| Basic Information | |
|---|---|
| Family ID | F051575 |
| Family Type | Metagenome |
| Number of Sequences | 144 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MRIGGEAPGGGPILSVGISAMFEYGFPPPRIVNSAVRRKASASAE |
| Number of Associated Samples | 122 |
| Number of Associated Scaffolds | 144 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.00 % |
| % of genes near scaffold ends (potentially truncated) | 31.94 % |
| % of genes from short scaffolds (< 2000 bps) | 65.28 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.19 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (56.944 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.361 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.611 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.167 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.44% β-sheet: 0.00% Coil/Unstructured: 83.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 144 Family Scaffolds |
|---|---|---|
| PF02371 | Transposase_20 | 39.58 |
| PF13610 | DDE_Tnp_IS240 | 2.08 |
| PF01548 | DEDD_Tnp_IS110 | 1.39 |
| PF04909 | Amidohydro_2 | 1.39 |
| PF14319 | Zn_Tnp_IS91 | 0.69 |
| PF14497 | GST_C_3 | 0.69 |
| PF12697 | Abhydrolase_6 | 0.69 |
| PF02776 | TPP_enzyme_N | 0.69 |
| PF13360 | PQQ_2 | 0.69 |
| PF08388 | GIIM | 0.69 |
| PF05598 | DUF772 | 0.69 |
| PF13424 | TPR_12 | 0.69 |
| PF07519 | Tannase | 0.69 |
| PF11306 | DUF3108 | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 40.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 56.94 % |
| Unclassified | root | N/A | 43.06 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2070309004|prs_FHA1B5K04ZB5FK | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 504 | Open in IMG/M |
| 3300001369|JGI12701J14581_1000795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1677 | Open in IMG/M |
| 3300001593|JGI12635J15846_10276885 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300001593|JGI12635J15846_10763752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 555 | Open in IMG/M |
| 3300001627|JGI20258J16339_100577 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100434878 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10072409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1345 | Open in IMG/M |
| 3300004633|Ga0066395_10086819 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
| 3300004633|Ga0066395_10123284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1281 | Open in IMG/M |
| 3300004633|Ga0066395_10594993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 647 | Open in IMG/M |
| 3300005174|Ga0066680_10372987 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300005186|Ga0066676_10881570 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300005353|Ga0070669_100871335 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300005435|Ga0070714_100216471 | All Organisms → cellular organisms → Bacteria | 1758 | Open in IMG/M |
| 3300005454|Ga0066687_10783437 | Not Available | 567 | Open in IMG/M |
| 3300005459|Ga0068867_100726337 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300005552|Ga0066701_10708586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 604 | Open in IMG/M |
| 3300005556|Ga0066707_10800409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 583 | Open in IMG/M |
