| Basic Information | |
|---|---|
| Family ID | F051443 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 144 |
| Average Sequence Length | 41 residues |
| Representative Sequence | VKAKDVVREADEAGLRLVRFLWCGNDGTVRAKASGRHGLEG |
| Number of Associated Samples | 123 |
| Number of Associated Scaffolds | 144 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 53.47 % |
| % of genes near scaffold ends (potentially truncated) | 99.31 % |
| % of genes from short scaffolds (< 2000 bps) | 92.36 % |
| Associated GOLD sequencing projects | 119 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.64 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.972 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.111 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.194 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (47.222 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.74% β-sheet: 20.29% Coil/Unstructured: 57.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 144 Family Scaffolds |
|---|---|---|
| PF13520 | AA_permease_2 | 9.72 |
| PF01717 | Meth_synt_2 | 4.17 |
| PF07690 | MFS_1 | 4.17 |
| PF01546 | Peptidase_M20 | 2.78 |
| PF05488 | PAAR_motif | 2.78 |
| PF00005 | ABC_tran | 2.08 |
| PF00248 | Aldo_ket_red | 2.08 |
| PF06737 | Transglycosylas | 2.08 |
| PF01694 | Rhomboid | 1.39 |
| PF00175 | NAD_binding_1 | 1.39 |
| PF17164 | DUF5122 | 1.39 |
| PF00106 | adh_short | 1.39 |
| PF00817 | IMS | 0.69 |
| PF03591 | AzlC | 0.69 |
| PF01070 | FMN_dh | 0.69 |
| PF07883 | Cupin_2 | 0.69 |
| PF08823 | PG_binding_2 | 0.69 |
| PF03007 | WES_acyltransf | 0.69 |
| PF07687 | M20_dimer | 0.69 |
| PF07676 | PD40 | 0.69 |
| PF13560 | HTH_31 | 0.69 |
| PF12848 | ABC_tran_Xtn | 0.69 |
| PF06974 | WS_DGAT_C | 0.69 |
| PF14333 | DUF4389 | 0.69 |
| PF14559 | TPR_19 | 0.69 |
| PF01180 | DHO_dh | 0.69 |
| PF10584 | Proteasome_A_N | 0.69 |
| PF13224 | DUF4032 | 0.69 |
| PF13180 | PDZ_2 | 0.69 |
| PF02633 | Creatininase | 0.69 |
| PF16952 | Gln-synt_N_2 | 0.69 |
| PF00903 | Glyoxalase | 0.69 |
| PF05977 | MFS_3 | 0.69 |
| PF08281 | Sigma70_r4_2 | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
|---|---|---|---|
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 4.17 |
| COG4104 | Zn-binding Pro-Ala-Ala-Arg (PAAR) domain, involved in Type VI secretion | Intracellular trafficking, secretion, and vesicular transport [U] | 2.78 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 1.39 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 1.39 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 1.39 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG0167 | Dihydroorotate dehydrogenase | Nucleotide transport and metabolism [F] | 0.69 |
| COG0389 | Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair | Replication, recombination and repair [L] | 0.69 |
| COG1296 | Predicted branched-chain amino acid permease (azaleucine resistance) | Amino acid transport and metabolism [E] | 0.69 |
| COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 0.69 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.69 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.69 |
| COG3342 | Uncharacterized conserved protein, Ntn-hydrolase superfamily | General function prediction only [R] | 0.69 |
| COG4908 | Uncharacterized conserved protein, contains a NRPS condensation (elongation) domain | General function prediction only [R] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.67 % |
| Unclassified | root | N/A | 8.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_118330133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 665 | Open in IMG/M |
| 3300000956|JGI10216J12902_123348871 | All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera → Monothalamids → Reticulomyxidae → Reticulomyxa → Reticulomyxa filosa | 1904 | Open in IMG/M |
| 3300001305|C688J14111_10027188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1699 | Open in IMG/M |
| 3300004463|Ga0063356_104079233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea → Miltoncostaea marina | 629 | Open in IMG/M |
| 3300004479|Ga0062595_100245469 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
| 3300004479|Ga0062595_101298801 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300005093|Ga0062594_100473523 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300005093|Ga0062594_100583005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 974 | Open in IMG/M |
