| Basic Information | |
|---|---|
| Family ID | F051795 |
| Family Type | Metagenome |
| Number of Sequences | 143 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MIRLTPSQITVDAAAAEGLPSRSISGVAVTYDETATVNDGTKVRF |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 143 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 76.76 % |
| % of genes near scaffold ends (potentially truncated) | 97.90 % |
| % of genes from short scaffolds (< 2000 bps) | 93.71 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.25 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (97.203 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (28.671 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.350 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (51.049 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 27.40% Coil/Unstructured: 72.60% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 143 Family Scaffolds |
|---|---|---|
| PF04860 | Phage_portal | 97.90 |
| PF03354 | TerL_ATPase | 2.10 |
| COG ID | Name | Functional Category | % Frequency in 143 Family Scaffolds |
|---|---|---|---|
| COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 2.10 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.60 % |
| Unclassified | root | N/A | 1.40 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003393|JGI25909J50240_1113352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
| 3300003499|JGI25930J51415_1024346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1120 | Open in IMG/M |
| 3300004126|Ga0066179_10076054 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 827 | Open in IMG/M |
| 3300004240|Ga0007787_10107200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1311 | Open in IMG/M |
| 3300005585|Ga0049084_10246674 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 601 | Open in IMG/M |
| 3300005585|Ga0049084_10313135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
| 3300005585|Ga0049084_10318012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
| 3300005805|Ga0079957_1139971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1247 | Open in IMG/M |
| 3300005805|Ga0079957_1156280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1153 | Open in IMG/M |
| 3300006802|Ga0070749_10049643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 2558 | Open in IMG/M |
| 3300006802|Ga0070749_10537125 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300006802|Ga0070749_10675818 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
| 3300006805|Ga0075464_10537578 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 717 | Open in IMG/M |
| 3300006805|Ga0075464_10552506 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 707 | Open in IMG/M |
| 3300006810|Ga0070754_10257094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 796 | Open in IMG/M |
| 3300007346|Ga0070753_1141443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 916 | Open in IMG/M |
| 3300007540|Ga0099847_1058095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1209 | Open in IMG/M |
| 3300007540|Ga0099847_1101218 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 878 | Open in IMG/M |
| 3300007541|Ga0099848_1091852 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1172 | Open in IMG/M |
| 3300007541|Ga0099848_1259337 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
| 3300007542|Ga0099846_1070076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1311 | Open in IMG/M |
| 3300007622|Ga0102863_1026583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1653 | Open in IMG/M |
| 3300009164|Ga0114975_10466961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 683 | Open in IMG/M |
| 3300009164|Ga0114975_10554768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 616 | Open in IMG/M |
| 3300009529|Ga0114919_10582921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 767 | Open in IMG/M |
| 3300009809|Ga0105089_1045567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 667 | Open in IMG/M |
| 3300010297|Ga0129345_1204653 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 699 | Open in IMG/M |
