 | Vadose Zone Soil | EKSIMQDAPWAPWSNRVFPEYFTKKMGCIHIQLLYGIDWTRLCRK* |
| Ga0137382_110836011 | 3300012200 | Vadose Zone Soil | RWAKVEKQIMQQAPWAPWSNRVFPEFFTHQMGCIHMQALYGFDLSRVCRK* |
| Ga0137370_108478342 | 3300012285 | Vadose Zone Soil | QAPWAPWSNRVFPEFFTHQMGCIHMQALYGFDWARVCRK* |
| Ga0137387_106284621 | 3300012349 | Vadose Zone Soil | QAPWAPWSNRVFPEFFTKQIGCIHTQRLYGIDFARLCRK* |
| Ga0137366_110043042 | 3300012354 | Vadose Zone Soil | EKQIMQQAPWAPWSNRVFPEYFAKSMGCIHTQRLYGIDWTRLCKK* |
| Ga0134025_11839112 | 3300012378 | Grasslands Soil | VLTPAVNARWAKVEKQIMQQAPWAPWSNRVFPEFFSKKMGCIHNQRLFGIDLMRLCKK* |
| Ga0134054_12029032 | 3300012390 | Grasslands Soil | VNARWTKVEKQIMQKAPWAPWSNRVFPEFFTKQMGCIHMQALYGFDLSRVCRK* |
| Ga0134048_11153341 | 3300012400 | Grasslands Soil | QAPWAPWSNRVFPEFFTKKMGCIHVQRLYGIDLARLCKK* |
| Ga0134045_12758742 | 3300012409 | Grasslands Soil | PAVNARWAKVEKQIMQQAPWAPWSNRVFPEFFGKNMSCIHTQLLYGIDLARLCKK* |
| Ga0157324_10274462 | 3300012506 | Arabidopsis Rhizosphere | PAVNARWASVEQTIMKDAPWAPWSNRVFPEFFSKKMGCIHVQLLYGIDLTRLCKK* |
| Ga0157303_101218281 | 3300012896 | Soil | IMAQAPWAPWSNRVFPEYFSKKMGCIHVQRLYGIDALRLCKK* |
| Ga0157283_103649791 | 3300012907 | Soil | PWSNRVFPEFFSKKMGCIHIQRLYGIDLARLCRK* |
| Ga0164300_110655541 | 3300012951 | Soil | MQQAPWAPWSNRVFPEFFSKKIGCIHVQRLYGIDALRLCRK* |
| Ga0164303_111088201 | 3300012957 | Soil | QAPWAPWSNRVFPEYFSKKMGCIHVQRLYGIDALRLCKK* |
| Ga0164303_114488521 | 3300012957 | Soil | KSQVLTPAVNARWAKVEKEIMSAAPWAPWSNRVMPEFFSKKMGCIHIQRLYGIDLARLCRK* |
| Ga0126369_103756833 | 3300012971 | Tropical Forest Soil | LTPAVNARWAKTEKQIMQQAPWAPWSNRVFPEFFSKNMSCIHIQLLYGIDLARLCKK* |
| Ga0134077_105777731 | 3300012972 | Grasslands Soil | PAVNAKWATVEKQIMQQAPWAPWSNRVFPEFFTKQIGCIHIQRLYGIDLARLCRK* |
| Ga0134087_101763311 | 3300012977 | Grasslands Soil | APWAPWSNRVFPEFFSKSMGCIHIQRLYGIDLARLCKK* |
| Ga0164309_104370462 | 3300012984 | Soil | VEKQIMAQAPWAPWSNRVFPEFFSKKMGCIHVQRLYGIDLARLCRK* |
| Ga0164304_110594442 | 3300012986 | Soil | VNARWAKVEKQIMQQAPWAPWSNRVFPEFFSKNMSCIHVQLLYGIDLARLCKK* |
| Ga0182008_104801461 | 3300014497 | Rhizosphere | PAVNARWAKVEKEIMAQAPWAPWSNRVFPEYFSKKMGCIHVQRLYGIDLARLCRK* |
| Ga0157379_106632562 | 3300014968 | Switchgrass Rhizosphere | PAVNQRWASVEKSIMQDAPWAPWSNRVFPEFFTKKMGCIHTQRLYGIDALRLCKK* |
| Ga0134085_104850662 | 3300015359 | Grasslands Soil | APWAPWSNRVFPEFFNRAIPKKCIHVQRLYGIDLARLCK* |
| Ga0132256_1008162582 | 3300015372 | Arabidopsis Rhizosphere | VNARWATVEKQIMAQAPWAPWSNRVFPEYFSKKMGCIHVQRLYGIDLARLCKK* |
| Ga0132255_1030227961 | 3300015374 | Arabidopsis Rhizosphere | VNKRWATVEKQIMQQAPWAPWSNRVFPEFFTKKMGCIHIQRLYGVDLARLCRK* |