| 3300005294|Ga0065705_10699252 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300005330|Ga0070690_100417792 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300005332|Ga0066388_102425268 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300005435|Ga0070714_101973015 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300005535|Ga0070684_101971574 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300005536|Ga0070697_100725405 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300005553|Ga0066695_10767079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 559 | Open in IMG/M |
| 3300005554|Ga0066661_10909845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 514 | Open in IMG/M |
| 3300005561|Ga0066699_10301630 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300005576|Ga0066708_11026829 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300005587|Ga0066654_10761799 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300005618|Ga0068864_102440014 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300005764|Ga0066903_102399524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1020 | Open in IMG/M |
| 3300005764|Ga0066903_102966090 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300005843|Ga0068860_100133931 | All Organisms → cellular organisms → Bacteria | 2379 | Open in IMG/M |
| 3300005844|Ga0068862_101029179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 816 | Open in IMG/M |
| 3300005874|Ga0075288_1026858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 834 | Open in IMG/M |
| 3300006031|Ga0066651_10611135 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300006169|Ga0082029_1523131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 603 | Open in IMG/M |
| 3300006794|Ga0066658_10551774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 626 | Open in IMG/M |
| 3300006797|Ga0066659_11635929 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300006800|Ga0066660_10066716 | All Organisms → cellular organisms → Bacteria | 2423 | Open in IMG/M |
| 3300006845|Ga0075421_100835132 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300006845|Ga0075421_102281831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 569 | Open in IMG/M |
| 3300006847|Ga0075431_102079088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
| 3300006854|Ga0075425_100250075 | All Organisms → cellular organisms → Bacteria | 2039 | Open in IMG/M |
| 3300009012|Ga0066710_101421300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1074 | Open in IMG/M |
| 3300009012|Ga0066710_103269028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 620 | Open in IMG/M |
| 3300009088|Ga0099830_10229361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1463 | Open in IMG/M |
| 3300009089|Ga0099828_11977889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
| 3300009090|Ga0099827_10083704 | All Organisms → cellular organisms → Bacteria | 2498 | Open in IMG/M |
| 3300009094|Ga0111539_12915394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 553 | Open in IMG/M |
| 3300009137|Ga0066709_103013499 | Not Available | 618 | Open in IMG/M |
| 3300009147|Ga0114129_10860315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1152 | Open in IMG/M |
| 3300009147|Ga0114129_11641574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 786 | Open in IMG/M |
| 3300009148|Ga0105243_10024245 | All Organisms → cellular organisms → Bacteria | 4627 | Open in IMG/M |
| 3300009148|Ga0105243_10785573 | Not Available | 937 | Open in IMG/M |
| 3300009148|Ga0105243_12189925 | Not Available | 589 | Open in IMG/M |
| 3300009162|Ga0075423_10292952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1705 | Open in IMG/M |
| 3300009176|Ga0105242_10431001 | Not Available | 1238 | Open in IMG/M |
| 3300009176|Ga0105242_11276132 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300009553|Ga0105249_11030946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 892 | Open in IMG/M |
| 3300010041|Ga0126312_11038387 | Not Available | 601 | Open in IMG/M |
| 3300010041|Ga0126312_11226123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 553 | Open in IMG/M |