| 3300010318|Ga0136656_1062317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1333 | Open in IMG/M |
| 3300013372|Ga0177922_10597921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 764 | Open in IMG/M |
| 3300013372|Ga0177922_11178010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 773 | Open in IMG/M |
| 3300014811|Ga0119960_1071970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 608 | Open in IMG/M |
| 3300014819|Ga0119954_1082175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
| 3300017716|Ga0181350_1106504 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 684 | Open in IMG/M |
| 3300017716|Ga0181350_1166963 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300017736|Ga0181365_1106900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 675 | Open in IMG/M |
| 3300017736|Ga0181365_1143400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
| 3300017754|Ga0181344_1138733 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 696 | Open in IMG/M |
| 3300017761|Ga0181356_1066483 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1217 | Open in IMG/M |
| 3300017774|Ga0181358_1051435 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1558 | Open in IMG/M |
| 3300017777|Ga0181357_1056643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1522 | Open in IMG/M |
| 3300017777|Ga0181357_1234707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 642 | Open in IMG/M |
| 3300017777|Ga0181357_1327494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
| 3300017778|Ga0181349_1057859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1509 | Open in IMG/M |
| 3300017778|Ga0181349_1102503 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1070 | Open in IMG/M |
| 3300017778|Ga0181349_1282714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300017784|Ga0181348_1177223 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 779 | Open in IMG/M |
| 3300017784|Ga0181348_1263993 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
| 3300017784|Ga0181348_1325835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| 3300017785|Ga0181355_1077019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1397 | Open in IMG/M |
| 3300017785|Ga0181355_1195014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 798 | Open in IMG/M |
| 3300017785|Ga0181355_1242956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 692 | Open in IMG/M |
| 3300017785|Ga0181355_1295613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
| 3300017788|Ga0169931_10681665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 680 | Open in IMG/M |
| 3300018420|Ga0181563_10613430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 604 | Open in IMG/M |
| 3300019784|Ga0181359_1234206 | Not Available | 568 | Open in IMG/M |
| 3300019784|Ga0181359_1254955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
| 3300020084|Ga0194110_10557342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 736 | Open in IMG/M |
| 3300020161|Ga0211726_10104415 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1073 | Open in IMG/M |
| 3300020172|Ga0211729_11335077 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2211 | Open in IMG/M |
| 3300020179|Ga0194134_10150668 | All Organisms → Viruses → Predicted Viral | 1057 | Open in IMG/M |
| 3300020205|Ga0211731_11072935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 782 | Open in IMG/M |
| 3300020220|Ga0194119_10607809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 672 | Open in IMG/M |
| 3300021960|Ga0222715_10188369 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1245 | Open in IMG/M |
| 3300021961|Ga0222714_10009894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8313 | Open in IMG/M |
| 3300021961|Ga0222714_10053123 | All Organisms → Viruses → Predicted Viral | 2791 | Open in IMG/M |
| 3300021961|Ga0222714_10099674 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1841 | Open in IMG/M |
| 3300021961|Ga0222714_10236320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1033 | Open in IMG/M |
