Metagenome / Metatranscriptome Family F051443

Basic Information
Family ID	F051443
Family Type	Metagenome / Metatranscriptome
Number of Sequences	144
Average Sequence Length	41 residues
Representative Sequence	VKAKDVVREADEAGLRLVRFLWCGNDGTVRAKASGRHGLEG
Number of Associated Samples	123
Number of Associated Scaffolds	144

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	53.47 %
% of genes near scaffold ends (potentially truncated)	99.31 %
% of genes from short scaffolds (< 2000 bps)	92.36 %
Associated GOLD sequencing projects	119
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.64

Most Common Taxonomy
Group	Bacteria (90.972 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.111 % of family members)
Environment Ontology (ENVO)	Unclassified (38.194 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (47.222 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 21.74% β-sheet: 20.29% Coil/Unstructured: 57.97%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 144 Family Scaffolds
PF13520	AA_permease_2	9.72
PF01717	Meth_synt_2	4.17
PF07690	MFS_1	4.17
PF01546	Peptidase_M20	2.78
PF05488	PAAR_motif	2.78
PF00005	ABC_tran	2.08
PF00248	Aldo_ket_red	2.08
PF06737	Transglycosylas	2.08
PF01694	Rhomboid	1.39
PF00175	NAD_binding_1	1.39
PF17164	DUF5122	1.39
PF00106	adh_short	1.39
PF00817	IMS	0.69
PF03591	AzlC	0.69
PF01070	FMN_dh	0.69
PF07883	Cupin_2	0.69
PF08823	PG_binding_2	0.69
PF03007	WES_acyltransf	0.69
PF07687	M20_dimer	0.69
PF07676	PD40	0.69
PF13560	HTH_31	0.69
PF12848	ABC_tran_Xtn	0.69
PF06974	WS_DGAT_C	0.69
PF14333	DUF4389	0.69
PF14559	TPR_19	0.69
PF01180	DHO_dh	0.69
PF10584	Proteasome_A_N	0.69
PF13224	DUF4032	0.69
PF13180	PDZ_2	0.69
PF02633	Creatininase	0.69
PF16952	Gln-synt_N_2	0.69
PF00903	Glyoxalase	0.69
PF05977	MFS_3	0.69
PF08281	Sigma70_r4_2	0.69

COG ID	Name	Functional Category	% Frequency in 144 Family Scaffolds
COG0620	Methionine synthase II (cobalamin-independent)	Amino acid transport and metabolism [E]	4.17
COG4104	Zn-binding Pro-Ala-Ala-Arg (PAAR) domain, involved in Type VI secretion	Intracellular trafficking, secretion, and vesicular transport [U]	2.78
COG0069	Glutamate synthase domain 2	Amino acid transport and metabolism [E]	1.39
COG0705	Membrane-associated serine protease, rhomboid family	Posttranslational modification, protein turnover, chaperones [O]	1.39
COG1304	FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase	Energy production and conversion [C]	1.39
COG0042	tRNA-dihydrouridine synthase	Translation, ribosomal structure and biogenesis [J]	0.69
COG0167	Dihydroorotate dehydrogenase	Nucleotide transport and metabolism [F]	0.69
COG0389	Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair	Replication, recombination and repair [L]	0.69
COG1296	Predicted branched-chain amino acid permease (azaleucine resistance)	Amino acid transport and metabolism [E]	0.69
COG1402	Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis)	Coenzyme transport and metabolism [H]	0.69
COG2070	NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family	General function prediction only [R]	0.69
COG2814	Predicted arabinose efflux permease AraJ, MFS family	Carbohydrate transport and metabolism [G]	0.69
COG3342	Uncharacterized conserved protein, Ntn-hydrolase superfamily	General function prediction only [R]	0.69
COG4908	Uncharacterized conserved protein, contains a NRPS condensation (elongation) domain	General function prediction only [R]	0.69

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	91.67 %
Unclassified	root	N/A	8.33 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	91.67 %
Unclassified	root	N/A	8.33 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	90.97 %
Unclassified	root	N/A	8.33 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.69 %

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	65.28 %
Unclassified	root	N/A	8.33 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.78 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	0.69 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.69 %

Name	Rank	Taxonomy	Distribution
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	43.06 %
Unclassified	root	N/A	8.33 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	3.47 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.78 %
Rhizaria	clade	All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria	0.69 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.69 %

Name	Rank	Taxonomy	Distribution
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	35.42 %
Unclassified	root	N/A	8.33 %
Thermoleophilia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	3.47 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.78 %
Retaria	clade	All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria	0.69 %
Chloroflexia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia	0.69 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.69 %

Name	Rank	Taxonomy	Distribution
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	35.42 %
Unclassified	root	N/A	8.33 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.78 %
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1.39 %
Miltoncostaeales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales	0.69 %
unclassified Chloroflexia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia	0.69 %
unclassified Thermoleophilia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia	0.69 %
Cytophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia	0.69 %
Foraminifera	phylum	All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera	0.69 %

Name	Rank	Taxonomy	Distribution
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	35.42 %
Unclassified	root	N/A	8.33 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.78 %
Solirubrobacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae	1.39 %
Chloroflexia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium	0.69 %
Thermoleophilia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium	0.69 %
Miltoncostaeaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae	0.69 %
Monothalamids	clade	All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids	0.69 %
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	0.69 %

Name	Rank	Taxonomy	Distribution
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	35.42 %
Unclassified	root	N/A	8.33 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.78 %
Solirubrobacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter	1.39 %
Miltoncostaea	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea	0.69 %
Spirosomaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae	0.69 %
Reticulomyxidae	family	All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae	0.69 %
Chloroflexia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium	0.69 %
Thermoleophilia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium	0.69 %

Name	Rank	Taxonomy	Distribution
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	35.42 %
Unclassified	root	N/A	8.33 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.78 %
Solirubrobacter pauli	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter pauli	1.39 %
Miltoncostaea marina	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea → Miltoncostaea marina	0.69 %
Reticulomyxa	genus	All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa	0.69 %
Spirosomaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae	0.69 %
Chloroflexia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium	0.69 %
Thermoleophilia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium	0.69 %