| 3300010048|Ga0126373_13242678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 506 | Open in IMG/M |
| 3300010325|Ga0134064_10334922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 586 | Open in IMG/M |
| 3300010336|Ga0134071_10270345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 849 | Open in IMG/M |
| 3300010360|Ga0126372_10398291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1255 | Open in IMG/M |
| 3300010361|Ga0126378_12088661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 646 | Open in IMG/M |
| 3300010362|Ga0126377_12134695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 636 | Open in IMG/M |
| 3300010366|Ga0126379_11981587 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300010371|Ga0134125_11637965 | Not Available | 700 | Open in IMG/M |
| 3300010373|Ga0134128_11806258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 673 | Open in IMG/M |
| 3300010376|Ga0126381_104889571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 515 | Open in IMG/M |
| 3300012096|Ga0137389_10844579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 786 | Open in IMG/M |
| 3300012200|Ga0137382_10733089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 709 | Open in IMG/M |
| 3300012201|Ga0137365_11292107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 518 | Open in IMG/M |
| 3300012202|Ga0137363_11642192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 535 | Open in IMG/M |
| 3300012204|Ga0137374_10366684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1156 | Open in IMG/M |
| 3300012209|Ga0137379_10762664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 872 | Open in IMG/M |
| 3300012212|Ga0150985_108173026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 960 | Open in IMG/M |
| 3300012212|Ga0150985_117639641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 539 | Open in IMG/M |
| 3300012349|Ga0137387_11247093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 523 | Open in IMG/M |
| 3300012351|Ga0137386_10684450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 737 | Open in IMG/M |
| 3300012353|Ga0137367_10263504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1238 | Open in IMG/M |
| 3300012358|Ga0137368_10624659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 683 | Open in IMG/M |
| 3300012363|Ga0137390_11462599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 625 | Open in IMG/M |
| 3300012397|Ga0134056_1347783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 976 | Open in IMG/M |
| 3300012402|Ga0134059_1379223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1592 | Open in IMG/M |
| 3300012469|Ga0150984_106695678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1008 | Open in IMG/M |
| 3300012499|Ga0157350_1038057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 565 | Open in IMG/M |
| 3300012532|Ga0137373_10129251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2160 | Open in IMG/M |
| 3300012908|Ga0157286_10376747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 544 | Open in IMG/M |
| 3300012918|Ga0137396_10421885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 989 | Open in IMG/M |
| 3300012938|Ga0162651_100001032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2290 | Open in IMG/M |
| 3300012951|Ga0164300_10400315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 754 | Open in IMG/M |
| 3300012951|Ga0164300_11162026 | Not Available | 509 | Open in IMG/M |
| 3300012976|Ga0134076_10236091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 776 | Open in IMG/M |
| 3300014325|Ga0163163_12956960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
| 3300014745|Ga0157377_10827097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 685 | Open in IMG/M |
| 3300015372|Ga0132256_101128970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 898 | Open in IMG/M |
| 3300015374|Ga0132255_101684103 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300018076|Ga0184609_10230458 | Not Available | 865 | Open in IMG/M |
| 3300018468|Ga0066662_12541860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 540 | Open in IMG/M |
| 3300021362|Ga0213882_10091116 | Not Available | 1231 | Open in IMG/M |
| 3300021388|Ga0213875_10460764 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 609 | Open in IMG/M |
| 3300024249|Ga0247676_1068294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 585 | Open in IMG/M |
| 3300025900|Ga0207710_10031188 | All Organisms → cellular organisms → Bacteria | 2329 | Open in IMG/M |
| 3300025913|Ga0207695_10997108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 717 | Open in IMG/M |
| 3300025926|Ga0207659_10834449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 792 | Open in IMG/M |
| 3300025931|Ga0207644_10194698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1596 | Open in IMG/M |
| 3300025931|Ga0207644_10825972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 775 | Open in IMG/M |
| 3300025932|Ga0207690_10026445 | All Organisms → cellular organisms → Bacteria | 3654 | Open in IMG/M |
| 3300025937|Ga0207669_10397852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1078 | Open in IMG/M |
| 3300025939|Ga0207665_10640464 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300025940|Ga0207691_10455662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter pauli | 1088 | Open in IMG/M |
| 3300025945|Ga0207679_10811240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 853 | Open in IMG/M |
| 3300025972|Ga0207668_10110250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2063 | Open in IMG/M |
| 3300025981|Ga0207640_10252910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1369 | Open in IMG/M |
| 3300025981|Ga0207640_11148149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 689 | Open in IMG/M |
| 3300026142|Ga0207698_10760511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium | 968 | Open in IMG/M |
| 3300026142|Ga0207698_11086436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 812 | Open in IMG/M |
| 3300026142|Ga0207698_11365045 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300026300|Ga0209027_1250798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 568 | Open in IMG/M |
| 3300026322|Ga0209687_1277730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 525 | Open in IMG/M |
| 3300026542|Ga0209805_1153922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1053 | Open in IMG/M |
| 3300026547|Ga0209156_10383565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 593 | Open in IMG/M |
| 3300026550|Ga0209474_10672273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 534 | Open in IMG/M |
| 3300026878|Ga0208891_1001358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 815 | Open in IMG/M |
| 3300027907|Ga0207428_10690039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 731 | Open in IMG/M |
| 3300027907|Ga0207428_11250183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 516 | Open in IMG/M |
| 3300028380|Ga0268265_11664545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter pauli | 644 | Open in IMG/M |
| 3300028380|Ga0268265_12210856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 557 | Open in IMG/M |
| 3300028381|Ga0268264_11637410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 654 | Open in IMG/M |
| 3300028587|Ga0247828_10249287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 953 | Open in IMG/M |
| 3300028597|Ga0247820_11125433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 564 | Open in IMG/M |
| 3300028711|Ga0307293_10082839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1013 | Open in IMG/M |
| 3300028799|Ga0307284_10352872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 595 | Open in IMG/M |
| 3300028803|Ga0307281_10097206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 987 | Open in IMG/M |
| 3300028878|Ga0307278_10502392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
| 3300030336|Ga0247826_10070412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2053 | Open in IMG/M |
| 3300030336|Ga0247826_11307075 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae | 584 | Open in IMG/M |
| 3300031152|Ga0307501_10204908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 566 | Open in IMG/M |
| 3300031731|Ga0307405_11781054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 547 | Open in IMG/M |
| 3300031854|Ga0310904_11127441 | Not Available | 563 | Open in IMG/M |
| 3300031912|Ga0306921_12059510 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300031954|Ga0306926_12125300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 628 | Open in IMG/M |
| 3300031954|Ga0306926_12471246 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300031996|Ga0308176_11733078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 667 | Open in IMG/M |
| 3300032001|Ga0306922_11809852 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 601 | Open in IMG/M |
| 3300032010|Ga0318569_10470047 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 586 | Open in IMG/M |
| 3300032126|Ga0307415_101746120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 601 | Open in IMG/M |
| 3300033134|Ga0335073_11472636 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 659 | Open in IMG/M |
| 3300033290|Ga0318519_10229097 | Not Available | 1069 | Open in IMG/M |
| 3300034417|Ga0364941_178793 | Not Available | 544 | Open in IMG/M |
| 3300034817|Ga0373948_0056409 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.42% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.17% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.17% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.47% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.47% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.08% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.08% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.08% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.08% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.39% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.39% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.39% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.39% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.39% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.39% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.39% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.69% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.69% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.69% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.69% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.69% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.69% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.69% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.69% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.69% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.69% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.69% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012397 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012402 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012499 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610 | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026878 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPC (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034417 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17 | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1183301331 | 3300000956 | Soil | VGAGDVAEQAEEAGLHLVRFVWCGNDGTIRAKASGL |
| JGI10216J12902_1233488711 | 3300000956 | Soil | VLVDAAEVLQRAEAAGLRLVRFLWCGNDGTVRAKASGTAGLAG |
| C688J14111_100271882 | 3300001305 | Soil | MALAEEVDARPVVKRADKEGLRLVRFLWCGNDGTV |
| Ga0063356_1040792331 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MGLAEGDDVSAVVERAEAADVRLVRFVWCGNDGTVRAKASALHGLAG |
| Ga0062595_1002454691 | 3300004479 | Soil | MRVDADVGGVVRRADEAGLRLIRFLWCGNDGTVRAKASSRHGL |
| Ga0062595_1012988012 | 3300004479 | Soil | MTQGVVDRVDAEGLRLVRFLWCGNDGTVRAKASGRRGLEGRLAS |
| Ga0062594_1004735231 | 3300005093 | Soil | MRVDADVGDVVRRADEAGLRLIRFLWCGNDGTVRAKASSRHGL |
| Ga0062594_1005830053 | 3300005093 | Soil | VTAAEVAALLDDAGAALVRFLWCGNDGTVRAKASGRAGLE |
| Ga0065705_106992521 | 3300005294 | Switchgrass Rhizosphere | MTQGVVDRVDAEGLRLVRFLWCGNDGTVRAKASGRRGLEGRLASGI |
| Ga0070690_1004177923 | 3300005330 | Switchgrass Rhizosphere | MDADGVARHADEAGVRLVRFLWCGNDGTVRAKASSLSGLAGR |
| Ga0066388_1024252681 | 3300005332 | Tropical Forest Soil | VNADDIVRRVEEEELAMVRFLWCGNDGTIRGKASGRHGLR |
| Ga0070714_1019730152 | 3300005435 | Agricultural Soil | VPSASEIATLADKAGLQFVRFLWCGNDGTVRAKASGRHGLQRRL |
| Ga0070684_1019715741 | 3300005535 | Corn Rhizosphere | LTNPPATAPQDVVRRAREAELRLVRFLWCGNDGTVRAKASAVDGLE |
| Ga0070697_1007254052 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VKAKDVVSSADEAGLRLVRFIWCGNDGTVRAKASAIPGLEGR |
| Ga0066695_107670792 | 3300005553 | Soil | MPRAVSEIAARADEAALRLVRFLWCGNDGTVRAKA |
| Ga0066661_109098452 | 3300005554 | Soil | LESREVVQQADEAGLRLVRFLWCGNDGTVRAKASSLHGLDGRI |
| Ga0066699_103016301 | 3300005561 | Soil | VASAKDVVEKADEADLRLVRFLWCGNDGTVRAKASA |
| Ga0066708_110268292 | 3300005576 | Soil | VSVEVVVQRADEAGLRLVRFLWCGNDGTVRAKASAR |
| Ga0066654_107617991 | 3300005587 | Soil | LESREVVQQADEAGLRLVRFLWCGNDGTVRAKSSGRHGLEGRLE |
| Ga0068864_1024400142 | 3300005618 | Switchgrass Rhizosphere | MTPEELARKADSAGLRLVRFLWCGNDGTIRAKASSRHGLEGRLE |
| Ga0066903_1023995241 | 3300005764 | Tropical Forest Soil | MAQATTMDAAAHRVVSEADEAKLRLVRFLWCGNDGTVR |
| Ga0066903_1029660902 | 3300005764 | Tropical Forest Soil | VSSSVDAGEVVRRAEEAELRLVRFLWCGNDGTVRAKA |
| Ga0068860_1001339313 | 3300005843 | Switchgrass Rhizosphere | MADSPAMDAADVVKRADEADLRLVRFLWCGNDGTVRAKASSR |
| Ga0068862_1010291792 | 3300005844 | Switchgrass Rhizosphere | VTGRLPAMDVADVVKRADEAGLRLVRFLWCGNDGTVRAK |
| Ga0075288_10268581 | 3300005874 | Rice Paddy Soil | MTDAAEIACDADEAGLRLVRFLWCGNDGTVRAKASGRHGLED |
| Ga0066651_106111352 | 3300006031 | Soil | MPRAVSEIAARADEAGLRLVRFLWCGNDGTVRAKA |
| Ga0082029_15231311 | 3300006169 | Termite Nest | MAATEEVDAAGIVKQVDKAGLRLVRFLWCGNDGTVRAKASS |
| Ga0066658_105517741 | 3300006794 | Soil | LESHEVVQQADEAGLRLVRFVWCGNDGTVRAKASSLHGL |
| Ga0066659_116359292 | 3300006797 | Soil | VPIEDVLQKADEAGLRLVRFLWCGNDGTVRAKASSRHGL |
| Ga0066660_100667163 | 3300006800 | Soil | VASAQDVVEKAREADLRLVRFLWCGNDGTVRAKASA |
| Ga0075421_1008351321 | 3300006845 | Populus Rhizosphere | VNAEELVAQVDAEGLRFVRFLWCGNDGTMRAKASARHGLEGRLRA |
| Ga0075421_1022818312 | 3300006845 | Populus Rhizosphere | VDASEVARGAAEANLRLVRFLWCGNDGTIRAKASGRHGLEDRLRSGI |
| Ga0075431_1020790881 | 3300006847 | Populus Rhizosphere | VNAEELAALVDVEGLRLVRFLWCGNDGTMRAKASARHGLE |
| Ga0075425_1002500751 | 3300006854 | Populus Rhizosphere | VNAEELVAQVDAEGLRFVRFLWCGNDGTMRAKASARHGLEGR |
| Ga0066710_1014213002 | 3300009012 | Grasslands Soil | VEGGDVVKQADEAGVRLVRFLWCGNDGTIRAKSSS |
| Ga0066710_1032690282 | 3300009012 | Grasslands Soil | VSRNVVSAVDDEGLRLVRFLWCGNDGTVRAKASGRHGLEG |
| Ga0099830_102293611 | 3300009088 | Vadose Zone Soil | VEAQDVVRQADEAGLRLVRFLWCGNDGTIRAKSSAPNGLEGRLESG |
| Ga0099828_119778892 | 3300009089 | Vadose Zone Soil | MAAADVVRQADEAGLRLVRFVWCGNDGTIRAKASGRHGLE |
| Ga0099827_100837041 | 3300009090 | Vadose Zone Soil | LEAAEVVRQADEAGLRLVRFLWCGNDGTVRAKASAVKG |
| Ga0111539_129153941 | 3300009094 | Populus Rhizosphere | MARPEDASEVVARAEEARLRLVRFLWCGNDGTVRAK |
| Ga0066709_1030134992 | 3300009137 | Grasslands Soil | MSALKIAGRADREGLRLVRLLWCGNDGTIRAKAAGRHELEGRLERGI |
| Ga0114129_108603152 | 3300009147 | Populus Rhizosphere | LTARDVVKQAGEADLRLVRFIWCGNDGTLRAKASSLHGLEG |
| Ga0114129_116415741 | 3300009147 | Populus Rhizosphere | VEAADVVLQVDGEGLRLVRFLWCGNDGTVRAKASAARG |
| Ga0105243_100242451 | 3300009148 | Miscanthus Rhizosphere | VRALDADDFACVTAKEIAKRVDEAGLRLVRFLWCGNDGTVRAK |
| Ga0105243_107855733 | 3300009148 | Miscanthus Rhizosphere | VTASHVVERVEDAGVRLVRFLYCGNDGTIRAKASGRHGLE |
| Ga0105243_121899253 | 3300009148 | Miscanthus Rhizosphere | MSFERTLRRMDVAEVVRKADEEGLRLIRFLWCGNDGTVRTKASSRNGL |
| Ga0075423_102929521 | 3300009162 | Populus Rhizosphere | VEAADVVLQVDGEGLRLVRFLWCGNDGTVRAKASAARGLE |
| Ga0105242_104310011 | 3300009176 | Miscanthus Rhizosphere | VSAANVVSRVDDTGIRLVRFLWCGNDGTVRAKASARRGLEGRIS |
| Ga0105242_112761322 | 3300009176 | Miscanthus Rhizosphere | MTQEVVGRVDAEGLRLVRFIWCGNDGTVRAKASGRHGLEG |
| Ga0105249_110309461 | 3300009553 | Switchgrass Rhizosphere | MALLETADAAGVVKRFDAAGLRLVRFLWCGNDGTV |
| Ga0126312_110383872 | 3300010041 | Serpentine Soil | MEVGDIVSAAREHDVRLVRFLWCGNDGTVRAKATAIAGLEQRVHGGI |
| Ga0126312_112261231 | 3300010041 | Serpentine Soil | VTVEDVLEQAGVAGLRLVRFLWCGNDGTVRAKASGRHGLRARLESG |
| Ga0126373_132426781 | 3300010048 | Tropical Forest Soil | VTAKDVLKRTDEAGLRLVRFLWCGNDGTVRAKASAR |
| Ga0134064_103349221 | 3300010325 | Grasslands Soil | MPPVEAGDVVRQVEEAGLRLVRFLWCGNDGTVRAKASAARGLEGRLRTG |
| Ga0134071_102703452 | 3300010336 | Grasslands Soil | VEAADIVRQADEAGLRLVRFLWCGNDGTVRAKSSALRGL |
| Ga0126372_103982911 | 3300010360 | Tropical Forest Soil | VTAADVARRADEAGVKLVRFLWCGNDGTVRAKASSLH |
| Ga0126378_120886612 | 3300010361 | Tropical Forest Soil | VTAEDVVRNAQEAELRLVRFLWCGNDGTIRAKASTLPGL |
| Ga0126377_121346951 | 3300010362 | Tropical Forest Soil | MTAEEIVQRADAAGLRLVRFLWCGNDGTVRAKASGRHGLAGRLE |
| Ga0126379_119815871 | 3300010366 | Tropical Forest Soil | VDVDDVVQRVDEAGLRFVRFLWCGNDGTVRAKASSRHG |
| Ga0134125_116379651 | 3300010371 | Terrestrial Soil | MTARDIVQRVDEADLRLVRFIWCGNDGTVRAKASALHGL |
| Ga0134128_118062582 | 3300010373 | Terrestrial Soil | VTADELLATVEDRGIRLVRFLWCGNDGTVRAKASSRHGLAGRLSAGI |
| Ga0126381_1048895712 | 3300010376 | Tropical Forest Soil | VTVEEVVQQADEADLRFVRFLWCGNDGTVRAKASSR |
| Ga0137389_108445791 | 3300012096 | Vadose Zone Soil | VAAHEVVKQADEAGLRLVRFIWCGNDGTIRAKSSARGGLEGRI |
| Ga0137382_107330891 | 3300012200 | Vadose Zone Soil | VEAADVVKQADEAGLRLVRFLWCGNDGTVRAKASAVRGLE |
| Ga0137365_112921071 | 3300012201 | Vadose Zone Soil | VTAKDVVSSADEAGLRLVRFLWCGNDGTVRAKSSSRHG |
| Ga0137363_116421922 | 3300012202 | Vadose Zone Soil | VEAHEVVKQADEAGLRLVRFIWCGNDGTIRAKSSARNGL |
| Ga0137374_103666842 | 3300012204 | Vadose Zone Soil | VAVDVVKQAEEADLRLVRFLWCGNDGTVRAKASGRHGLQRRL |
| Ga0137379_107626642 | 3300012209 | Vadose Zone Soil | LEASDVVRQADEAGLRLVRFIWCGNDGTVRAKASALPGL |
| Ga0150985_1081730261 | 3300012212 | Avena Fatua Rhizosphere | MALLETADAAAVVKRADEAGLLLVRFLWCGNDGTVRA |
| Ga0150985_1176396412 | 3300012212 | Avena Fatua Rhizosphere | MGADAGSIVKRADKEDLRLVRFLWCGNDGTVRAKASSRHGLEGRIRAGIGL |
| Ga0137387_112470931 | 3300012349 | Vadose Zone Soil | LEASDVVRQADEAGLRLVRFIWCGNDGTVRAKASALPGLEG |
| Ga0137386_106844501 | 3300012351 | Vadose Zone Soil | VTAKETAKHADEAGLRLVRFLWCGNDGTVRAKSSARHGLEG |
| Ga0137367_102635042 | 3300012353 | Vadose Zone Soil | VTAKDVVSSADEAGLRLVRFLWCGNDGTIRAKSSGRHGLKGRL |
| Ga0137368_106246593 | 3300012358 | Vadose Zone Soil | VEKEDIATAATEAGLRLVRFIWCGNDGTIRAKASALEGL |
| Ga0137390_114625991 | 3300012363 | Vadose Zone Soil | VEAPEVVKQADEAGLRLVRFIWCGNDGTIRAKSSARNGFEGRIASGI |
| Ga0134056_13477831 | 3300012397 | Grasslands Soil | VKAKDVVREADEAGLRLVRFLWCGNDGTVRAKASGRH |
| Ga0134059_13792231 | 3300012402 | Grasslands Soil | VKAKDVVREADEAGLRLVRFLWCGNDGTVRAKASGRHGLEG |
| Ga0150984_1066956782 | 3300012469 | Avena Fatua Rhizosphere | MALAEEVDAGVVVKRADKAGLRLVRFLWCGNDGTVRGKA |
| Ga0157350_10380571 | 3300012499 | Unplanted Soil | VDANDVVRQAEEAGLRLVRFLWCGNDGTVRAKASTLR |
| Ga0137373_101292513 | 3300012532 | Vadose Zone Soil | MATVADLVARADEAGLRLVRFLWCGNDGTVRAKASGRHGLERRL |
| Ga0157286_103767471 | 3300012908 | Soil | VTANEVAAQADAAGLRLVRFLWCGNDGTVRAKASGRQGLEGRLRA |
| Ga0137396_104218852 | 3300012918 | Vadose Zone Soil | VTARDVAKQVDEADLRLVRFLWCGNDGTIRAKSSARHGLEGRLEAGI |
| Ga0162651_1000010324 | 3300012938 | Soil | VDAGDVVRQAEDAGLRLVRFLWCGNDGTVRAKASSMRGLEERIG |
| Ga0164300_104003152 | 3300012951 | Soil | MADFPAMDAADVVKRADEAGVRLVRFLWCGNDGTVRAKASSRHGL |
| Ga0164300_111620262 | 3300012951 | Soil | MDPADVVRAADEAGLRLVRFLWCGNDGTVRAKASSRH |
| Ga0134076_102360912 | 3300012976 | Grasslands Soil | MDAGDAVKQADEAGLRLVRFLWCGNDGTVRGKASGRRGLE |
| Ga0163163_129569601 | 3300014325 | Switchgrass Rhizosphere | MPAAEVAKLADDLGLRLIRFLWCGNDGTVRAKASGRHGLEGRMSSGI |
| Ga0157377_108270972 | 3300014745 | Miscanthus Rhizosphere | VTASHVVERVEDAGVRLVRFLYCGNDGTIRAKASGR |
| Ga0132256_1011289702 | 3300015372 | Arabidopsis Rhizosphere | MDADEVVRRADEAGLRLVRFLWCGNDGTVRAKASALRGLE |
| Ga0132255_1016841031 | 3300015374 | Arabidopsis Rhizosphere | MQPGDVVKRVDEEGLRLVRFMYCGNDGTVRAKASGARGLE |
| Ga0184609_102304582 | 3300018076 | Groundwater Sediment | VIQDVVGRVDQEGIRLVRFLWCGNDGTVRAKASGRHG |
| Ga0066662_125418601 | 3300018468 | Grasslands Soil | VTARDVAARADEADLRLVRFLWCGNDGTVRAKSSARHGLEGRL |
| Ga0213882_100911161 | 3300021362 | Exposed Rock | VTADELLATVEDRGVRLVRFLWCGNDGTVRAKASARHGLAGRL |
| Ga0213875_104607642 | 3300021388 | Plant Roots | MTAEELVATVDEKGLRLVRFLWCGNDGTVRGKASA |
| Ga0247676_10682942 | 3300024249 | Soil | VSAADVASQADDADLRLVRFLWCGNDGTIRAKASS |
| Ga0207710_100311884 | 3300025900 | Switchgrass Rhizosphere | MADSPAMDAADVVKRADEAGLRLVRFLWCGNDGTVRAKASSRHGLEG |
| Ga0207695_109971081 | 3300025913 | Corn Rhizosphere | VSVDDVVAQFDEAGLRLLRFLWCGNDGTVRAKASGRHG |
| Ga0207659_108344492 | 3300025926 | Miscanthus Rhizosphere | VTGRLPAMDAADVVKRADEAGLRLVRFLWCGNDGTV |
| Ga0207644_101946981 | 3300025931 | Switchgrass Rhizosphere | MDAADVVKRADEASLRLVRFLWCGNDGTVRAKASSG |
| Ga0207644_108259721 | 3300025931 | Switchgrass Rhizosphere | VSVDDVVAQFDEAGLRLLRFLWCGNDGTVRAKASGR |
| Ga0207690_100264454 | 3300025932 | Corn Rhizosphere | MADSPAMDAADVVKRADEADLRLVRFLWCGNDGTVRAKASSRHGLEG |
| Ga0207669_103978522 | 3300025937 | Miscanthus Rhizosphere | VSVDDVVAQFDEAGLRLLRFLWCGNDGTVRAKASGRHGLEG |
| Ga0207665_106404641 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VTAKEIVKRADEADLRLVRFLWCGNDGTIRAKSSGRHGLKGRLQAGI |
| Ga0207691_104556624 | 3300025940 | Miscanthus Rhizosphere | MTPEELARKADSAGLRLVRFLWCGNDGTIRAKASSRHG |
| Ga0207679_108112401 | 3300025945 | Corn Rhizosphere | MARPEDASEVVARAEEARLRLVRFLWCGNDGTVRAKA |
| Ga0207668_101102501 | 3300025972 | Switchgrass Rhizosphere | MDVAEVVRKADEEGLRLIRFLWCGNDGTVRTKASGRNGL |
| Ga0207640_102529102 | 3300025981 | Corn Rhizosphere | VSVDDVVAQFDEAGLRLLRFLWCGNDGTVRAKASG |
| Ga0207640_111481491 | 3300025981 | Corn Rhizosphere | MTPEELARKADSAGLRLVRFLWCGNDGTVRAKASSRHGLEGRIRAG |
| Ga0207698_107605112 | 3300026142 | Corn Rhizosphere | MDLQEVVRQADDAQLRLVRFLWCGNDGTIRAKASARHGLEGR |
| Ga0207698_110864362 | 3300026142 | Corn Rhizosphere | MALLETADAAGVVKRVDAAGLRLVRFLWCGNDGTVRAK |
| Ga0207698_113650451 | 3300026142 | Corn Rhizosphere | VTASHVVERVEDAGVRLVRFLYVGNDGTIRAKASGRHGLEQR |
| Ga0209027_12507981 | 3300026300 | Grasslands Soil | MPPVEAGDVVRQVEEAGLRLVRFLWCGNDGTVRAKASAARGLAGR |
| Ga0209687_12777301 | 3300026322 | Soil | VTARDVVQKVDEAGLRLVRFLWCGNDGTIRAKASSVRGLEGRI |
| Ga0209805_11539222 | 3300026542 | Soil | VASAKDVVEKADEADLRLVRFLWCGNDGTVRAKASAVGGLESRIG |
| Ga0209156_103835651 | 3300026547 | Soil | MPPVEARDVVRQVEEAGLRLVRFLWCGNDGTVRAKASAARGLEGR |
| Ga0209474_106722731 | 3300026550 | Soil | VTARDVAVRADEADLRLVRFLWCGNDGTVRAKASARHGLE |
| Ga0208891_10013582 | 3300026878 | Soil | VEPAHVVKAVDEAGLRLVRFLWCGNDGTVRGTADARERCTGH |
| Ga0207428_106900391 | 3300027907 | Populus Rhizosphere | VSVDDVVAQFDEAGLRLLRFLWCGNDGTVRAKASGRHGLEGRLR |
| Ga0207428_112501832 | 3300027907 | Populus Rhizosphere | MDAADVVKRADEASLRLVRFLWCGNDGTVRAKASSRHGLE |
| Ga0268265_116645453 | 3300028380 | Switchgrass Rhizosphere | MTPEELARKADSAGLRLVRFLWCGNDGTIRAKASSRHGLE |
| Ga0268265_122108562 | 3300028380 | Switchgrass Rhizosphere | VQAAEVLHLADEADLRLVRFLWCGNDGTIRAKASGRAALG |
| Ga0268264_116374102 | 3300028381 | Switchgrass Rhizosphere | VSVDDVVAQFDEAGLRLLRFLWCGNDGTVRAKASGRHGLE |
| Ga0247828_102492871 | 3300028587 | Soil | MADSPAMDAADVVKRADEASLRLVRFLWCGNDGTVRAKASSG |
| Ga0247820_111254331 | 3300028597 | Soil | MMPRVIARQVVDRAEDARVRLVRFLWCGNDGTIRAKASGRHGLEQ |
| Ga0307293_100828391 | 3300028711 | Soil | VTAEDVVRKADEAGLRLVRFLWCGNDGTVRAKASTLPGLE |
| Ga0307284_103528721 | 3300028799 | Soil | VSVDDVVAQFDEAGLRLLRFLWCGNDGTVRAKASGRHGLEGRL |
| Ga0307281_100972061 | 3300028803 | Soil | VKAKDVVKNADEAGLRLVRFLWCGNDGTVRAKSSARHGLEGRL |
| Ga0307278_105023921 | 3300028878 | Soil | MQDVAARVDEEGIRLVRFLWCGNDGTVRAKASGRHG |
| Ga0247826_100704123 | 3300030336 | Soil | VDAGEVARRAEEADLRLVRFLWCGNDGTVRAKASSVRGLEDRVR |
| Ga0247826_113070753 | 3300030336 | Soil | MTPEELARKADSAGLRLVRFLWCGNDGTIRAKASSRHGLEGRLEA |
| Ga0307501_102049082 | 3300031152 | Soil | VDATKVVQRAGEAGLRLVRFLWCGNDGTVRAKASAVSGLE |
| Ga0307405_117810542 | 3300031731 | Rhizosphere | MALAEEVDAGAVVKRAEKAGLRLVRFLWCGNDGTVR |
| Ga0310904_111274411 | 3300031854 | Soil | VSTAAEIDEVVRLADEAGLRFVRFLWCGNDGTVRA |
| Ga0306921_120595101 | 3300031912 | Soil | LSAEDVLRKVDDAGIRLVRFLWCGNDGTVRAKASGRHGLDGRIGSGIG |
| Ga0306926_121253001 | 3300031954 | Soil | VTPAEVAFLAEEAGLALVRFLWCGNDGTVRAKASARHGLEGRL |
| Ga0306926_124712462 | 3300031954 | Soil | MDIDEVVQQVNDAELRFVRFLWCGNDGTIRAKASSRHGL |
| Ga0308176_117330781 | 3300031996 | Soil | MEVDHGSVVKRADKEGLRLVRFLWCGNDGTVRAKASS |
| Ga0306922_118098521 | 3300032001 | Soil | VTPDELLATIEDRGVRLVRFLWCGNDGTVRAKASARHGLAGRLG |
| Ga0318569_104700472 | 3300032010 | Soil | VTADELLANVEDRGIRLVRFLWCGNDGTVRAKASARH |
| Ga0307415_1017461201 | 3300032126 | Rhizosphere | MALLESADAEAVVKRAEEAGLRLVRFLWCGNDGTVRAKASSRHGLEGR |
| Ga0335073_114726361 | 3300033134 | Soil | MTADEVLATAEEEGLRLVRFLWCGNDGTIRAKASGRH |
| Ga0318519_102290972 | 3300033290 | Soil | VTPDELLATIEDRGVRLVRFLWCGNDGTVRAKASARHGL |
| Ga0364941_178793_3_116 | 3300034417 | Sediment | MDILRTARERGLMLVRFLWCGNDGTVRAKATALGGLEA |
| Ga0373948_0056409_713_853 | 3300034817 | Rhizosphere Soil | MSTAAEIDEVVRLADEAELRFVRFLWCGNDGTVRAKASARQGLGGRL |
| ⦗Top⦘ |