| 3300021961|Ga0222714_10409415 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 714 | Open in IMG/M |
| 3300021962|Ga0222713_10344925 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 933 | Open in IMG/M |
| 3300021962|Ga0222713_10438207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 795 | Open in IMG/M |
| 3300021963|Ga0222712_10224963 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1214 | Open in IMG/M |
| 3300021963|Ga0222712_10498851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 720 | Open in IMG/M |
| 3300022063|Ga0212029_1026046 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 805 | Open in IMG/M |
| 3300022179|Ga0181353_1093324 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 747 | Open in IMG/M |
| 3300022179|Ga0181353_1135944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 576 | Open in IMG/M |
| 3300022190|Ga0181354_1116345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 862 | Open in IMG/M |
| 3300022190|Ga0181354_1138453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 770 | Open in IMG/M |
| 3300022190|Ga0181354_1217301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
| 3300022198|Ga0196905_1046048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1255 | Open in IMG/M |
| 3300022200|Ga0196901_1059943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1399 | Open in IMG/M |
| 3300022200|Ga0196901_1213694 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 613 | Open in IMG/M |
| 3300022200|Ga0196901_1223339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 595 | Open in IMG/M |
| 3300022208|Ga0224495_10170165 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 922 | Open in IMG/M |
| 3300022407|Ga0181351_1020416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 2796 | Open in IMG/M |
| 3300022407|Ga0181351_1105110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1085 | Open in IMG/M |
| 3300022407|Ga0181351_1227176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 600 | Open in IMG/M |
| 3300022929|Ga0255752_10336736 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 622 | Open in IMG/M |
| 3300023179|Ga0214923_10167556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1344 | Open in IMG/M |
| 3300023184|Ga0214919_10217220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1411 | Open in IMG/M |
| 3300024262|Ga0210003_1265911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 671 | Open in IMG/M |
| 3300024276|Ga0255205_1019664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1110 | Open in IMG/M |
| 3300025508|Ga0208148_1073055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 790 | Open in IMG/M |
| 3300025543|Ga0208303_1057422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 923 | Open in IMG/M |
| 3300025646|Ga0208161_1034790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1739 | Open in IMG/M |
| 3300025646|Ga0208161_1070617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1041 | Open in IMG/M |
| 3300025647|Ga0208160_1140677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 593 | Open in IMG/M |
| 3300025872|Ga0208783_10217769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 784 | Open in IMG/M |
| 3300025889|Ga0208644_1105390 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1378 | Open in IMG/M |
| 3300025889|Ga0208644_1172828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 966 | Open in IMG/M |
| 3300025889|Ga0208644_1219146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 811 | Open in IMG/M |
| 3300027139|Ga0255082_1056842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 610 | Open in IMG/M |
| 3300027193|Ga0208800_1003503 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1941 | Open in IMG/M |
| 3300027193|Ga0208800_1062763 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| 3300027306|Ga0255220_1054277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 759 | Open in IMG/M |
| 3300027649|Ga0208960_1156306 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
| 3300027659|Ga0208975_1205982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