Name	Rank	Taxonomy	Distribution
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	35.42 %
Unclassified	root	N/A	8.33 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.78 %
Solirubrobacter pauli	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter pauli	1.39 %
Reticulomyxa filosa	species	All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa	0.69 %
Miltoncostaea marina	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea → Miltoncostaea marina	0.69 %
Spirosomaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae	0.69 %
Chloroflexia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium	0.69 %
Thermoleophilia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium	0.69 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000956\|JGI10216J12902_118330133	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	665	Open in IMG/M
3300000956\|JGI10216J12902_123348871	All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa	1904	Open in IMG/M
3300001305\|C688J14111_10027188	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1699	Open in IMG/M
3300004463\|Ga0063356_104079233	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea → Miltoncostaea marina	629	Open in IMG/M
3300004479\|Ga0062595_100245469	All Organisms → cellular organisms → Bacteria	1156	Open in IMG/M
3300004479\|Ga0062595_101298801	All Organisms → cellular organisms → Bacteria	655	Open in IMG/M
3300005093\|Ga0062594_100473523	All Organisms → cellular organisms → Bacteria	1047	Open in IMG/M
3300005093\|Ga0062594_100583005	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	974	Open in IMG/M
3300005294\|Ga0065705_10699252	All Organisms → cellular organisms → Bacteria	653	Open in IMG/M
3300005330\|Ga0070690_100417792	All Organisms → cellular organisms → Bacteria	988	Open in IMG/M
3300005332\|Ga0066388_102425268	All Organisms → cellular organisms → Bacteria	952	Open in IMG/M
3300005435\|Ga0070714_101973015	All Organisms → cellular organisms → Bacteria	569	Open in IMG/M
3300005535\|Ga0070684_101971574	All Organisms → cellular organisms → Bacteria	551	Open in IMG/M
3300005536\|Ga0070697_100725405	All Organisms → cellular organisms → Bacteria	878	Open in IMG/M
3300005553\|Ga0066695_10767079	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	559	Open in IMG/M
3300005554\|Ga0066661_10909845	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	514	Open in IMG/M
3300005561\|Ga0066699_10301630	All Organisms → cellular organisms → Bacteria	1140	Open in IMG/M
3300005576\|Ga0066708_11026829	All Organisms → cellular organisms → Bacteria	512	Open in IMG/M
3300005587\|Ga0066654_10761799	All Organisms → cellular organisms → Bacteria	547	Open in IMG/M
3300005618\|Ga0068864_102440014	All Organisms → cellular organisms → Bacteria	529	Open in IMG/M
3300005764\|Ga0066903_102399524	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1020	Open in IMG/M
3300005764\|Ga0066903_102966090	All Organisms → cellular organisms → Bacteria	920	Open in IMG/M
3300005843\|Ga0068860_100133931	All Organisms → cellular organisms → Bacteria	2379	Open in IMG/M
3300005844\|Ga0068862_101029179	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	816	Open in IMG/M
3300005874\|Ga0075288_1026858	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	834	Open in IMG/M
3300006031\|Ga0066651_10611135	All Organisms → cellular organisms → Bacteria	580	Open in IMG/M
3300006169\|Ga0082029_1523131	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	603	Open in IMG/M
3300006794\|Ga0066658_10551774	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	626	Open in IMG/M
3300006797\|Ga0066659_11635929	All Organisms → cellular organisms → Bacteria	542	Open in IMG/M
3300006800\|Ga0066660_10066716	All Organisms → cellular organisms → Bacteria	2423	Open in IMG/M
3300006845\|Ga0075421_100835132	All Organisms → cellular organisms → Bacteria	1057	Open in IMG/M
3300006845\|Ga0075421_102281831	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	569	Open in IMG/M
3300006847\|Ga0075431_102079088	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	523	Open in IMG/M
3300006854\|Ga0075425_100250075	All Organisms → cellular organisms → Bacteria	2039	Open in IMG/M
3300009012\|Ga0066710_101421300	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1074	Open in IMG/M
3300009012\|Ga0066710_103269028	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	620	Open in IMG/M
3300009088\|Ga0099830_10229361	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1463	Open in IMG/M
3300009089\|Ga0099828_11977889	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	510	Open in IMG/M
3300009090\|Ga0099827_10083704	All Organisms → cellular organisms → Bacteria	2498	Open in IMG/M
3300009094\|Ga0111539_12915394	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	553	Open in IMG/M
3300009137\|Ga0066709_103013499	Not Available	618	Open in IMG/M
3300009147\|Ga0114129_10860315	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1152	Open in IMG/M
3300009147\|Ga0114129_11641574	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	786	Open in IMG/M
3300009148\|Ga0105243_10024245	All Organisms → cellular organisms → Bacteria	4627	Open in IMG/M
3300009148\|Ga0105243_10785573	Not Available	937	Open in IMG/M
3300009148\|Ga0105243_12189925	Not Available	589	Open in IMG/M
3300009162\|Ga0075423_10292952	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1705	Open in IMG/M
3300009176\|Ga0105242_10431001	Not Available	1238	Open in IMG/M
3300009176\|Ga0105242_11276132	All Organisms → cellular organisms → Bacteria	757	Open in IMG/M
3300009553\|Ga0105249_11030946	All Organisms → cellular organisms → Bacteria → Terrabacteria group	892	Open in IMG/M
3300010041\|Ga0126312_11038387	Not Available	601	Open in IMG/M
3300010041\|Ga0126312_11226123	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	553	Open in IMG/M
3300010048\|Ga0126373_13242678	All Organisms → cellular organisms → Bacteria → Terrabacteria group	506	Open in IMG/M
3300010325\|Ga0134064_10334922	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	586	Open in IMG/M
3300010336\|Ga0134071_10270345	All Organisms → cellular organisms → Bacteria → Terrabacteria group	849	Open in IMG/M
3300010360\|Ga0126372_10398291	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1255	Open in IMG/M
3300010361\|Ga0126378_12088661	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	646	Open in IMG/M
3300010362\|Ga0126377_12134695	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	636	Open in IMG/M
3300010366\|Ga0126379_11981587	All Organisms → cellular organisms → Bacteria	685	Open in IMG/M
3300010371\|Ga0134125_11637965	Not Available	700	Open in IMG/M
3300010373\|Ga0134128_11806258	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	673	Open in IMG/M
3300010376\|Ga0126381_104889571	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	515	Open in IMG/M
3300012096\|Ga0137389_10844579	All Organisms → cellular organisms → Bacteria → Terrabacteria group	786	Open in IMG/M
3300012200\|Ga0137382_10733089	All Organisms → cellular organisms → Bacteria → Terrabacteria group	709	Open in IMG/M
3300012201\|Ga0137365_11292107	All Organisms → cellular organisms → Bacteria → Terrabacteria group	518	Open in IMG/M
3300012202\|Ga0137363_11642192	All Organisms → cellular organisms → Bacteria → Terrabacteria group	535	Open in IMG/M
3300012204\|Ga0137374_10366684	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1156	Open in IMG/M
3300012209\|Ga0137379_10762664	All Organisms → cellular organisms → Bacteria → Terrabacteria group	872	Open in IMG/M
3300012212\|Ga0150985_108173026	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	960	Open in IMG/M
3300012212\|Ga0150985_117639641	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	539	Open in IMG/M
3300012349\|Ga0137387_11247093	All Organisms → cellular organisms → Bacteria → Terrabacteria group	523	Open in IMG/M
3300012351\|Ga0137386_10684450	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	737	Open in IMG/M
3300012353\|Ga0137367_10263504	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1238	Open in IMG/M
3300012358\|Ga0137368_10624659	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	683	Open in IMG/M
3300012363\|Ga0137390_11462599	All Organisms → cellular organisms → Bacteria → Terrabacteria group	625	Open in IMG/M
3300012397\|Ga0134056_1347783	All Organisms → cellular organisms → Bacteria → Terrabacteria group	976	Open in IMG/M
3300012402\|Ga0134059_1379223	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1592	Open in IMG/M
3300012469\|Ga0150984_106695678	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1008	Open in IMG/M
3300012499\|Ga0157350_1038057	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	565	Open in IMG/M
3300012532\|Ga0137373_10129251	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2160	Open in IMG/M