| 3300005568|Ga0066703_10856919 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300005713|Ga0066905_100412148 | Not Available | 1099 | Open in IMG/M |
| 3300005764|Ga0066903_107370638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 568 | Open in IMG/M |
| 3300005840|Ga0068870_10802354 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300006047|Ga0075024_100491403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 642 | Open in IMG/M |
| 3300006175|Ga0070712_101066659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 700 | Open in IMG/M |
| 3300006755|Ga0079222_10224753 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300006845|Ga0075421_100872260 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300006845|Ga0075421_101312604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 801 | Open in IMG/M |
| 3300006914|Ga0075436_100493918 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300007255|Ga0099791_10312938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 749 | Open in IMG/M |
| 3300007788|Ga0099795_10637277 | Not Available | 509 | Open in IMG/M |
| 3300009137|Ga0066709_102521914 | Not Available | 692 | Open in IMG/M |
| 3300009147|Ga0114129_11926357 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300009147|Ga0114129_13052140 | Not Available | 549 | Open in IMG/M |
| 3300010043|Ga0126380_10113831 | Not Available | 1655 | Open in IMG/M |
| 3300010046|Ga0126384_10969257 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300010047|Ga0126382_11882620 | Not Available | 565 | Open in IMG/M |
| 3300010048|Ga0126373_10218955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1856 | Open in IMG/M |
| 3300010048|Ga0126373_10462087 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
| 3300010048|Ga0126373_10986641 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300010167|Ga0123353_13000194 | Not Available | 547 | Open in IMG/M |
| 3300010359|Ga0126376_12624452 | Not Available | 552 | Open in IMG/M |
| 3300010359|Ga0126376_12959647 | Not Available | 525 | Open in IMG/M |
| 3300010376|Ga0126381_100049913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5117 | Open in IMG/M |
| 3300010376|Ga0126381_102854725 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300010398|Ga0126383_11134863 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300011271|Ga0137393_11413832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 585 | Open in IMG/M |
| 3300012096|Ga0137389_10327207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium onobrychidis | 1301 | Open in IMG/M |
| 3300012208|Ga0137376_11311772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 614 | Open in IMG/M |
| 3300012361|Ga0137360_10716552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 859 | Open in IMG/M |
| 3300012362|Ga0137361_10911892 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300012944|Ga0137410_11248619 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300012971|Ga0126369_10046223 | All Organisms → cellular organisms → Bacteria | 3690 | Open in IMG/M |
| 3300012971|Ga0126369_10291671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1627 | Open in IMG/M |
| 3300016341|Ga0182035_10651818 | Not Available | 914 | Open in IMG/M |