| 3300027707|Ga0209443_1023989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2679 | Open in IMG/M |
| 3300027733|Ga0209297_1250345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 680 | Open in IMG/M |
| 3300027764|Ga0209134_10109129 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 949 | Open in IMG/M |
| 3300027782|Ga0209500_10098376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1453 | Open in IMG/M |
| 3300027782|Ga0209500_10254278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 764 | Open in IMG/M |
| 3300027785|Ga0209246_10202859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 774 | Open in IMG/M |
| 3300027785|Ga0209246_10323484 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
| 3300027798|Ga0209353_10453749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
| 3300027808|Ga0209354_10078461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1343 | Open in IMG/M |
| 3300027808|Ga0209354_10224201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 758 | Open in IMG/M |
| 3300027940|Ga0209893_1003538 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1174 | Open in IMG/M |
| 3300028071|Ga0255216_1006315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 2296 | Open in IMG/M |
| 3300028083|Ga0255190_1071199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
| 3300028269|Ga0255193_1010251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1382 | Open in IMG/M |
| 3300031539|Ga0307380_11205832 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
| 3300031539|Ga0307380_11408759 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
| 3300031565|Ga0307379_10383600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1353 | Open in IMG/M |
| 3300031565|Ga0307379_10986749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 719 | Open in IMG/M |
| 3300031565|Ga0307379_11199342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 629 | Open in IMG/M |
| 3300031566|Ga0307378_10363051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1344 | Open in IMG/M |
| 3300031566|Ga0307378_10372571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1321 | Open in IMG/M |
| 3300031578|Ga0307376_10590043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 708 | Open in IMG/M |
| 3300031673|Ga0307377_10296865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1225 | Open in IMG/M |
| 3300031834|Ga0315290_10383485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1232 | Open in IMG/M |
| 3300032401|Ga0315275_12357224 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
| 3300033233|Ga0334722_10220923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1398 | Open in IMG/M |
| 3300033981|Ga0334982_0329615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 710 | Open in IMG/M |
| 3300034073|Ga0310130_0053921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1200 | Open in IMG/M |
| 3300034093|Ga0335012_0142067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1312 | Open in IMG/M |
| 3300034093|Ga0335012_0150809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1265 | Open in IMG/M |
| 3300034105|Ga0335035_0195270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1249 | Open in IMG/M |
| 3300034106|Ga0335036_0735658 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 579 | Open in IMG/M |
| 3300034112|Ga0335066_0172134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1305 | Open in IMG/M |
| 3300034116|Ga0335068_0040183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2782 | Open in IMG/M |
| 3300034356|Ga0335048_0233152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 994 | Open in IMG/M |