3300012908\|Ga0157286_10376747	All Organisms → cellular organisms → Bacteria → Terrabacteria group	544	Open in IMG/M
3300012918\|Ga0137396_10421885	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	989	Open in IMG/M
3300012938\|Ga0162651_100001032	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2290	Open in IMG/M
3300012951\|Ga0164300_10400315	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	754	Open in IMG/M
3300012951\|Ga0164300_11162026	Not Available	509	Open in IMG/M
3300012976\|Ga0134076_10236091	All Organisms → cellular organisms → Bacteria → Terrabacteria group	776	Open in IMG/M
3300014325\|Ga0163163_12956960	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	530	Open in IMG/M
3300014745\|Ga0157377_10827097	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium	685	Open in IMG/M
3300015372\|Ga0132256_101128970	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	898	Open in IMG/M
3300015374\|Ga0132255_101684103	All Organisms → cellular organisms → Bacteria	962	Open in IMG/M
3300018076\|Ga0184609_10230458	Not Available	865	Open in IMG/M
3300018468\|Ga0066662_12541860	All Organisms → cellular organisms → Bacteria → Terrabacteria group	540	Open in IMG/M
3300021362\|Ga0213882_10091116	Not Available	1231	Open in IMG/M
3300021388\|Ga0213875_10460764	All Organisms → cellular organisms → Bacteria → Proteobacteria	609	Open in IMG/M
3300024249\|Ga0247676_1068294	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	585	Open in IMG/M
3300025900\|Ga0207710_10031188	All Organisms → cellular organisms → Bacteria	2329	Open in IMG/M
3300025913\|Ga0207695_10997108	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	717	Open in IMG/M
3300025926\|Ga0207659_10834449	All Organisms → cellular organisms → Bacteria → Terrabacteria group	792	Open in IMG/M
3300025931\|Ga0207644_10194698	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1596	Open in IMG/M
3300025931\|Ga0207644_10825972	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	775	Open in IMG/M
3300025932\|Ga0207690_10026445	All Organisms → cellular organisms → Bacteria	3654	Open in IMG/M
3300025937\|Ga0207669_10397852	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1078	Open in IMG/M
3300025939\|Ga0207665_10640464	All Organisms → cellular organisms → Bacteria	832	Open in IMG/M
3300025940\|Ga0207691_10455662	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter pauli	1088	Open in IMG/M
3300025945\|Ga0207679_10811240	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	853	Open in IMG/M
3300025972\|Ga0207668_10110250	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2063	Open in IMG/M
3300025981\|Ga0207640_10252910	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1369	Open in IMG/M
3300025981\|Ga0207640_11148149	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	689	Open in IMG/M
3300026142\|Ga0207698_10760511	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium	968	Open in IMG/M
3300026142\|Ga0207698_11086436	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	812	Open in IMG/M
3300026142\|Ga0207698_11365045	All Organisms → cellular organisms → Bacteria	724	Open in IMG/M
3300026300\|Ga0209027_1250798	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	568	Open in IMG/M
3300026322\|Ga0209687_1277730	All Organisms → cellular organisms → Bacteria → Terrabacteria group	525	Open in IMG/M
3300026542\|Ga0209805_1153922	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1053	Open in IMG/M
3300026547\|Ga0209156_10383565	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	593	Open in IMG/M
3300026550\|Ga0209474_10672273	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	534	Open in IMG/M
3300026878\|Ga0208891_1001358	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	815	Open in IMG/M
3300027907\|Ga0207428_10690039	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	731	Open in IMG/M
3300027907\|Ga0207428_11250183	All Organisms → cellular organisms → Bacteria → Terrabacteria group	516	Open in IMG/M
3300028380\|Ga0268265_11664545	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter pauli	644	Open in IMG/M
3300028380\|Ga0268265_12210856	All Organisms → cellular organisms → Bacteria → Terrabacteria group	557	Open in IMG/M
3300028381\|Ga0268264_11637410	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	654	Open in IMG/M
3300028587\|Ga0247828_10249287	All Organisms → cellular organisms → Bacteria → Terrabacteria group	953	Open in IMG/M
3300028597\|Ga0247820_11125433	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	564	Open in IMG/M
3300028711\|Ga0307293_10082839	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1013	Open in IMG/M
3300028799\|Ga0307284_10352872	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	595	Open in IMG/M
3300028803\|Ga0307281_10097206	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	987	Open in IMG/M
3300028878\|Ga0307278_10502392	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	530	Open in IMG/M
3300030336\|Ga0247826_10070412	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	2053	Open in IMG/M
3300030336\|Ga0247826_11307075	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae	584	Open in IMG/M
3300031152\|Ga0307501_10204908	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	566	Open in IMG/M
3300031731\|Ga0307405_11781054	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	547	Open in IMG/M
3300031854\|Ga0310904_11127441	Not Available	563	Open in IMG/M
3300031912\|Ga0306921_12059510	All Organisms → cellular organisms → Bacteria	606	Open in IMG/M
3300031954\|Ga0306926_12125300	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	628	Open in IMG/M
3300031954\|Ga0306926_12471246	All Organisms → cellular organisms → Bacteria	571	Open in IMG/M
3300031996\|Ga0308176_11733078	All Organisms → cellular organisms → Bacteria → Terrabacteria group	667	Open in IMG/M
3300032001\|Ga0306922_11809852	All Organisms → cellular organisms → Bacteria → Proteobacteria	601	Open in IMG/M
3300032010\|Ga0318569_10470047	All Organisms → cellular organisms → Bacteria → Proteobacteria	586	Open in IMG/M
3300032126\|Ga0307415_101746120	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	601	Open in IMG/M
3300033134\|Ga0335073_11472636	All Organisms → cellular organisms → Bacteria → Proteobacteria	659	Open in IMG/M
3300033290\|Ga0318519_10229097	Not Available	1069	Open in IMG/M
3300034417\|Ga0364941_178793	Not Available	544	Open in IMG/M
3300034817\|Ga0373948_0056409	All Organisms → cellular organisms → Bacteria	854	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	65.97%
Host-Associated	Host-Associated	34.03%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	65.28%
Plants	Host-Associated → Plants	34.03%
Aquatic	Environmental → Aquatic	0.69%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	63.19%
Rhizosphere	Host-Associated → Plants → Rhizosphere	22.22%
Rhizoplane	Host-Associated → Plants → Rhizoplane	10.42%
Roots	Host-Associated → Plants → Roots	1.39%
Sediment	Environmental → Aquatic → Sediment	0.69%
Rock-Dwelling (Subaerial Biofilms)	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms)	0.69%
Floodplain	Environmental → Terrestrial → Floodplain	0.69%
Agricultural Field	Environmental → Terrestrial → Agricultural Field	0.69%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	55.56%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	14.58%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	8.33%
Soil	Host-Associated → Plants → Rhizosphere → Soil	7.64%
Loam	Environmental → Terrestrial → Soil → Loam	6.25%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.08%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	1.39%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.69%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified	0.69%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.69%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified	0.69%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.69%