| Ga0184634_104503511 | 3300018031 | Groundwater Sediment | KKAPVLTPAVNQRWASVEKSIMQDAPWAPWSNRVFPEFFTKKMGCIHIQLLYGIDLARLCKK |
| Ga0184624_102345041 | 3300018073 | Groundwater Sediment | RWAKVEKQIMQQAPWAPWSNRVFPEFFTKKMGCIHTQRLYGIDALRLCRK |
| Ga0184609_105175091 | 3300018076 | Groundwater Sediment | QQAPWAPWSNRVFPEFFGKNMSCIHTQLLYGIDLARLCKK |
| Ga0066667_102229353 | 3300018433 | Grasslands Soil | QAPWAPWSNRVFPEFFNKSIPAKCIHVQRLYGIDLARLCK |
| Ga0066669_120098691 | 3300018482 | Grasslands Soil | WAKVEKQIMMQAPWAPWSNRVFPEFFNKSIPAKCIHVQRLYGIDLARLCK |
| Ga0173479_100206013 | 3300019362 | Soil | MQQAPWAPWSNRVFPEFFSKKMGCIHIQRLYGVDLMRLCRK |
| Ga0193729_12653692 | 3300019887 | Soil | ATVEKQIMQQAPWAPWSNRVFPEFFTKQIGCIHIQRLYGIDLARLCRK |
| Ga0193755_12061602 | 3300020004 | Soil | RWATVEKQIMSQAPWAPWSNRVFPEFFSKKMGCIHVQRLYGIDLARLCRK |
| Ga0193719_102374812 | 3300021344 | Soil | AKVEKQIMQQAPWAPWSNRVFPEFFGKNMSCIHTQLLYGIDLARLCKK |
| Ga0222624_11200741 | 3300021951 | Groundwater Sediment | KQIMQQAPWAPWSNRVFPEFFGKNMSCIHTQLLYGIDLARLCKK |
| Ga0222622_101176413 | 3300022756 | Groundwater Sediment | PWAPWSNRVFPEYFSKKMGCIHVQRLYGIDALRLCRK |
| Ga0222622_112588012 | 3300022756 | Groundwater Sediment | QQAPWAPWSNRVFPEFFNKSIPAKCIHVQRLYGIDLARLCK |
| Ga0247694_10281461 | 3300024178 | Soil | NKRWATVEKQIMQQAPWAPWSNRVFPEFFSKKIGCIHIQRLYGIDALRLCRK |
| Ga0247664_11152142 | 3300024232 | Soil | IMQNAPWAPWSNRVFPEFFSKKIGCIHVQRLYGIDLARLCKK |
| Ga0247679_10225192 | 3300024251 | Soil | PVNKRWATVEKQIMQQAPWAPWSNRVFPEFFSKKIGCIHIQRLYGIDALRLCRK |
| Ga0207654_110037631 | 3300025911 | Corn Rhizosphere | WAPWSNRVFPEFFSKKMGCIHVQRLYGIDLARLCKK |
| Ga0207649_105662191 | 3300025920 | Corn Rhizosphere | VEKQIMQQAPWAPWSNRVFPEFFSKNMSCIHVQLLYGIDLARLCKK |
| Ga0207700_116504212 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | APWSNRVFPEFFSKKIGCIHVQRLYGIDALRLCRK |
| Ga0207664_106453881 | 3300025929 | Agricultural Soil | WATVEKQIMQQAPWAPWSNRVFPEFFSKKIGCIHIQRLYGIDALRLCRK |
| Ga0207651_110110602 | 3300025960 | Switchgrass Rhizosphere | WAPWSNRVFPEFFSKKMGCIHTQRLYGIDALRLCKK |
| Ga0207651_112913551 | 3300025960 | Switchgrass Rhizosphere | WATVEKQIMAQAPWAPWSNRVFPEYFSKKMGCIHVQRLYGIDALRLCRK |
| Ga0207668_105632911 | 3300025972 | Switchgrass Rhizosphere | VEKQVMQAAPWAPWSNRVFPEFFSKKMGCIHVQRLYGIDLARLCKK |
| Ga0207677_111101612 | 3300026023 | Miscanthus Rhizosphere | PWAPWSNRVFPEYFSKKMGCIHVQRLYGIDLARLCKK |
| Ga0207702_113074681 | 3300026078 | Corn Rhizosphere | APWAPWSNRVFPEFFSKKIGCIHVQRLYGIDALRLCRK |
| Ga0207641_113102212 | 3300026088 | Switchgrass Rhizosphere | QIMQQAPWAPWSNRVFPEFFSKKMGCIHTQRLYGIDALRLCKK |