| 3300034418|Ga0348337_044643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1855 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 28.67% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 18.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.69% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 6.29% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 6.99% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.20% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.20% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.20% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.50% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.10% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.10% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.10% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.40% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.40% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.40% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.40% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.70% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.70% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.70% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.70% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
| 3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
| 3300009809 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022208 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024276 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_8d | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027139 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8h | Environmental | Open in IMG/M |
| 3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
| 3300027306 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepB_8d | Environmental | Open in IMG/M |
| 3300027649 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_25-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300028071 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepA_8d | Environmental | Open in IMG/M |
| 3300028083 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300028269 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25909J50240_11133522 | 3300003393 | Freshwater Lake | MIKLIPTQITVDAAAANGMPRRSISGIAVTYDETATVSDGTQVRVMQGAL |
| JGI25930J51415_10243462 | 3300003499 | Freshwater Lake | MIRLTPSQITVDAAAAEGLPSRSISGVAVTYDETATVNDGTKVRFLQGSLP |
| Ga0066179_100760542 | 3300004126 | Freshwater Lake | MIRLTAQKITLDAAADGTTGRTISGVAVTYGVTATVLDGTKVQFLQGSLPVTGR |
| Ga0007787_101072002 | 3300004240 | Freshwater Lake | MIRLTPSQITVDAAAADDKPSRSISGVAVTYDETATVSDGTKVRFLQGSLPVTGRDPK |
| Ga0049084_102466742 | 3300005585 | Freshwater Lentic | MIQFVPSQQITVDAAKADGQPRRSISGVAIQYDVVAT |
| Ga0049084_103131351 | 3300005585 | Freshwater Lentic | MIKLTPTQITVDAAAAEGLPSRSISGVAVTYDETATV |
| Ga0049084_103180122 | 3300005585 | Freshwater Lentic | MIKLVPSQITVDAAAADGLPRRSISGVAVTYDETATVS |
| Ga0079957_11399711 | 3300005805 | Lake | MIRLTPSQITVDAAAAEGLPSRSISGVAVTYDETATVND |
| Ga0079957_11562801 | 3300005805 | Lake | MIRLTPTQITVDAAAAEGLPSRSISGVAVTYDETATVND |
| Ga0070749_100496433 | 3300006802 | Aqueous | MIKLVPSQITVDAAAADGLPRRSISGVAVTYDETA |
| Ga0070749_105371252 | 3300006802 | Aqueous | MIKLTPKTLITVDAAAAEGSPRRSISGVAVTYDEVATVSD |
| Ga0070749_106758181 | 3300006802 | Aqueous | MIRLTPTQITVDAAAAEGLPSRSISGVAVTYDETATVNDGTKVRFLQGSLPVT |
| Ga0075464_105375782 | 3300006805 | Aqueous | MIKLVPSQITVDAAAADGLPRRSISGVAVTYDETATVSD |
| Ga0075464_105525061 | 3300006805 | Aqueous | MIRLTPSQITVDAAAAEGLPSRSISGVAVTYDETATVNDGTKVRF |
| Ga0070754_102570941 | 3300006810 | Aqueous | MIRLTPTQITVDAAAAEGLPSRSISGVAVTYDETATVNDGTKVRFLKGSLP |
| Ga0070753_11414431 | 3300007346 | Aqueous | MIRLTPTQITVDAAAAEGLPSRSISGVAVTYDETA |
| Ga0099847_10580952 | 3300007540 | Aqueous | MIKFQTQITVDAAAVEGLPSRSISGVAVTYDETATVSDGTQ |
| Ga0099847_11012181 | 3300007540 | Aqueous | MIKLTPTQITVDAAAAEGLPSRSISGVAVTYDETAT |
| Ga0099848_10918522 | 3300007541 | Aqueous | MIRFTPKSLITVDAAAAEGSPRRSISGVAVTYDEVATVSDGTQVKILQ |
| Ga0099848_12593372 | 3300007541 | Aqueous | MIRLTPTQITVDAAAAEGLPSRSISGVAVTYDETATVNDGTKVRFLQGSL |
| Ga0099846_10700762 | 3300007542 | Aqueous | MIRLTPTQITVDAAAAEGLPSRSISGVAVTYDETATVSDGT |
| Ga0102863_10265831 | 3300007622 | Estuarine | MIRLTPSQITVDAAAAEGLPSRSISGVAVTYDETATVNDGTKVRFLQGSLPVTGRDPK |
| Ga0114981_100646893 | 3300009160 | Freshwater Lake | MIKLVPSLITVDAGAVGELPRRSISGIAVTYDETAV |
| Ga0114975_104669612 | 3300009164 | Freshwater Lake | MIRLTPSQITVDAGAVGELPRRSISGIAVTYDETAVVADGTKVRIMQGALPVD |