Unclassified	Host-Associated → Plants → Roots → Unclassified	0.69%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	29.86%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	14.58%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	13.89%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	8.33%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	7.64%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	4.86%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	4.17%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.47%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.78%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	2.08%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.08%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	1.39%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.69%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.69%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified	0.69%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.69%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified	0.69%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.69%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	0.69%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	11.11%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	10.42%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	6.94%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	5.56%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	4.17%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	4.17%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	4.17%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	3.47%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	3.47%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	3.47%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.47%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.78%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.78%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.08%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	2.08%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.08%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	2.08%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.39%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	1.39%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.39%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	1.39%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.39%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.39%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.39%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.69%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.69%
Unplanted Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil	0.69%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.69%
Termite Nest	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest	0.69%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.69%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	0.69%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.69%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.69%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.69%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.69%
Exposed Rock	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock	0.69%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.69%
Soil	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil	0.69%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.69%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.69%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.69%
Plant Roots	Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots	0.69%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.69%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.69%
Rhizosphere Soil	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil	0.69%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.69%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.69%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300001305	Grasslands soil microbial communities from Hopland, California, USA	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005294	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil	Environmental	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental	Open in IMG/M
3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Environmental	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005553	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144	Environmental	Open in IMG/M
3300005554	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110	Environmental	Open in IMG/M
3300005561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148	Environmental	Open in IMG/M
3300005576	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157	Environmental	Open in IMG/M
3300005587	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103	Environmental	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300005874	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404	Environmental	Open in IMG/M
3300006031	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100	Environmental	Open in IMG/M
3300006169	Termite nest microbial communities from Madurai, India	Environmental	Open in IMG/M
3300006794	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300010041	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010325	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG	Environmental	Open in IMG/M
3300010336	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental	Open in IMG/M
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012351	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG	Environmental	Open in IMG/M
3300012353	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG	Environmental	Open in IMG/M
3300012358	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG	Environmental	Open in IMG/M
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental	Open in IMG/M
3300012397	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012402	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012499	Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610	Environmental	Open in IMG/M
3300012532	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG	Environmental	Open in IMG/M
3300012908	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1	Environmental	Open in IMG/M
3300012918	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG	Environmental	Open in IMG/M
3300012938	Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015	Environmental	Open in IMG/M
3300012951	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG	Environmental	Open in IMG/M
3300012976	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300018076	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300021362	Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09	Environmental	Open in IMG/M
3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Host-Associated	Open in IMG/M
3300024249	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17	Environmental	Open in IMG/M
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026300	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026322	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)	Environmental	Open in IMG/M
3300026542	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)	Environmental	Open in IMG/M
3300026547	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)	Environmental	Open in IMG/M
3300026550	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)	Environmental	Open in IMG/M
3300026878	Soil and rhizosphere microbial communities from Laval, Canada - mgHPC (SPAdes)	Environmental	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028587	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3	Environmental	Open in IMG/M
3300028597	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14	Environmental	Open in IMG/M
3300028711	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150	Environmental	Open in IMG/M
3300028799	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123	Environmental	Open in IMG/M
3300028803	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120	Environmental	Open in IMG/M
3300028878	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117	Environmental	Open in IMG/M
3300030336	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1	Environmental	Open in IMG/M
3300031152	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S	Environmental	Open in IMG/M
3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Host-Associated	Open in IMG/M
3300031854	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1	Environmental	Open in IMG/M
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental	Open in IMG/M
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental	Open in IMG/M
3300031996	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2	Environmental	Open in IMG/M
3300032001	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)	Environmental	Open in IMG/M
3300032010	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22	Environmental	Open in IMG/M
3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Host-Associated	Open in IMG/M
3300033134	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2	Environmental	Open in IMG/M
3300033290	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15	Environmental	Open in IMG/M
3300034417	Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17	Environmental	Open in IMG/M
3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.64
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.64
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F051443