| Ga0209027_12880291 | 3300026300 | Grasslands Soil | PAVNKRWANVEKLIMQQAPWAPWSNRTFPEFFSKNMGCISIQRLYGIDFMKACRK |
| Ga0209238_11878622 | 3300026301 | Grasslands Soil | PWSNRVFPEFFNKSIPAKCIHVQRLYGIDLARLCK |
| Ga0209577_103476921 | 3300026552 | Soil | KEIVQNAPWAPWSNRVFPEFFSKSMGCIHVQRLYGIDLSRLCKH |
| Ga0207546_1026432 | 3300026806 | Soil | VNKRWATVEKQIMQQAPWAPWSNRVFPEFFSKKMGCIHIQRLYGVDLMRLCRK |
| Ga0207635_10003373 | 3300027485 | Soil | PWAPWSNRVFPEFFSKKMGCIHIQRLYGVDLMRLCRK |
| Ga0209177_100497411 | 3300027775 | Agricultural Soil | KSQVLTPAVNARWAKVEKEIMAQAPWAPWSNRVFPEFFSKKMGCIHVQRLYGIDLARLCK |
| Ga0307311_100986722 | 3300028716 | Soil | PVLTPAVNQRWASVEKSIMQDAPWAPWSNRVFPEFFTKKMGCIHIQLLYGIDLARLCKK |
| Ga0307301_101564822 | 3300028719 | Soil | WAPWSNRVFPEFFTKKMGCIHIQLLYGIDLARLCKK |
| Ga0307301_101580132 | 3300028719 | Soil | EKQIMQQAPWAPWSNRVFPEFFSKKMGCIHTQRLYGIDAIRLCRK |
| Ga0307320_101105561 | 3300028771 | Soil | WAKIEKQIMQQAPWAPWSNRVWPEFFSKKMSCIHVQPLFGVDWLRLCKK |
| Ga0307287_101545092 | 3300028796 | Soil | LTPAVNARWAKVEKQIMQQAPWAPWSNRVFPEFFGKNMSCIHTQLLYGIDLARLCKK |
| Ga0307296_101717702 | 3300028819 | Soil | VEKQIMQQAPWAPWSNRVFPEFFSKKMGCIHTQRLYGIDAIRLCRK |
| Ga0307312_104063122 | 3300028828 | Soil | TPAVNLRWTKVEKEIMQQAPWAPWSNRVFPEYFTKQMGCIHMQALYGFDLSRVCRK |
| Ga0307312_107530951 | 3300028828 | Soil | VEKQIMQQAPWAPWSNRVFPEFFTKQMGCIHMQALYGFDLARVCRK |
| Ga0307289_100786672 | 3300028875 | Soil | MQAAPWAPWSNRVFPEFFSKKMGCIHVQRLYGIDLA |
| Ga0307300_103592221 | 3300028880 | Soil | KQIMQQAPWAPWSNRVFPEFFSKKMGCIHTQRLYGIDAIRLCRK |
| Ga0247827_103248521 | 3300028889 | Soil | QAPWAPWSNRVFPEFFSKSMSCIHTQLLYGIDLARLCKK |
| Ga0308189_105060792 | 3300031058 | Soil | VNDRWATVEKQIMQQAPWAPWSNRVFPEFFSKKMGCIHTQRLYGIDAIRLCRK |
| Ga0307500_101659591 | 3300031198 | Soil | RWATVEKQIMAQAPWAPWSNRVFPEFFSKKMGCIHVQRLYGIDALRLCKK |
| Ga0308194_100805242 | 3300031421 | Soil | WATVEKQIMQQAPWAPWSNRVFPEFFSKKMGCIHTQRLYGIDAIRLCRK |
| Ga0310813_121936071 | 3300031716 | Soil | PVLTPAVNAKWATVEKQIMQQAPWAPWSNRVFPEFFTKQIGCIHIQRLYGIDLARLCRK |
| Ga0308175_1024270682 | 3300031938 | Soil | QIMAQAPWAPWSNRVFPEFFSKKMGCIHVQRLYGIDTLRLCKK |
| Ga0310890_105151062 | 3300032075 | Soil | QVLTPPVNKRWATVEKQIMQQAPWAPWSNRVFPEFFSKKIGCIHIQRLYGIDALRLCRK |
| Ga0307472_1012634342 | 3300032205 | Hardwood Forest Soil | QVLTPAVNKRWATVEKQIMQQAPWAPWSNRVFPEFFNKSIPAKCIHVQRLYGIDLARLCK |
| Ga0335079_107391862 | 3300032783 | Soil | KVEKQIMQQAPWAPWSNRVFPEFFNKSIPLKCIHVQRLYGIDLARLCK |
| Ga0310810_104762051 | 3300033412 | Soil | WAPWSNRVFPEFFSKSMGCIHVQRLYGIDALRLCKK |
| ⦗Top⦘ |