| Ga0114975_105547682 | 3300009164 | Freshwater Lake | MIKLTPTTMITVDAAAAEGLPRRSISGVAVTYDETATVADGTQVRFKQ* |
| Ga0114919_105829212 | 3300009529 | Deep Subsurface | MIRLTPTQITVDAAAADDKPSRSISGVAVTYDETATVNDG |
| Ga0105089_10455671 | 3300009809 | Groundwater Sand | MIRLTPSQITVDAAAAEGLPSRSISGVAVTYDETATVNDGTKVRFLQGSLPVTGRD |
| Ga0129345_12046532 | 3300010297 | Freshwater To Marine Saline Gradient | MIRLTPTQITVDAAAAEGLPSRSISGVAVTYDETAVVNDGTKV |
| Ga0136656_10623171 | 3300010318 | Freshwater To Marine Saline Gradient | MIRLTPTQITVDAAAADDKPSRSISGVAVTYDETAVVNDGTKVR |
| Ga0177922_105979212 | 3300013372 | Freshwater | MIRLTPTQITVDAAAAEGLPSRSISGVAVTYDETATVNDGTQV |
| Ga0177922_111780102 | 3300013372 | Freshwater | MIKLVPSQITVDAAAADGLPRRSISGVAVTYDETATVSDGTRV |
| Ga0119960_10719702 | 3300014811 | Aquatic | MIRLTPSQITVDAGAVGELPRRSISGIAVTYDETATVADGTKV |
| Ga0119954_10821751 | 3300014819 | Freshwater | MIKLIPQLITVDAAAADGLPRRSISGVAVTYDETATVSDGTKVRFLQGS |
| Ga0181350_11065042 | 3300017716 | Freshwater Lake | MITLTPSQITVDAAAAGQLPSRSISGVAVTYDETAIVNDGTKVRFLQG |
| Ga0181350_11669631 | 3300017716 | Freshwater Lake | MIKLIPTQITVDAAAANGMPRRSISGIAVTYDETATVSDGTQVRVMQV |
| Ga0181365_11069001 | 3300017736 | Freshwater Lake | MIKLTPSQITVDAAAVGELPRRSISGIAVTYDETAIAS |
| Ga0181365_11434001 | 3300017736 | Freshwater Lake | MIKLVPSLITVDAGAVGELPRRSISGIAVTYDETAVV |
| Ga0181344_11387332 | 3300017754 | Freshwater Lake | MIRLTPSQITVDAGAVGELPRRSISGIAVTYDETAVVADGTKVRIMQGALPVDGRN |
| Ga0181356_10664831 | 3300017761 | Freshwater Lake | MIRLTPSKITVDAAASDGLARRSISGIAVTYDEVAVVADGTKVRFLQGSL |
| Ga0181358_10514353 | 3300017774 | Freshwater Lake | MIKLIPTQITVDAAAANGMPRRSISGIAVTYDETATVSDG |
| Ga0181357_10566433 | 3300017777 | Freshwater Lake | MIKLVPSQITVDAAAAEGLPSRSISGVAVTYDETATVND |
| Ga0181357_12347071 | 3300017777 | Freshwater Lake | MIRLTPTQITVDAAAAEGLPSRSISGVAVTYDETATVNDGTQVRFLQG |
| Ga0181357_13274941 | 3300017777 | Freshwater Lake | MITLTPSRITVDAAAAGALPSRSISGVAVTYDETAIVNDGTKVRFLQG |
| Ga0181349_10578591 | 3300017778 | Freshwater Lake | MIRLTPSKITVDAAASDGLARRSISGIAVTYDEVAVVADGTKVRFLQGS |
| Ga0181349_11025031 | 3300017778 | Freshwater Lake | MIKLTPSQITVDAAAVGELPRRSISGIAVTYDEIATVADGTKVRIMQGA |
| Ga0181349_12827141 | 3300017778 | Freshwater Lake | MIRLTPTQITVDAAAAEGLPSRSISGVAVTYDETATVNDGTKVR |
| Ga0181348_11772232 | 3300017784 | Freshwater Lake | MIKLTPTMITVDAAAAEGLPRRSISGVAVTYNEIATVSDGTQVKIL |
| Ga0181348_12639932 | 3300017784 | Freshwater Lake | MIKLTPTTITVDAAAAEGLPRRSISGVAVTYNEIATVADGTQVRIMQ |
| Ga0181348_13258352 | 3300017784 | Freshwater Lake | MIKLIPTQITVDAAAANGMPRRSISGIAVTYDETATVSDGTQV |
| Ga0181355_10770191 | 3300017785 | Freshwater Lake | MIRLTPQQITVDAAAADGVQRRTISGVAVEYGVTATVSDGTQ |
| Ga0181355_11950141 | 3300017785 | Freshwater Lake | MIRLTPSKITVDAAASDGLARRSISGIAVTYDEIAVVLEGTGVR |
| Ga0181355_12429562 | 3300017785 | Freshwater Lake | MIRITPSQITVDAAAAEGLPSRSISGVAVTYDETA |
| Ga0181355_12956131 | 3300017785 | Freshwater Lake | MIKLIPTQITVDAAAANGMPRRSISGIAVTYDETATVSDGTQVR |
| Ga0169931_106816651 | 3300017788 | Freshwater | MIRLTPTSITVDAAAADGLPSRSITGVAVTYDETATVLDGTKVRFLQGSLPVT |
| Ga0181563_106134301 | 3300018420 | Salt Marsh | MIKLIPQLITVDSAAADGLPRRSISGVAVTYDETATVSDGTKVRFLQGSLPVTG |
| Ga0181359_12342061 | 3300019784 | Freshwater Lake | MIRLTPTQITVDAAAAEGLPSRSISGVAVTYDETATVNDGTKP |
| Ga0181359_12549552 | 3300019784 | Freshwater Lake | MIKLTPTTITVDAAAAEGLPRRSISGVAVTYNEIATVADGTQVRIMQGALPVDGRNP |
| Ga0194110_105573422 | 3300020084 | Freshwater Lake | MIRLTPTQITVDAAAADGLPSRSITGIAVTYDTVATVLDGT |
| Ga0211726_101044151 | 3300020161 | Freshwater | MIRLIPSQITVDAAAVEGLPSRSISGVAVTYDETATVLDGTKVRFEQGS |
| Ga0211729_113350771 | 3300020172 | Freshwater | MIKLVPSLITVDAGAVGELPRRSISGIAVTYDETATVADGTQVRIMQGALPV |
| Ga0194134_101506681 | 3300020179 | Freshwater Lake | MIRLTPTQITVDAAAADGLPSRSITGVAVTYDTVATVLDGTK |
| Ga0211731_110729351 | 3300020205 | Freshwater | MIKLVPSLITVDAGAVGELPRRSISGIAVTYDETATVLDGTKVRFQQGSL |
| Ga0194119_106078091 | 3300020220 | Freshwater Lake | MIRLTPTQITVDAAAADGLPSRSITGIAVTYDTVATVLDGTKVKFLQG |