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI10216J12902_1183301331	3300000956	Soil	VGAGDVAEQAEEAGLHLVRFVWCGNDGTIRAKASGL
JGI10216J12902_1233488711	3300000956	Soil	VLVDAAEVLQRAEAAGLRLVRFLWCGNDGTVRAKASGTAGLAG
C688J14111_100271882	3300001305	Soil	MALAEEVDARPVVKRADKEGLRLVRFLWCGNDGTV
Ga0063356_1040792331	3300004463	Arabidopsis Thaliana Rhizosphere	MGLAEGDDVSAVVERAEAADVRLVRFVWCGNDGTVRAKASALHGLAG
Ga0062595_1002454691	3300004479	Soil	MRVDADVGGVVRRADEAGLRLIRFLWCGNDGTVRAKASSRHGL
Ga0062595_1012988012	3300004479	Soil	MTQGVVDRVDAEGLRLVRFLWCGNDGTVRAKASGRRGLEGRLAS
Ga0062594_1004735231	3300005093	Soil	MRVDADVGDVVRRADEAGLRLIRFLWCGNDGTVRAKASSRHGL
Ga0062594_1005830053	3300005093	Soil	VTAAEVAALLDDAGAALVRFLWCGNDGTVRAKASGRAGLE
Ga0065705_106992521	3300005294	Switchgrass Rhizosphere	MTQGVVDRVDAEGLRLVRFLWCGNDGTVRAKASGRRGLEGRLASGI
Ga0070690_1004177923	3300005330	Switchgrass Rhizosphere	MDADGVARHADEAGVRLVRFLWCGNDGTVRAKASSLSGLAGR
Ga0066388_1024252681	3300005332	Tropical Forest Soil	VNADDIVRRVEEEELAMVRFLWCGNDGTIRGKASGRHGLR
Ga0070714_1019730152	3300005435	Agricultural Soil	VPSASEIATLADKAGLQFVRFLWCGNDGTVRAKASGRHGLQRRL
Ga0070684_1019715741	3300005535	Corn Rhizosphere	LTNPPATAPQDVVRRAREAELRLVRFLWCGNDGTVRAKASAVDGLE
Ga0070697_1007254052	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	VKAKDVVSSADEAGLRLVRFIWCGNDGTVRAKASAIPGLEGR
Ga0066695_107670792	3300005553	Soil	MPRAVSEIAARADEAALRLVRFLWCGNDGTVRAKA
Ga0066661_109098452	3300005554	Soil	LESREVVQQADEAGLRLVRFLWCGNDGTVRAKASSLHGLDGRI
Ga0066699_103016301	3300005561	Soil	VASAKDVVEKADEADLRLVRFLWCGNDGTVRAKASA
Ga0066708_110268292	3300005576	Soil	VSVEVVVQRADEAGLRLVRFLWCGNDGTVRAKASAR
Ga0066654_107617991	3300005587	Soil	LESREVVQQADEAGLRLVRFLWCGNDGTVRAKSSGRHGLEGRLE
Ga0068864_1024400142	3300005618	Switchgrass Rhizosphere	MTPEELARKADSAGLRLVRFLWCGNDGTIRAKASSRHGLEGRLE
Ga0066903_1023995241	3300005764	Tropical Forest Soil	MAQATTMDAAAHRVVSEADEAKLRLVRFLWCGNDGTVR
Ga0066903_1029660902	3300005764	Tropical Forest Soil	VSSSVDAGEVVRRAEEAELRLVRFLWCGNDGTVRAKA
Ga0068860_1001339313	3300005843	Switchgrass Rhizosphere	MADSPAMDAADVVKRADEADLRLVRFLWCGNDGTVRAKASSR
Ga0068862_1010291792	3300005844	Switchgrass Rhizosphere	VTGRLPAMDVADVVKRADEAGLRLVRFLWCGNDGTVRAK
Ga0075288_10268581	3300005874	Rice Paddy Soil	MTDAAEIACDADEAGLRLVRFLWCGNDGTVRAKASGRHGLED
Ga0066651_106111352	3300006031	Soil	MPRAVSEIAARADEAGLRLVRFLWCGNDGTVRAKA
Ga0082029_15231311	3300006169	Termite Nest	MAATEEVDAAGIVKQVDKAGLRLVRFLWCGNDGTVRAKASS
Ga0066658_105517741	3300006794	Soil	LESHEVVQQADEAGLRLVRFVWCGNDGTVRAKASSLHGL
Ga0066659_116359292	3300006797	Soil	VPIEDVLQKADEAGLRLVRFLWCGNDGTVRAKASSRHGL
Ga0066660_100667163	3300006800	Soil	VASAQDVVEKAREADLRLVRFLWCGNDGTVRAKASA
Ga0075421_1008351321	3300006845	Populus Rhizosphere	VNAEELVAQVDAEGLRFVRFLWCGNDGTMRAKASARHGLEGRLRA
Ga0075421_1022818312	3300006845	Populus Rhizosphere	VDASEVARGAAEANLRLVRFLWCGNDGTIRAKASGRHGLEDRLRSGI
Ga0075431_1020790881	3300006847	Populus Rhizosphere	VNAEELAALVDVEGLRLVRFLWCGNDGTMRAKASARHGLE
Ga0075425_1002500751	3300006854	Populus Rhizosphere	VNAEELVAQVDAEGLRFVRFLWCGNDGTMRAKASARHGLEGR
Ga0066710_1014213002	3300009012	Grasslands Soil	VEGGDVVKQADEAGVRLVRFLWCGNDGTIRAKSSS
Ga0066710_1032690282	3300009012	Grasslands Soil	VSRNVVSAVDDEGLRLVRFLWCGNDGTVRAKASGRHGLEG