| 3300016387|Ga0182040_11000379 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300016445|Ga0182038_11186306 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300018431|Ga0066655_11382820 | Not Available | 510 | Open in IMG/M |
| 3300021170|Ga0210400_11209691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 608 | Open in IMG/M |
| 3300021361|Ga0213872_10218592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 811 | Open in IMG/M |
| 3300021478|Ga0210402_11996902 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300021560|Ga0126371_13647352 | Not Available | 519 | Open in IMG/M |
| 3300021560|Ga0126371_13861212 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300025929|Ga0207664_10538462 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300025934|Ga0207686_10804195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 754 | Open in IMG/M |
| 3300026308|Ga0209265_1096638 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300026361|Ga0257176_1088311 | Not Available | 508 | Open in IMG/M |
| 3300027071|Ga0209214_1018864 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300027654|Ga0209799_1012292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1846 | Open in IMG/M |
| 3300027655|Ga0209388_1164678 | Not Available | 623 | Open in IMG/M |
| 3300027660|Ga0209736_1190860 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300027817|Ga0209112_10331410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 541 | Open in IMG/M |
| 3300027829|Ga0209773_10079683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1342 | Open in IMG/M |
| 3300027873|Ga0209814_10344757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 651 | Open in IMG/M |
| 3300028381|Ga0268264_10157174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2044 | Open in IMG/M |
| 3300031057|Ga0170834_112591113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 887 | Open in IMG/M |
| 3300031543|Ga0318516_10439355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 750 | Open in IMG/M |
| 3300031545|Ga0318541_10225356 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300031546|Ga0318538_10813002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 508 | Open in IMG/M |
| 3300031564|Ga0318573_10679588 | Not Available | 554 | Open in IMG/M |
| 3300031640|Ga0318555_10774563 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300031679|Ga0318561_10553468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 633 | Open in IMG/M |
| 3300031718|Ga0307474_10125381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1929 | Open in IMG/M |
| 3300031719|Ga0306917_10034832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3275 | Open in IMG/M |
| 3300031719|Ga0306917_11342415 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300031747|Ga0318502_10496635 | Not Available | 731 | Open in IMG/M |
| 3300031763|Ga0318537_10172075 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300031770|Ga0318521_10327187 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300031777|Ga0318543_10418049 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300031781|Ga0318547_10478415 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300031795|Ga0318557_10117516 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
| 3300031879|Ga0306919_11276306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium muleiense | 556 | Open in IMG/M |