| Ga0222715_101883692 | 3300021960 | Estuarine Water | MIRLTPSQITVDAAAAEGLPSRSISGVAVTYDETATVNDGTKVRFLQGSLPVT |
| Ga0222714_1000989414 | 3300021961 | Estuarine Water | MIRLTPTQITVDAAAAEGLPSRSISGVAVTYDETATV |
| Ga0222714_100531231 | 3300021961 | Estuarine Water | MIRLTPSQITVDAAAAEGLPSRSISGVAVTYDETATVLDGTQVRFLQGS |
| Ga0222714_100996741 | 3300021961 | Estuarine Water | MIRLTPSQITVDAAAAEGLPSRSISGVAVTYDETATVLDGT |
| Ga0222714_102363201 | 3300021961 | Estuarine Water | MIRLTPSQITVDAAAAEGLPSRSISGVAVTYDETATVNDGTK |
| Ga0222714_104094151 | 3300021961 | Estuarine Water | MIKLTPTQITVDAAAAEGLPSRSISGVAVTYDETATVLDGTQVRFLQGS |
| Ga0222713_103449251 | 3300021962 | Estuarine Water | MIRLSPSQITVDAAAAEGLPSRSISGVAVTYDETATVSDGTKVRFLQGSLPVTGRDPK |
| Ga0222713_104382072 | 3300021962 | Estuarine Water | MIRLTPSQITVDAAAAEGLPSRSISGVAVTYDETATISDGTKVRFLQGSLPV |
| Ga0222712_102249631 | 3300021963 | Estuarine Water | MIRLTPSQITVDAAAVEGLPSRSISGVAVTYDETATVLDGT |
| Ga0222712_104988511 | 3300021963 | Estuarine Water | MIRLTPSQITVDAAAAEGLPSRSISGVAVTYDETATVNDG |
| Ga0212029_10260462 | 3300022063 | Aqueous | MIRLTPTQITVDAAAADDKPSRSISGIAVTYDETATVNDGTQVRFLQGSLPVTGRDPKLY |
| Ga0181353_10933242 | 3300022179 | Freshwater Lake | MIRLTPSQITVDAAAAEGLPSRSISGVAVTYDETATVNDGT |
| Ga0181353_11359442 | 3300022179 | Freshwater Lake | MIRLTPSQITVDAAAAEGLPSRSISGVAVTYDETATVNDGTKV |
| Ga0181354_11163451 | 3300022190 | Freshwater Lake | MIRLTPSQITVDAAAAEGLPSRSISGVAVTYDETATVN |
| Ga0181354_11384531 | 3300022190 | Freshwater Lake | MIRLTPSQITVDAAAAEGLPSRSISGVAVTYNETATVNDGTKVRFLQGSL |
| Ga0181354_12173011 | 3300022190 | Freshwater Lake | MIKLTPSQITVDAAAADGLPRRSISGVAVTYDEVATVNDGTKVRFL |
| Ga0196905_10460482 | 3300022198 | Aqueous | MIRLTPTQITVDAAAAEGLPSRSISGVAVTYDETATVNDGTKVRFL |
| Ga0196901_10599431 | 3300022200 | Aqueous | MIRLTPTQITVDAAAADDKPSRSISGIAVTYDETATVNDGTQVR |
| Ga0196901_12136942 | 3300022200 | Aqueous | MIRLTPTQITVDAAAAEGLPSRSISGVAVTYDETAT |
| Ga0196901_12233391 | 3300022200 | Aqueous | MIKLTPTQITVDAAAAEGLPSRSISGVAVTYDETATVLD |
| Ga0224495_101701652 | 3300022208 | Sediment | MIRLTPKTLITVDAAAAEGSPRRSISGVAVTYDEVATVSDGTQV |
| Ga0181351_10204163 | 3300022407 | Freshwater Lake | MIRLTPSQITVDAAAVEGLPSRSISGVAVTYDETATVVDGTKVR |
| Ga0181351_11051102 | 3300022407 | Freshwater Lake | MIKLTPSQITVDAAAVGELPRRSISGIAVTYDETAIVTDGTKVRIMQG |
| Ga0181351_12271761 | 3300022407 | Freshwater Lake | MIRLTPSQITVDAAAAEGLPSRSISGVAVTYDETAT |
| Ga0255752_103367361 | 3300022929 | Salt Marsh | MIKLTPSQITVDAAAAEGLPSRSISGVAVTYDETATVLDGTKVRFLQG |
| Ga0214923_101675561 | 3300023179 | Freshwater | MITLVPSKITVDAAAADGLPRRSISGIAVTYNETATVADGTKVRFLQGSLPVEGRKNLTFVP |
| Ga0214919_102172202 | 3300023184 | Freshwater | MIKLTPSQITVDAAAAEGLPSRSISGVAVTYDETATVLDGTKVRFLQGSLPVTG |
| Ga0210003_12659111 | 3300024262 | Deep Subsurface | MIRLIPSQITVDAAAVEGLPSRSISGVAVTYDETATVL |
| Ga0255205_10196641 | 3300024276 | Freshwater | MIRLTPSQITVDAAAAEGLPSRSISGVAVTYDETATVSDGTQVRF |
| Ga0208148_10730551 | 3300025508 | Aqueous | MIRLTPTQITVDAAAAEGLPSRSISGVAVTYDETATVNDG |
| Ga0208303_10574222 | 3300025543 | Aqueous | MIKFQTQITVDAAAVEGLPSRSISGVAVTYDETATVSDGTQVR |
| Ga0208161_10347903 | 3300025646 | Aqueous | MIRLTPSQITVDAAAAEGLPSRSISGVAVTYDETATISDGTK |
| Ga0208161_10706172 | 3300025646 | Aqueous | MIRLSPSQITVDAAAAEGLPSRSISGVAVTYDETATVNDGTK |
| Ga0208160_11406772 | 3300025647 | Aqueous | MIRLTPTQITVDAAAAEGLPSRSISGVAVTYDETATVN |
| Ga0208783_102177692 | 3300025872 | Aqueous | MIRLTPKTLITVDAAAAEGSPRRSISGVAVTYDEVATVSDGTQVKILQ |
| Ga0208644_11053901 | 3300025889 | Aqueous | MIRLTPSQITVDAAAAEGLPSRSISGVAVTYDETATVNDGTKVRFLQGSLPVTGR |
| Ga0208644_11728281 | 3300025889 | Aqueous | MIRLTPSQITVDAAAAEGLPSRSISGVAVTYDETATVNDGTKVRFLQGSLPV |
| Ga0208644_12191461 | 3300025889 | Aqueous | MIRLTPTQITVDAAAAEGLPSRSISGVAVTYDETATVNDGTKVRFLQGSLPVTG |
| Ga0255082_10568421 | 3300027139 | Freshwater | MIRLTPSQITVDAAAAEGLPSRSISGVAVTYDETATV |
| Ga0208800_10035033 | 3300027193 | Estuarine | MIRLTPTQITVDAAAAEGLPSRSISGVAVTYDETATVNDGTKVRF |
| Ga0208800_10627632 | 3300027193 | Estuarine | MIKLTPSQITVDAAAADGQPRRSISGIAVEYNQTATVADGTQVQFKP |