Ga0099830_102293611	3300009088	Vadose Zone Soil	VEAQDVVRQADEAGLRLVRFLWCGNDGTIRAKSSAPNGLEGRLESG
Ga0099828_119778892	3300009089	Vadose Zone Soil	MAAADVVRQADEAGLRLVRFVWCGNDGTIRAKASGRHGLE
Ga0099827_100837041	3300009090	Vadose Zone Soil	LEAAEVVRQADEAGLRLVRFLWCGNDGTVRAKASAVKG
Ga0111539_129153941	3300009094	Populus Rhizosphere	MARPEDASEVVARAEEARLRLVRFLWCGNDGTVRAK
Ga0066709_1030134992	3300009137	Grasslands Soil	MSALKIAGRADREGLRLVRLLWCGNDGTIRAKAAGRHELEGRLERGI
Ga0114129_108603152	3300009147	Populus Rhizosphere	LTARDVVKQAGEADLRLVRFIWCGNDGTLRAKASSLHGLEG
Ga0114129_116415741	3300009147	Populus Rhizosphere	VEAADVVLQVDGEGLRLVRFLWCGNDGTVRAKASAARG
Ga0105243_100242451	3300009148	Miscanthus Rhizosphere	VRALDADDFACVTAKEIAKRVDEAGLRLVRFLWCGNDGTVRAK
Ga0105243_107855733	3300009148	Miscanthus Rhizosphere	VTASHVVERVEDAGVRLVRFLYCGNDGTIRAKASGRHGLE
Ga0105243_121899253	3300009148	Miscanthus Rhizosphere	MSFERTLRRMDVAEVVRKADEEGLRLIRFLWCGNDGTVRTKASSRNGL
Ga0075423_102929521	3300009162	Populus Rhizosphere	VEAADVVLQVDGEGLRLVRFLWCGNDGTVRAKASAARGLE
Ga0105242_104310011	3300009176	Miscanthus Rhizosphere	VSAANVVSRVDDTGIRLVRFLWCGNDGTVRAKASARRGLEGRIS
Ga0105242_112761322	3300009176	Miscanthus Rhizosphere	MTQEVVGRVDAEGLRLVRFIWCGNDGTVRAKASGRHGLEG
Ga0105249_110309461	3300009553	Switchgrass Rhizosphere	MALLETADAAGVVKRFDAAGLRLVRFLWCGNDGTV
Ga0126312_110383872	3300010041	Serpentine Soil	MEVGDIVSAAREHDVRLVRFLWCGNDGTVRAKATAIAGLEQRVHGGI
Ga0126312_112261231	3300010041	Serpentine Soil	VTVEDVLEQAGVAGLRLVRFLWCGNDGTVRAKASGRHGLRARLESG
Ga0126373_132426781	3300010048	Tropical Forest Soil	VTAKDVLKRTDEAGLRLVRFLWCGNDGTVRAKASAR
Ga0134064_103349221	3300010325	Grasslands Soil	MPPVEAGDVVRQVEEAGLRLVRFLWCGNDGTVRAKASAARGLEGRLRTG
Ga0134071_102703452	3300010336	Grasslands Soil	VEAADIVRQADEAGLRLVRFLWCGNDGTVRAKSSALRGL
Ga0126372_103982911	3300010360	Tropical Forest Soil	VTAADVARRADEAGVKLVRFLWCGNDGTVRAKASSLH
Ga0126378_120886612	3300010361	Tropical Forest Soil	VTAEDVVRNAQEAELRLVRFLWCGNDGTIRAKASTLPGL
Ga0126377_121346951	3300010362	Tropical Forest Soil	MTAEEIVQRADAAGLRLVRFLWCGNDGTVRAKASGRHGLAGRLE
Ga0126379_119815871	3300010366	Tropical Forest Soil	VDVDDVVQRVDEAGLRFVRFLWCGNDGTVRAKASSRHG
Ga0134125_116379651	3300010371	Terrestrial Soil	MTARDIVQRVDEADLRLVRFIWCGNDGTVRAKASALHGL
Ga0134128_118062582	3300010373	Terrestrial Soil	VTADELLATVEDRGIRLVRFLWCGNDGTVRAKASSRHGLAGRLSAGI
Ga0126381_1048895712	3300010376	Tropical Forest Soil	VTVEEVVQQADEADLRFVRFLWCGNDGTVRAKASSR
Ga0137389_108445791	3300012096	Vadose Zone Soil	VAAHEVVKQADEAGLRLVRFIWCGNDGTIRAKSSARGGLEGRI
Ga0137382_107330891	3300012200	Vadose Zone Soil	VEAADVVKQADEAGLRLVRFLWCGNDGTVRAKASAVRGLE
Ga0137365_112921071	3300012201	Vadose Zone Soil	VTAKDVVSSADEAGLRLVRFLWCGNDGTVRAKSSSRHG
Ga0137363_116421922	3300012202	Vadose Zone Soil	VEAHEVVKQADEAGLRLVRFIWCGNDGTIRAKSSARNGL
Ga0137374_103666842	3300012204	Vadose Zone Soil	VAVDVVKQAEEADLRLVRFLWCGNDGTVRAKASGRHGLQRRL
Ga0137379_107626642	3300012209	Vadose Zone Soil	LEASDVVRQADEAGLRLVRFIWCGNDGTVRAKASALPGL
Ga0150985_1081730261	3300012212	Avena Fatua Rhizosphere	MALLETADAAAVVKRADEAGLLLVRFLWCGNDGTVRA
Ga0150985_1176396412	3300012212	Avena Fatua Rhizosphere	MGADAGSIVKRADKEDLRLVRFLWCGNDGTVRAKASSRHGLEGRIRAGIGL
Ga0137387_112470931	3300012349	Vadose Zone Soil	LEASDVVRQADEAGLRLVRFIWCGNDGTVRAKASALPGLEG