| 3300031910|Ga0306923_11281305 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300031941|Ga0310912_10861465 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300031954|Ga0306926_10053866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4823 | Open in IMG/M |
| 3300032042|Ga0318545_10350410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 531 | Open in IMG/M |
| 3300032065|Ga0318513_10165992 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300032261|Ga0306920_100340396 | All Organisms → cellular organisms → Bacteria | 2232 | Open in IMG/M |
| 3300032261|Ga0306920_101108749 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300032261|Ga0306920_102935424 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300032261|Ga0306920_103959258 | Not Available | 538 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.36% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.19% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.03% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.86% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.08% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.08% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.39% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.39% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.39% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.69% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.69% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.69% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.69% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.69% |
| Green-Waste Compost | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost | 0.69% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2070309004 | Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto Rico | Environmental | Open in IMG/M |
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300001369 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001627 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF024 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Host-Associated | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027023 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| prs_04266690 | 2070309004 | Green-Waste Compost | RIGGEAPGGGTNLQVDIRASSNHGFPPPRIVDSAVRRKVSASAE |
| E41_09677260 | 2170459005 | Grass Soil | MRIGGKALGGGPILSVGINAMFEYGFPPPRIVSSAVRR |
| JGI12701J14581_10007952 | 3300001369 | Forest Soil | LDPDHDAVMRIGGEAPGGGPILSVGISAMFEYGFPPPRIVNSAVRRKASASAE* |
| JGI12635J15846_102768851 | 3300001593 | Forest Soil | RIGGEAPGGGPILSVGIGAMFEYGFPPPRIVNSAVRRKASAR* |
| JGI12635J15846_107637522 | 3300001593 | Forest Soil | HDAVMRIGGEAPGGGPILSVGISAMFEYGFPPPRIVDSAVRRKASASAE* |
| JGI20258J16339_1005772 | 3300001627 | Forest Soil | MRIGGEAPGGGPILSVGLKCQVEYGFPPPRIVNSAVVRKASASAEWC* |
| JGIcombinedJ26739_1004348782 | 3300002245 | Forest Soil | DHDAVMRIGGEAPGGGPILSVGINAMFEYGFPPPRIVNSAVRRKASASAE* |
| JGIcombinedJ26739_1011855841 | 3300002245 | Forest Soil | MRIGGEAPAGGPILSVGINAMFEYGFPPPRIVSSAVRR |
| JGIcombinedJ51221_100724092 | 3300003505 | Forest Soil | GGEAPGGGPILSVGIKAMFEYGFPPPRIVNSAVRRKASASAE* |
| Ga0066395_100868192 | 3300004633 | Tropical Forest Soil | MRIGGEAPGGGANLLVGIRASSNHGFPPPRIVNSAVRRKASASAE* |
| Ga0066395_101232842 | 3300004633 | Tropical Forest Soil | MRIGGEAPGGGAILSVGIRASSNHGFPPPRIGNSAVRRIAQW* |
| Ga0066395_105949933 | 3300004633 | Tropical Forest Soil | MRIGGEAPGGGANLSVGIRASSNHGFPPPRIVNSAVRRKASASAE* |
| Ga0066672_102964421 | 3300005167 | Soil | MRIGGKAPGGGPILPVGISAMFEYGFPPPRIVDPAHRRKPSASAE* |
| Ga0066680_103729872 | 3300005174 | Soil | MRIGGEAPGGGSILSVGISAMFEYGFPPPRIVNSAVRRKASASAE* |
| Ga0066676_108815701 | 3300005186 | Soil | MRIGGEAPGGGPILSVGISAMFEYGFPPPRIVNSAVRRKASASAE* |
| Ga0070669_1008713351 | 3300005353 | Switchgrass Rhizosphere | IGGEAPGGGANLPVGIRASSNHGFPPPRIVNSAVRRKASASAE* |
| Ga0070714_1002164711 | 3300005435 | Agricultural Soil | MRIGGEAPGGGPILLVGIGAMFEYGFPPPRIVNSAVRRKASASAE* |
| Ga0066687_107834372 | 3300005454 | Soil | MRICGEAPGGGPILSVGIKAMFEYGVPPPRIVNSAVRRKASASTDQV |
| Ga0068867_1007263371 | 3300005459 | Miscanthus Rhizosphere | MRIGGEAPGGGPILSVGISAMFEYGFPPPRIVNSAVRRKPSTSAEWC* |
| Ga0066701_107085861 | 3300005552 | Soil | MRIGGEAPGGGSILSVGISAMFEYGFPPPRIVDSAVRRKASASAE* |
| Ga0066661_103874912 | 3300005554 | Soil | MRIGGKAPGGGPILSVGISAMFEYGFPPPRIVNSAVRRKASASAE* |
| Ga0066707_108004091 | 3300005556 | Soil | MRIGGGSGSGPILSVGISAMFEYGFPPPRIVDSAVRRKASASAE* |
| Ga0066703_108569191 | 3300005568 | Soil | PDHDAVMRIGGEAPGGGPILSVGISAMFEYGFPPPRIVNSAVRRKASASAE* |
| Ga0066705_107174482 | 3300005569 | Soil | MRIGGKAPGGGPILSVGINAMFEYGVPPPRIVNSAVG* |
| Ga0066694_101399822 | 3300005574 | Soil | MRIGGEAPGGGSILSVGLKAMFEYGFPPPRIVNSAV |
| Ga0070702_1012796701 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | DHDAVMRIGGEAPGGGPILSVGINARFEYGFPPPRIVNSAIG* |
| Ga0066905_1004121482 | 3300005713 | Tropical Forest Soil | MRIGCEAPGGGANLFVGISASSNHGFPPPRIVNSAVRRK |
| Ga0066903_1073706381 | 3300005764 | Tropical Forest Soil | MRIGGEAPGGGAILSVGISASSNHGFPPPRIVNSAVRRKASASAEMAQW* |
| Ga0068870_108023542 | 3300005840 | Miscanthus Rhizosphere | DPDHDAVMRIGGEAPGGGPILSVGISAMFEYGFPPPRIVNSAVRRKPSTSAEWC* |
| Ga0075024_1004914032 | 3300006047 | Watersheds | LILNHDAVMRIGGEAPGGGPILSVGISAMFEFGFPPPRIVNSAVREASASAE* |
| Ga0075432_100300082 | 3300006058 | Populus Rhizosphere | MRIGGEAPGGGPILSVGINARFEYGFPPPRIVNSAIG* |
| Ga0070712_1004012841 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRIGGKAPGGGPILSVGIGAMFEYGFPPPRIVNSAVG* |
| Ga0070712_1010666592 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRIGGEAPGGGANLPVGIRASSNHGFPPPRIVNSAVRRKASASAE* |
| Ga0079222_102247531 | 3300006755 | Agricultural Soil | MRIGGEAPGGGANLSRHQSQFESRLPATRIVNSAVRQKASASAE* |
| Ga0079221_104335832 | 3300006804 | Agricultural Soil | LDPDHDAVMRIGGETPGGGPILLVGIGATFEYGFPPPRIVNPAVGLKDSTSAE* |
| Ga0075421_1008722601 | 3300006845 | Populus Rhizosphere | EAPGGGANLPVGIRASSNHGFPPPRIVNSAVRRKASASAE* |
| Ga0075421_1013126042 | 3300006845 | Populus Rhizosphere | MRIGGEAPGGGANLPVGIRASSNHGFPPLGSSIRLRPKASASAE* |
| Ga0075436_1004939181 | 3300006914 | Populus Rhizosphere | PDHDAVMRIGGEAPGGGANLPVGIRASSNHGFPPPRIVNSAVRRKASASAE* |
| Ga0099791_103129382 | 3300007255 | Vadose Zone Soil | MRIGGEAPGGGPILSVGINAMFEYGFPPPRIVNSAVRRKASASAE* |
| Ga0099795_106372772 | 3300007788 | Vadose Zone Soil | MRIGGEAPGGGPILSIGISAMFEYGFPPPRIVNSAVR* |
| Ga0066709_1025219142 | 3300009137 | Grasslands Soil | MRIGGEAPGGGPILSVGISAMFESGFPPPRIVNSAVRRKASASAE* |
| Ga0066709_1027278651 | 3300009137 | Grasslands Soil | MRIGGEAPGGGPILSVGISAMFEYGFPPPRIVNSAV |
| Ga0114129_119263572 | 3300009147 | Populus Rhizosphere | GGEAPGGGAILFVGISASSNHGFPPLGSSIRLRPKASASAE* |
| Ga0114129_130521402 | 3300009147 | Populus Rhizosphere | MRIGGEAPGGGPILSVGISAMFEYGFRPPRIVNSAVRRKASASAE* |
| Ga0105237_119168601 | 3300009545 | Corn Rhizosphere | MRIGGKAPGSGPILPVGISAMFEYGFPPPRIVNSA |
| Ga0126380_101138311 | 3300010043 | Tropical Forest Soil | MRIGGEAPGGGANLSVAISASSNHGFPPPRIVNSAVRRKASERRIVQ |
| Ga0126384_109692572 | 3300010046 | Tropical Forest Soil | MRIGGEAPGGGANLPVGIRASSNHGFPPPRIVNSAAPKASASAE* |
| Ga0126382_118826201 | 3300010047 | Tropical Forest Soil | MRIGGEAPGGGANLPVGIRASSNHGFPPPRIVNSAVRRKASA |
| Ga0126373_102189552 | 3300010048 | Tropical Forest Soil | MRIGGEVPGGGPILSVGIGAMFAHGFPPPRIVSSAIG* |
| Ga0126373_104620872 | 3300010048 | Tropical Forest Soil | RIGGEAPGGGANLSVGIRASSNHGFPPPRIVNSAVRRKASASAE* |
| Ga0126373_109866411 | 3300010048 | Tropical Forest Soil | HDAVMRIGGEAPGGGANLSVGIRASSNHGFPPPRIVNSAVRRKASASAE* |
| Ga0123353_130001941 | 3300010167 | Termite Gut | MRIGGEAPGGVAILPVGIRASSNHGFPPPRIVNSAVRRKASASAE* |
| Ga0126376_126244522 | 3300010359 | Tropical Forest Soil | MRIGGEAPGGGAILFVGIRASSNHGFPPPRIVNSAVRRKAS |
| Ga0126376_129596471 | 3300010359 | Tropical Forest Soil | MRIGGEAPGGGPILSVGISARFEYGFPPPRIVNSAVVLKAPA |
| Ga0126381_1000499136 | 3300010376 | Tropical Forest Soil | MRIGGEAPGGGAILSVGISASSNHGFPPPRIVNSAVRRKASASAEMVQW* |
| Ga0126381_1028547252 | 3300010376 | Tropical Forest Soil | DHDAVMRIGGEAPGGGANLSVGIRASSNHGFPPPRIVNSAVRRKASASAE* |
| Ga0126381_1049896551 | 3300010376 | Tropical Forest Soil | MRIGGKAPGGGPILTVGISAMFEYGFPPPRIVNSAIVLKASASAEWC* |
| Ga0126383_111348631 | 3300010398 | Tropical Forest Soil | GGEAPGGGVILSVGISASSNHGFPPPRIVNSAVRRKASASAEMAQW* |
| Ga0137391_104755152 | 3300011270 | Vadose Zone Soil | MRIGGKAPGDGPILSVGISAMFEYGFPPPRIVNSAVVLEASASAEYC* |
| Ga0137393_114138323 | 3300011271 | Vadose Zone Soil | VMRIGGEAPGSGPILSVGISAMFEYGFPPPRIVSSAARRKASASAE* |
| Ga0137389_103272072 | 3300012096 | Vadose Zone Soil | PDHDAVMRIGGEAPGGGPILSVGISAMFEYGFPPPRIVSSAVRRKASASAE* |
| Ga0137380_111407182 | 3300012206 | Vadose Zone Soil | MRIGGEAPGGGPILSVGISAMFEYGFPPPRIVNSAVG* |
| Ga0137376_113117722 | 3300012208 | Vadose Zone Soil | MRIGGEAPGGGPILSVGISAMFGYGFPPPRIVDSAVRRKASASAE* |
| Ga0137372_109882541 | 3300012350 | Vadose Zone Soil | RIGGKAPGGGPILSVGISAMFEYGFPPPRIVNPAVG* |
| Ga0137384_100472331 | 3300012357 | Vadose Zone Soil | MRIGGKAPGGEPILSVGISAMFEYGFPPPRIVNSAVG* |
| Ga0137360_107165522 | 3300012361 | Vadose Zone Soil | MRIGGEAPGGGPILSVGISAMFEYGFPPPRIVNSTVRRKASASAE* |
| Ga0137361_109118921 | 3300012362 | Vadose Zone Soil | MRIGGEAPVGPGMKDTGRGKPADILSVGISAMFEYGFPPPRIVNSAVRRKASASAE* |
| Ga0137413_111916271 | 3300012924 | Vadose Zone Soil | MRIGGEAPGGGPILSVGISAMFEYGVPPPRIVNSAVG* |
| Ga0137407_109632941 | 3300012930 | Vadose Zone Soil | MRIGGRAPGGGPILSVGISAMFEYGFPPPRIVNPAVG* |
| Ga0137410_112486192 | 3300012944 | Vadose Zone Soil | MRIGGEAPGGGPILSVGINAMFEYGFPPPRIVNSGVCRKASATAE* |
| Ga0126369_100462231 | 3300012971 | Tropical Forest Soil | MRIGGEAPGGGAILFVGIRASSNHGFPPPRIVNSAVRRKASASAE* |
| Ga0126369_102916713 | 3300012971 | Tropical Forest Soil | MRIGGEAPGGGTNLSVGIRASSNHGFPPPRIVNSAVRRKASASAE* |
| Ga0134081_102814821 | 3300014150 | Grasslands Soil | MRIGGKAPGGGPILPVGISAMFEYGFPPPRIVDPAH |
| Ga0137403_101383212 | 3300015264 | Vadose Zone Soil | MRIGGKAPGGGPILSVGISAMFEYGFPPPRIVNPAVG* |
| Ga0137403_101740642 | 3300015264 | Vadose Zone Soil | MRIGGEAPGGGPILSVGINAMFEYGFPPPRIVSSAVR* |
| Ga0182035_106518181 | 3300016341 | Soil | MRIGGEAPGGGTILSVGIRASSNHGFPPPRIVNSAV |
| Ga0182040_110003791 | 3300016387 | Soil | DAVMRIGGEAPGGGANLSVGIRASSNHGFPPPRIVNSAVRRKASASAE |
| Ga0182038_111863061 | 3300016445 | Soil | GAILSVGISASSNHGFPPPQIVNSAVRRKASASAEMAQW |
| Ga0182038_116512441 | 3300016445 | Soil | MRIDGKAPGGGANLQVGIRASSNHGFPPPRIVNSA |
| Ga0187820_12251361 | 3300017924 | Freshwater Sediment | MRIGGKAPGGGPILSVGISAMFEYGFPPPRIVNRQ |
| Ga0066655_113828202 | 3300018431 | Grasslands Soil | MRIGGETPGDGPILLVGIGATFEYGFPPPRIVNSAVGLNDSTSAD |
| Ga0066669_124435742 | 3300018482 | Grasslands Soil | MRIGGKAPGGGPILSVGINAMFEYGVPPPRIVNSAVG |
| Ga0210406_108638451 | 3300021168 | Soil | MRMGGKAPGGGPILSVGISAMFEYGFPPPRIVNRQS |
| Ga0210400_112096912 | 3300021170 | Soil | MRIGGEAPGGGPILSVGISAMFEYGFPPPRIVNSAVRRKASA |
| Ga0210405_111604411 | 3300021171 | Soil | MRIGGEAPGGGPILSVGISAMFEYGFPPPRIVNSAVG |
| Ga0210396_113165441 | 3300021180 | Soil | MRIGGEAPGGGPILSVGISAMFVLRFPPPRIVSSA |
| Ga0213872_102185921 | 3300021361 | Rhizosphere | MRIDGEAPGGGANLSVGIRASSNHGFPPPRIVNSAVRRKASAGAE |
| Ga0210402_119969022 | 3300021478 | Soil | EAPGGGPILSVGISAMFEYGFPPPRIVNSAVRRKASASAE |
| Ga0126371_136473521 | 3300021560 | Tropical Forest Soil | MRIGCEAPGGGANLFVGISASSNHGFPPPRIVNSAVRRKASAR |
| Ga0126371_138612122 | 3300021560 | Tropical Forest Soil | MRIGGEAPGGGPILLVGIGARFEYGFPPPRIVNSAVVPKASASAEWC |
| Ga0207663_111293082 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MRIGGKAPGGGPILSVGIGAMFEYGFPPPRIVNSAVG |
| Ga0207664_101008663 | 3300025929 | Agricultural Soil | MRIGGKAPGDGPILSVGISAMFEYGFPPPRIVNSAVG |
| Ga0207664_105384621 | 3300025929 | Agricultural Soil | MRIGGEAPGGGPILLVGIGAMFEYGFPPPRIVNSAVRRKASASAE |
| Ga0207686_108041951 | 3300025934 | Miscanthus Rhizosphere | MRIGGEAPGGGANLPVGIRASSNHGFPPPRIVNSAVR |
| Ga0209265_10966382 | 3300026308 | Soil | MRIGGKAPGGGPILPVGISAMFEYGFPPPRIVDPAHRRKPSASAE |
| Ga0209055_12667012 | 3300026309 | Soil | HDAVMRIGGEAPGGGPILSVGISAMFEYGVPPPRIVNSALG |
| Ga0209687_12523782 | 3300026322 | Soil | MRIGGKAPGGGPILSVGISAMFEYGFPPPRIANSAVG |
| Ga0257176_10883112 | 3300026361 | Soil | MRIGGEAPGGGPILSVGISAMFVLRFPPPRIVNSAVR |
| Ga0179593_10286061 | 3300026555 | Vadose Zone Soil | MRIGGEAPGGGPILSVGISAMFVLRLPPPRIVNSA |
| Ga0207736_1081482 | 3300027023 | Tropical Forest Soil | MRIGGEAPGGGPILSVGISARFEYGFPPPRIVNSAVVL |
| Ga0209214_10188641 | 3300027071 | Forest Soil | MRIGGKAPGGGAILSVGINASSNHGFPPPRIINSAVRPEASASAE |
| Ga0209179_11103981 | 3300027512 | Vadose Zone Soil | MRIGGKAPGGGPILSIGISATFEYGFPPPRIAIRQSC |
| Ga0209799_10122922 | 3300027654 | Tropical Forest Soil | MRIGGEAPGGGANLSVGIRASSNHGFPPPRIVNSAAPKASASAE |
| Ga0209388_11646782 | 3300027655 | Vadose Zone Soil | MRIGGEAPGGGPILSVGINAMFEYGFPPPRIVNSAVRRKASASAE |
| Ga0209736_11908602 | 3300027660 | Forest Soil | MRIGGEAPGGGPILSVGISAMFEYGFPPPRIVNSAVRRKPSTSAEWC |
| Ga0209177_100280762 | 3300027775 | Agricultural Soil | MRIGGETPGGGPILLVGIGATFEYGFPPPRIVNPAVGLKDSTSAE |
| Ga0209112_103314101 | 3300027817 | Forest Soil | PDHDAVMRIGGEAPGGGPILSGRRSAMFEYGVLPPRIVIGSRAEKPARAEWC |
| Ga0209773_100796831 | 3300027829 | Bog Forest Soil | MRIGGEAPGGGPILSVGISAMFVLRFPPPRIVNSAARE |
| Ga0209814_103447571 | 3300027873 | Populus Rhizosphere | MRIGGEAPGGGANLPVGIRASSNHGFPPSRIVNSAVRRKASASAE |
| Ga0268264_101571742 | 3300028381 | Switchgrass Rhizosphere | MRIGGEAPGGGANLPVGIRASSNHGFPPPRIVNSAVRRKASASAE |
| Ga0170834_1125911132 | 3300031057 | Forest Soil | MRIGGEAPGGGAILSVGISASSNHGFPPPRIVNSAVRRKASASAEIAQW |
| Ga0170822_171690641 | 3300031122 | Forest Soil | MRIGGEAPGGGPILSVGISARFEYGFPPPRIVNSA |
| Ga0318516_104393551 | 3300031543 | Soil | MRIGGEAPGGGTNLQVGIRASSNHGFPPPRIVNSAVRRKASASAE |
| Ga0318541_102253561 | 3300031545 | Soil | MRIGGEAPGGGTNLQVGIRASSNHGFPPPRIVNSAVRRKVSASAE |
| Ga0318538_108130021 | 3300031546 | Soil | MRIGGEAPGGGANLQVGIRASSNHGFPPPRIVNSAVRRKASASAE |
| Ga0318573_106795881 | 3300031564 | Soil | MRIGGEAPGGGAILSVGIRASSNHGFPPLGSSIRQCAEASA |
| Ga0318555_107745632 | 3300031640 | Soil | MRIGGEAPGGGPILLVGIGARFEYGFPPPRIVNSAVVPKTSASAEWC |
| Ga0318561_105534681 | 3300031679 | Soil | MRIDGKAPGGGANLQVGIRASSNHGFPPPRIVNSAS |
| Ga0307474_101253811 | 3300031718 | Hardwood Forest Soil | MRIGGEAPGGGPILSVGIGAMFEYGFPPPRIVNSAVRRKASASAG |
| Ga0306917_100348324 | 3300031719 | Soil | MRIGGEAPGGGPILSVGISARFEYGFPSPRIVNSAVVLKAPAQA |
| Ga0306917_113424151 | 3300031719 | Soil | AKLPGGGANLLVGIRASSNHGFPPPRIVNSAVRRKASASAE |
| Ga0318502_104966352 | 3300031747 | Soil | MRIGGEAPGGGANLLVGIRASSNHGFPPPRIVNSAVRRKASASAELVQW |
| Ga0307477_102560282 | 3300031753 | Hardwood Forest Soil | MRIGGEAPGGGPILSVGISARFEYGFPPPRIVKFGSRAEKASASAEC |
| Ga0318537_101720752 | 3300031763 | Soil | PDHDAVMRIGGEAPGGGAILSVGIRASSNHGFPPLGSSIRQCAEASASAE |
| Ga0318521_103271873 | 3300031770 | Soil | MRIGGEAPGGGPILSVAISARFEYGFPPPRIVNSAVVLKA |
| Ga0318543_104180491 | 3300031777 | Soil | MRIGGEAPGGEAILSVGIRASSNHGFPPPRIVNSAVRRKASASAE |
| Ga0318547_104784152 | 3300031781 | Soil | MRIGGEAPGGGPILLVGIGARFEYGFPPPRIVNSAVVPKTSASAEW |
| Ga0318557_101175162 | 3300031795 | Soil | MRIGGEAPGGGANLQVGIRASSNHGFPPPRIVNSAVRRKASASAELVQW |
| Ga0318499_104115801 | 3300031832 | Soil | MRIGGEAPGGGPLLSVGISEGFEYGFPPPRIVNRQ |
| Ga0306919_112763061 | 3300031879 | Soil | EAPGGGANLLVGIRASSNHGFPPPRIVNSAVRRKASASAE |
| Ga0306925_103734621 | 3300031890 | Soil | MQNSPAGGEAPGGGPILSVGISARFEYGFPPPRIV |
| Ga0306923_112813052 | 3300031910 | Soil | AVMRIGGEAPGGGANLSVGIRASSNHGFPPPRIVNSAVRRKASASAE |
| Ga0306921_111153851 | 3300031912 | Soil | MQNSPAGGEAPGGGPILSVGISARFEYGFPPPRIVNSA |
| Ga0310912_108614651 | 3300031941 | Soil | MRIGGEAPGGGPILLVGIGARFEYGFPPPRIVNSAVVLKASTSAEWC |
| Ga0306926_100538664 | 3300031954 | Soil | MRIGGEAPGGGANLLVGIRASSNHGFPPPRIVNSAVRRKASASAE |
| Ga0318545_103504101 | 3300032042 | Soil | HDAVMRIGGEAPGGGANLSVGIRASSNHGFPPPRIVNSAVRRNASASAE |
| Ga0318505_101107793 | 3300032060 | Soil | MRIGGEAPGGGPILSVGISARFEYGFPSPRIVNSAVVLKAPAQAPKM |
| Ga0318510_100383522 | 3300032064 | Soil | PDHDAIMRIGGEAPGGGPILSVGISARFEYGFPPPRIVN |
| Ga0318513_101659922 | 3300032065 | Soil | RIDGEAPGGGANLPVGIRASSNHGVPPPRIVNSAVRRKASASAE |
| Ga0318525_104867131 | 3300032089 | Soil | MRIGGKAPGGGPILSVGISCHVNNRFPPPRIVNRQF |
| Ga0306920_1003403961 | 3300032261 | Soil | HDAVMRIGGEAPGGGPILLVGIGARFEYGFPPPRIVNSAVVPKTSASAEWC |
| Ga0306920_1011087491 | 3300032261 | Soil | MRIGGEAPGGGANLSVGIRASSNHGFPPPRIVNSAVRRNASASAE |
| Ga0306920_1029354241 | 3300032261 | Soil | MQNSPAGGEAPGGGPILSVGISARFEYGFPPPRIVNSAVVLKAP |
| Ga0306920_1039592581 | 3300032261 | Soil | MRIGGEAPGGGPILLVGIGARFEYGFPPPRIVNSAVVLKASTS |
| ⦗Top⦘ |