| Ga0255220_10542771 | 3300027306 | Freshwater | MIRLSPSQITVDAAAAEGLPSRSISGVAVTYDETATVNDGTKVRFLQGSLPVTG |
| Ga0208960_11563061 | 3300027649 | Freshwater Lentic | MIRLTPSQITVDAAAAEGLPSRSISGVAVTYDETATVNDGTKVRFLQGSL |
| Ga0208975_12059822 | 3300027659 | Freshwater Lentic | MIRLTPSQITVDAAAAEGLPSRSISGVAVTYDETA |
| Ga0209443_10239893 | 3300027707 | Freshwater Lake | MIRLTPTQITVDAAAAEGLPSRSISGVAVTYDETATVNDGTKVRFLQGSLPVTGRNP |
| Ga0209297_12503451 | 3300027733 | Freshwater Lake | MIKLVPSLITVDAGAVGELPRRSISGIAVTYNETATVADGTQVRIMQG |
| Ga0209134_101091292 | 3300027764 | Freshwater Lake | MIRLTPSQITVDAGAVGELPRRSISGIAVTYDETAVVADGTKVRIMQGALP |
| Ga0209500_100983763 | 3300027782 | Freshwater Lake | MIKLTPTTMITVDAAAAEGLPRRSISGVAVTYDETATVADGTQVRFKQGSL |
| Ga0209500_102542782 | 3300027782 | Freshwater Lake | MIKLVPSLITVDAGAVGELPRRSISGIAVTYNETATVADGTKVRIMQGALPVDGRAPKL |
| Ga0209246_102028591 | 3300027785 | Freshwater Lake | MIRLTPQQITVDAAAADGVQRRTISGVAVEYGVTATVSDGTQVKFMPGSLSAA |
| Ga0209246_103234841 | 3300027785 | Freshwater Lake | MIRLTPTQITVDAAAAEGLPSRSISGVAVTYDETATVLDGTKVRFLQG |
| Ga0209353_104537491 | 3300027798 | Freshwater Lake | MIKLIPTQITVDAAAANGMPRRSISGIAVTYDETATVSDGTQVRVM |
| Ga0209354_100784612 | 3300027808 | Freshwater Lake | MITLTPSRITVDAAAAGQLPSRSISGVAVTYDETATVLDGTKVRFLQ |
| Ga0209354_102242012 | 3300027808 | Freshwater Lake | MIKLTPSQITVDAAAVGELPRRSISGIAVTYDETA |
| Ga0209893_10035382 | 3300027940 | Sand | MIRLTPSQITVDAAAAEGLPSRSISGVAVTYDETATVNDGTKVRFLQGSLPVTGRDPKIL |
| Ga0255216_10063151 | 3300028071 | Freshwater | MIRLTPSQITVDAAAAEGLPSRSISGVAVTYDETAVVNDGTKVRFL |
| Ga0255190_10711991 | 3300028083 | Freshwater | MIRLTPTQITVDAAAAEGLPSRSISGIAVTYDETATVNDGTQVRFLQGS |
| Ga0255193_10102511 | 3300028269 | Freshwater | MIRLTPTQITVDAAAAEGLPSRSISGIAVTYDETATVNDGTQVRFLQGSLPVT |
| Ga0307380_112058321 | 3300031539 | Soil | MIRLTPTQITVDAAAADDKPSRSISGVAVTYDETAIVNDGTKVRFLQGSLPVTGRDPK |
| Ga0307380_114087592 | 3300031539 | Soil | MIRLTPTQITVDAAAAEGLPSRSISGVAVTYDETAVVNDGTKVRFL |
| Ga0307379_103836001 | 3300031565 | Soil | MIKLTPTLITVDAAAAEGSPRRTISGVAVTYDQVATVSDGTQVKILQGALPVEGKNP |
| Ga0307379_109867492 | 3300031565 | Soil | MIRLTPTQITVDAAAADDKPSRSISGVAVTYDETATVNDGTQV |
| Ga0307379_111993421 | 3300031565 | Soil | MIQLIPSQITVDAAAVEGLPSRSISGVAVTYDETATVLDG |
| Ga0307378_103630511 | 3300031566 | Soil | MIRLIPSQITVDAAAVEGLPSRSISGVAVTYDETATVLDGTKVRFLQGALPVDGR |
| Ga0307378_103725711 | 3300031566 | Soil | MIQLIPSQITVDAAAVEGLPSRSISGVAVTYDETATVLDGTKVR |
| Ga0307376_105900432 | 3300031578 | Soil | MIRLIPSQITVDAAAVEGLPSRSISGVAVTYDETATVLDGTKV |
| Ga0307377_102968651 | 3300031673 | Soil | MIRLTPTQITVDAAAADDKPSRSISGIAVTYDETAVVNDGTKVRFLQGSL |
| Ga0315290_103834851 | 3300031834 | Sediment | MIRLTPMSITVDAAAADGAQRRTISGVAVEYNVTATVSDGTQ |
| Ga0315275_123572242 | 3300032401 | Sediment | MIKLTPTTMITVDAAAAEGLPRRSISGVAVTYDETTTVADG |
| Ga0334722_102209231 | 3300033233 | Sediment | MIKLIPTQITVDAAAANGMPRRSISGIAVTYDETATVSDGTQVRIMQGALPVEGR |
| Ga0334982_0329615_565_708 | 3300033981 | Freshwater | MIRLTPSQITVDAAAAEGLPSRSISGVAVTYDETATVNDGTKVRFLQG |
| Ga0310130_0053921_1028_1198 | 3300034073 | Fracking Water | MIRLSPSQITVDAAAAEGLPSRSISGVAVTYDETATVNDGTKVRFLQGSLPVTGRDP |
| Ga0335012_0142067_1_120 | 3300034093 | Freshwater | MIKLTPTTMITVDAAAAEGLPRRSISGVAVTYDETATVAD |
| Ga0335012_0150809_2_121 | 3300034093 | Freshwater | MIKLVPSQITVDAAAADGLPRRSISGVAVTYDETATVSDG |
| Ga0335035_0195270_1086_1247 | 3300034105 | Freshwater | MIRLTPSQITVDAAAAEGLPSRSISGVAVTYDETATVNDGTKVRFLQGSLPVTG |
| Ga0335036_0735658_1_117 | 3300034106 | Freshwater | MIRLTPSQITVDAAAAEGLPSRSISGVAVTYDETATISD |
| Ga0335066_0172134_3_176 | 3300034112 | Freshwater | MIRLTPTQITVDAAAAEGLPSRSISGVAVTYDETATVNDGTQVRFLQGSLPVTGRDPK |
| Ga0335068_0040183_2639_2782 | 3300034116 | Freshwater | MIKLVPSQITVDAAAADGLPRRSISGVAVTYDETATVSDGTRVRFLQG |
| Ga0335048_0233152_3_167 | 3300034356 | Freshwater | MIKLVPSQITVDAAAADGLPRRSISGVAVTYDETATVSDGTQVRFLQGSLPVTGR |
| Ga0348337_044643_1712_1855 | 3300034418 | Aqueous | MIRLTPTQITVDAAAAEGLPSRSISGVAVTYDETATISDGTKVRFLQG |
| ⦗Top⦘ |