Ga0137386_106844501	3300012351	Vadose Zone Soil	VTAKETAKHADEAGLRLVRFLWCGNDGTVRAKSSARHGLEG
Ga0137367_102635042	3300012353	Vadose Zone Soil	VTAKDVVSSADEAGLRLVRFLWCGNDGTIRAKSSGRHGLKGRL
Ga0137368_106246593	3300012358	Vadose Zone Soil	VEKEDIATAATEAGLRLVRFIWCGNDGTIRAKASALEGL
Ga0137390_114625991	3300012363	Vadose Zone Soil	VEAPEVVKQADEAGLRLVRFIWCGNDGTIRAKSSARNGFEGRIASGI
Ga0134056_13477831	3300012397	Grasslands Soil	VKAKDVVREADEAGLRLVRFLWCGNDGTVRAKASGRH
Ga0134059_13792231	3300012402	Grasslands Soil	VKAKDVVREADEAGLRLVRFLWCGNDGTVRAKASGRHGLEG
Ga0150984_1066956782	3300012469	Avena Fatua Rhizosphere	MALAEEVDAGVVVKRADKAGLRLVRFLWCGNDGTVRGKA
Ga0157350_10380571	3300012499	Unplanted Soil	VDANDVVRQAEEAGLRLVRFLWCGNDGTVRAKASTLR
Ga0137373_101292513	3300012532	Vadose Zone Soil	MATVADLVARADEAGLRLVRFLWCGNDGTVRAKASGRHGLERRL
Ga0157286_103767471	3300012908	Soil	VTANEVAAQADAAGLRLVRFLWCGNDGTVRAKASGRQGLEGRLRA
Ga0137396_104218852	3300012918	Vadose Zone Soil	VTARDVAKQVDEADLRLVRFLWCGNDGTIRAKSSARHGLEGRLEAGI
Ga0162651_1000010324	3300012938	Soil	VDAGDVVRQAEDAGLRLVRFLWCGNDGTVRAKASSMRGLEERIG
Ga0164300_104003152	3300012951	Soil	MADFPAMDAADVVKRADEAGVRLVRFLWCGNDGTVRAKASSRHGL
Ga0164300_111620262	3300012951	Soil	MDPADVVRAADEAGLRLVRFLWCGNDGTVRAKASSRH
Ga0134076_102360912	3300012976	Grasslands Soil	MDAGDAVKQADEAGLRLVRFLWCGNDGTVRGKASGRRGLE
Ga0163163_129569601	3300014325	Switchgrass Rhizosphere	MPAAEVAKLADDLGLRLIRFLWCGNDGTVRAKASGRHGLEGRMSSGI
Ga0157377_108270972	3300014745	Miscanthus Rhizosphere	VTASHVVERVEDAGVRLVRFLYCGNDGTIRAKASGR
Ga0132256_1011289702	3300015372	Arabidopsis Rhizosphere	MDADEVVRRADEAGLRLVRFLWCGNDGTVRAKASALRGLE
Ga0132255_1016841031	3300015374	Arabidopsis Rhizosphere	MQPGDVVKRVDEEGLRLVRFMYCGNDGTVRAKASGARGLE
Ga0184609_102304582	3300018076	Groundwater Sediment	VIQDVVGRVDQEGIRLVRFLWCGNDGTVRAKASGRHG
Ga0066662_125418601	3300018468	Grasslands Soil	VTARDVAARADEADLRLVRFLWCGNDGTVRAKSSARHGLEGRL
Ga0213882_100911161	3300021362	Exposed Rock	VTADELLATVEDRGVRLVRFLWCGNDGTVRAKASARHGLAGRL
Ga0213875_104607642	3300021388	Plant Roots	MTAEELVATVDEKGLRLVRFLWCGNDGTVRGKASA
Ga0247676_10682942	3300024249	Soil	VSAADVASQADDADLRLVRFLWCGNDGTIRAKASS
Ga0207710_100311884	3300025900	Switchgrass Rhizosphere	MADSPAMDAADVVKRADEAGLRLVRFLWCGNDGTVRAKASSRHGLEG
Ga0207695_109971081	3300025913	Corn Rhizosphere	VSVDDVVAQFDEAGLRLLRFLWCGNDGTVRAKASGRHG
Ga0207659_108344492	3300025926	Miscanthus Rhizosphere	VTGRLPAMDAADVVKRADEAGLRLVRFLWCGNDGTV
Ga0207644_101946981	3300025931	Switchgrass Rhizosphere	MDAADVVKRADEASLRLVRFLWCGNDGTVRAKASSG
Ga0207644_108259721	3300025931	Switchgrass Rhizosphere	VSVDDVVAQFDEAGLRLLRFLWCGNDGTVRAKASGR
Ga0207690_100264454	3300025932	Corn Rhizosphere	MADSPAMDAADVVKRADEADLRLVRFLWCGNDGTVRAKASSRHGLEG
Ga0207669_103978522	3300025937	Miscanthus Rhizosphere	VSVDDVVAQFDEAGLRLLRFLWCGNDGTVRAKASGRHGLEG
Ga0207665_106404641	3300025939	Corn, Switchgrass And Miscanthus Rhizosphere	VTAKEIVKRADEADLRLVRFLWCGNDGTIRAKSSGRHGLKGRLQAGI
Ga0207691_104556624	3300025940	Miscanthus Rhizosphere	MTPEELARKADSAGLRLVRFLWCGNDGTIRAKASSRHG
Ga0207679_108112401	3300025945	Corn Rhizosphere	MARPEDASEVVARAEEARLRLVRFLWCGNDGTVRAKA
Ga0207668_101102501	3300025972	Switchgrass Rhizosphere	MDVAEVVRKADEEGLRLIRFLWCGNDGTVRTKASGRNGL
Ga0207640_102529102	3300025981	Corn Rhizosphere	VSVDDVVAQFDEAGLRLLRFLWCGNDGTVRAKASG
Ga0207640_111481491	3300025981	Corn Rhizosphere	MTPEELARKADSAGLRLVRFLWCGNDGTVRAKASSRHGLEGRIRAG
Ga0207698_107605112	3300026142	Corn Rhizosphere	MDLQEVVRQADDAQLRLVRFLWCGNDGTIRAKASARHGLEGR
Ga0207698_110864362	3300026142	Corn Rhizosphere	MALLETADAAGVVKRVDAAGLRLVRFLWCGNDGTVRAK
Ga0207698_113650451	3300026142	Corn Rhizosphere	VTASHVVERVEDAGVRLVRFLYVGNDGTIRAKASGRHGLEQR
Ga0209027_12507981	3300026300	Grasslands Soil	MPPVEAGDVVRQVEEAGLRLVRFLWCGNDGTVRAKASAARGLAGR
Ga0209687_12777301	3300026322	Soil	VTARDVVQKVDEAGLRLVRFLWCGNDGTIRAKASSVRGLEGRI
Ga0209805_11539222	3300026542	Soil	VASAKDVVEKADEADLRLVRFLWCGNDGTVRAKASAVGGLESRIG
Ga0209156_103835651	3300026547	Soil	MPPVEARDVVRQVEEAGLRLVRFLWCGNDGTVRAKASAARGLEGR
Ga0209474_106722731	3300026550	Soil	VTARDVAVRADEADLRLVRFLWCGNDGTVRAKASARHGLE
Ga0208891_10013582	3300026878	Soil	VEPAHVVKAVDEAGLRLVRFLWCGNDGTVRGTADARERCTGH
Ga0207428_106900391	3300027907	Populus Rhizosphere	VSVDDVVAQFDEAGLRLLRFLWCGNDGTVRAKASGRHGLEGRLR
Ga0207428_112501832	3300027907	Populus Rhizosphere	MDAADVVKRADEASLRLVRFLWCGNDGTVRAKASSRHGLE
Ga0268265_116645453	3300028380	Switchgrass Rhizosphere	MTPEELARKADSAGLRLVRFLWCGNDGTIRAKASSRHGLE
Ga0268265_122108562	3300028380	Switchgrass Rhizosphere	VQAAEVLHLADEADLRLVRFLWCGNDGTIRAKASGRAALG
Ga0268264_116374102	3300028381	Switchgrass Rhizosphere	VSVDDVVAQFDEAGLRLLRFLWCGNDGTVRAKASGRHGLE
Ga0247828_102492871	3300028587	Soil	MADSPAMDAADVVKRADEASLRLVRFLWCGNDGTVRAKASSG
Ga0247820_111254331	3300028597	Soil	MMPRVIARQVVDRAEDARVRLVRFLWCGNDGTIRAKASGRHGLEQ
Ga0307293_100828391	3300028711	Soil	VTAEDVVRKADEAGLRLVRFLWCGNDGTVRAKASTLPGLE
Ga0307284_103528721	3300028799	Soil	VSVDDVVAQFDEAGLRLLRFLWCGNDGTVRAKASGRHGLEGRL
Ga0307281_100972061	3300028803	Soil	VKAKDVVKNADEAGLRLVRFLWCGNDGTVRAKSSARHGLEGRL
Ga0307278_105023921	3300028878	Soil	MQDVAARVDEEGIRLVRFLWCGNDGTVRAKASGRHG
Ga0247826_100704123	3300030336	Soil	VDAGEVARRAEEADLRLVRFLWCGNDGTVRAKASSVRGLEDRVR
Ga0247826_113070753	3300030336	Soil	MTPEELARKADSAGLRLVRFLWCGNDGTIRAKASSRHGLEGRLEA
Ga0307501_102049082	3300031152	Soil	VDATKVVQRAGEAGLRLVRFLWCGNDGTVRAKASAVSGLE
Ga0307405_117810542	3300031731	Rhizosphere	MALAEEVDAGAVVKRAEKAGLRLVRFLWCGNDGTVR
Ga0310904_111274411	3300031854	Soil	VSTAAEIDEVVRLADEAGLRFVRFLWCGNDGTVRA
Ga0306921_120595101	3300031912	Soil	LSAEDVLRKVDDAGIRLVRFLWCGNDGTVRAKASGRHGLDGRIGSGIG
Ga0306926_121253001	3300031954	Soil	VTPAEVAFLAEEAGLALVRFLWCGNDGTVRAKASARHGLEGRL
Ga0306926_124712462	3300031954	Soil	MDIDEVVQQVNDAELRFVRFLWCGNDGTIRAKASSRHGL
Ga0308176_117330781	3300031996	Soil	MEVDHGSVVKRADKEGLRLVRFLWCGNDGTVRAKASS
Ga0306922_118098521	3300032001	Soil	VTPDELLATIEDRGVRLVRFLWCGNDGTVRAKASARHGLAGRLG
Ga0318569_104700472	3300032010	Soil	VTADELLANVEDRGIRLVRFLWCGNDGTVRAKASARH
Ga0307415_1017461201	3300032126	Rhizosphere	MALLESADAEAVVKRAEEAGLRLVRFLWCGNDGTVRAKASSRHGLEGR
Ga0335073_114726361	3300033134	Soil	MTADEVLATAEEEGLRLVRFLWCGNDGTIRAKASGRH
Ga0318519_102290972	3300033290	Soil	VTPDELLATIEDRGVRLVRFLWCGNDGTVRAKASARHGL
Ga0364941_178793_3_116	3300034417	Sediment	MDILRTARERGLMLVRFLWCGNDGTVRAKATALGGLEA
Ga0373948_0056409_713_853	3300034817	Rhizosphere Soil	MSTAAEIDEVVRLADEAELRFVRFLWCGNDGTVRAKASARQGLGGRL

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign