NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F051236

Metagenome Family F051236

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F051236
Family Type Metagenome
Number of Sequences 144
Average Sequence Length 48 residues
Representative Sequence IFDLHGNYSAAIWGLIVISALMVPLSLAMASPAELAKRIGQQRIRE
Number of Associated Samples 130
Number of Associated Scaffolds 144

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 97.92 %
% of genes from short scaffolds (< 2000 bps) 86.81 %
Associated GOLD sequencing projects 122
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.056 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(11.111 % of family members)
Environment Ontology (ENVO) Unclassified
(31.944 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(36.806 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: Yes Secondary Structure distribution: α-helix: 50.00%    β-sheet: 0.00%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 144 Family Scaffolds
PF04909Amidohydro_2 11.11
PF00753Lactamase_B 6.94
PF09084NMT1 4.17
PF01124MAPEG 2.78
PF00701DHDPS 2.78
PF03401TctC 2.08
PF01738DLH 2.08
PF01593Amino_oxidase 2.08
PF00296Bac_luciferase 1.39
PF02515CoA_transf_3 1.39
PF01797Y1_Tnp 1.39
PF13193AMP-binding_C 1.39
PF07690MFS_1 1.39
PF05990DUF900 1.39
PF00528BPD_transp_1 1.39
PF01717Meth_synt_2 1.39
PF135322OG-FeII_Oxy_2 1.39
PF01042Ribonuc_L-PSP 1.39
PF01425Amidase 0.69
PF16864Dimerisation2 0.69
PF13343SBP_bac_6 0.69
PF05973Gp49 0.69
PF09994DUF2235 0.69
PF00990GGDEF 0.69
PF00075RNase_H 0.69
PF02449Glyco_hydro_42 0.69
PF01850PIN 0.69
PF12146Hydrolase_4 0.69
PF14518Haem_oxygenas_2 0.69
PF11154DUF2934 0.69
PF02371Transposase_20 0.69
PF01609DDE_Tnp_1 0.69
PF01402RHH_1 0.69
PF00903Glyoxalase 0.69
PF0563523S_rRNA_IVP 0.69
PF04392ABC_sub_bind 0.69
PF00496SBP_bac_5 0.69

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 144 Family Scaffolds
COG03294-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyaseCell wall/membrane/envelope biogenesis [M] 5.56
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 4.17
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 4.17
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 2.08
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 1.39
COG4782Esterase/lipase superfamily enzymeGeneral function prediction only [R] 1.39
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 1.39
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 1.39
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 1.39
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 1.39
COG1874Beta-galactosidase GanACarbohydrate transport and metabolism [G] 0.69
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.69
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.69
COG3293TransposaseMobilome: prophages, transposons [X] 0.69
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.69
COG3547TransposaseMobilome: prophages, transposons [X] 0.69
COG3657Putative component of the toxin-antitoxin plasmid stabilization moduleDefense mechanisms [V] 0.69
COG4679Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin systemDefense mechanisms [V] 0.69
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.69
COG5421TransposaseMobilome: prophages, transposons [X] 0.69
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.69
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.69


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.06 %
UnclassifiedrootN/A6.94 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000559|F14TC_102730547All Organisms → cellular organisms → Bacteria1603Open in IMG/M
3300002407|C687J29651_10092500All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300003987|Ga0055471_10107520All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300004009|Ga0055437_10209614All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Sinimarinibacterium → unclassified Sinimarinibacterium → Sinimarinibacterium sp. CAU 1509627Open in IMG/M
3300004012|Ga0055464_10093275All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium829Open in IMG/M
3300004114|Ga0062593_100834000All Organisms → cellular organisms → Bacteria922Open in IMG/M
3300004778|Ga0062383_10221032All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300005166|Ga0066674_10129117All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1186Open in IMG/M
3300005172|Ga0066683_10109042All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1683Open in IMG/M
3300005178|Ga0066688_10567402All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300005187|Ga0066675_11067148All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium604Open in IMG/M
3300005289|Ga0065704_10355683All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300005294|Ga0065705_10218272All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1329Open in IMG/M
3300005327|Ga0070658_11023323All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300005353|Ga0070669_100036622All Organisms → cellular organisms → Bacteria3556Open in IMG/M
3300005355|Ga0070671_100981944All Organisms → cellular organisms → Bacteria → Proteobacteria739Open in IMG/M
3300005440|Ga0070705_101239652All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium616Open in IMG/M
3300005456|Ga0070678_101775222All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300005457|Ga0070662_101708443All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium543Open in IMG/M
3300005558|Ga0066698_10114360All Organisms → cellular organisms → Bacteria1793Open in IMG/M
3300005829|Ga0074479_10991654All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300005841|Ga0068863_101831352All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300005888|Ga0075289_1001334All Organisms → cellular organisms → Bacteria3204Open in IMG/M
3300006058|Ga0075432_10056918All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1387Open in IMG/M
3300006224|Ga0079037_102257465All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium543Open in IMG/M
3300006755|Ga0079222_10178506All Organisms → cellular organisms → Bacteria1248Open in IMG/M
3300006794|Ga0066658_10641071All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium581Open in IMG/M
3300006797|Ga0066659_10081166All Organisms → cellular organisms → Bacteria2152Open in IMG/M
3300006845|Ga0075421_100942830All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria982Open in IMG/M
3300006845|Ga0075421_101258318All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300006846|Ga0075430_100117210All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2219Open in IMG/M
3300006847|Ga0075431_101200128All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium721Open in IMG/M
3300006852|Ga0075433_10142409All Organisms → cellular organisms → Bacteria2131Open in IMG/M
3300006903|Ga0075426_10419571All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium989Open in IMG/M
3300006904|Ga0075424_100969773All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Sinimarinibacterium → unclassified Sinimarinibacterium → Sinimarinibacterium sp. CAU 1509906Open in IMG/M
3300006904|Ga0075424_101163019All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium822Open in IMG/M
3300006914|Ga0075436_100063845All Organisms → cellular organisms → Bacteria2545Open in IMG/M
3300009100|Ga0075418_12857253All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium527Open in IMG/M
3300009147|Ga0114129_10689337All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1314Open in IMG/M
3300009148|Ga0105243_10420060All Organisms → cellular organisms → Bacteria1247Open in IMG/M
3300009156|Ga0111538_10775426All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1214Open in IMG/M
3300009162|Ga0075423_10918211All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium928Open in IMG/M
3300009162|Ga0075423_12302609All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300009168|Ga0105104_10118978All Organisms → cellular organisms → Bacteria1423Open in IMG/M
3300009444|Ga0114945_10091961Not Available1697Open in IMG/M
3300009553|Ga0105249_12659756Not Available572Open in IMG/M
3300009609|Ga0105347_1023146All Organisms → cellular organisms → Bacteria2144Open in IMG/M
3300009609|Ga0105347_1134614All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300009609|Ga0105347_1136052All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium952Open in IMG/M
3300009610|Ga0105340_1451803All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium574Open in IMG/M
3300010040|Ga0126308_10677280All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300010043|Ga0126380_10682583All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium823Open in IMG/M
3300010047|Ga0126382_11774393All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300010329|Ga0134111_10041846All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1637Open in IMG/M
3300010336|Ga0134071_10087502All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1466Open in IMG/M
3300010336|Ga0134071_10382628All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium715Open in IMG/M
3300010362|Ga0126377_10121117All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2417Open in IMG/M
3300010362|Ga0126377_13393875All Organisms → cellular organisms → Bacteria → Proteobacteria515Open in IMG/M
3300010362|Ga0126377_13411004All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium514Open in IMG/M
3300010376|Ga0126381_104645428All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium529Open in IMG/M
3300010391|Ga0136847_11902580Not Available2263Open in IMG/M
3300010396|Ga0134126_10762641All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1096Open in IMG/M
3300011417|Ga0137326_1042483All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium982Open in IMG/M
3300011440|Ga0137433_1100026Not Available905Open in IMG/M
3300012038|Ga0137431_1017619All Organisms → cellular organisms → Bacteria1949Open in IMG/M
3300012175|Ga0137321_1093683All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium675Open in IMG/M
3300012198|Ga0137364_10473724Not Available940Open in IMG/M
3300012200|Ga0137382_10566051All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Sinimarinibacterium → unclassified Sinimarinibacterium → Sinimarinibacterium sp. CAU 1509810Open in IMG/M
3300012349|Ga0137387_10552273All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium835Open in IMG/M
3300012350|Ga0137372_10088157All Organisms → cellular organisms → Bacteria2628Open in IMG/M
3300012514|Ga0157330_1067959All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium545Open in IMG/M
3300012517|Ga0157354_1014026All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium850Open in IMG/M
3300012673|Ga0137339_1015484Not Available752Open in IMG/M
3300012922|Ga0137394_10210297All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1663Open in IMG/M
3300012922|Ga0137394_11001075All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium695Open in IMG/M
3300012929|Ga0137404_11638918All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300012930|Ga0137407_12216843All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium525Open in IMG/M
3300012948|Ga0126375_11719195All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium545Open in IMG/M
3300012964|Ga0153916_10377585All Organisms → cellular organisms → Bacteria1472Open in IMG/M
3300012975|Ga0134110_10629139All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium501Open in IMG/M
3300012976|Ga0134076_10559818All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium529Open in IMG/M
3300014272|Ga0075327_1028547All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1662Open in IMG/M
3300014324|Ga0075352_1265779All Organisms → cellular organisms → Bacteria → Proteobacteria534Open in IMG/M
3300014968|Ga0157379_10583095All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1043Open in IMG/M
3300015264|Ga0137403_10218797All Organisms → cellular organisms → Bacteria1828Open in IMG/M
3300015357|Ga0134072_10379499All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium551Open in IMG/M
3300015372|Ga0132256_101045356All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium932Open in IMG/M
3300015372|Ga0132256_101527442All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300015373|Ga0132257_100314965All Organisms → cellular organisms → Bacteria1883Open in IMG/M
3300015374|Ga0132255_101763141All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300015374|Ga0132255_104528675All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300015374|Ga0132255_105298754All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300015374|Ga0132255_106194651All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300016294|Ga0182041_10358784All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1228Open in IMG/M
3300018028|Ga0184608_10112232All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1148Open in IMG/M
3300018072|Ga0184635_10000154All Organisms → cellular organisms → Bacteria14604Open in IMG/M
3300018074|Ga0184640_10510683All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium528Open in IMG/M
3300018075|Ga0184632_10158618All Organisms → cellular organisms → Bacteria998Open in IMG/M
3300018083|Ga0184628_10003207All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria7801Open in IMG/M
3300018422|Ga0190265_10357703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1548Open in IMG/M
3300018433|Ga0066667_10814400All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium795Open in IMG/M
3300018466|Ga0190268_10233738All Organisms → cellular organisms → Bacteria1039Open in IMG/M
3300022563|Ga0212128_10072396Not Available2222Open in IMG/M
3300025157|Ga0209399_10205230All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium786Open in IMG/M
3300025159|Ga0209619_10409257All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium694Open in IMG/M
3300025313|Ga0209431_10518249All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300025327|Ga0209751_10791197All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300025791|Ga0210115_1010395All Organisms → cellular organisms → Bacteria2211Open in IMG/M
3300025792|Ga0210143_1001678All Organisms → cellular organisms → Bacteria → Proteobacteria5005Open in IMG/M
3300025911|Ga0207654_10584151All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300025935|Ga0207709_10447980All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria997Open in IMG/M
3300026067|Ga0207678_10025973All Organisms → cellular organisms → Bacteria → Proteobacteria5111Open in IMG/M
3300026547|Ga0209156_10072653All Organisms → cellular organisms → Bacteria1759Open in IMG/M
3300026550|Ga0209474_10712326All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium521Open in IMG/M
3300027163|Ga0209878_1032381All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium679Open in IMG/M
3300027462|Ga0210000_1036317All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300027511|Ga0209843_1075466Not Available579Open in IMG/M
3300027513|Ga0208685_1012821All Organisms → cellular organisms → Bacteria1996Open in IMG/M
3300027775|Ga0209177_10077941All Organisms → cellular organisms → Bacteria1005Open in IMG/M
3300027819|Ga0209514_10088374All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1878Open in IMG/M
3300027840|Ga0209683_10509378All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300027907|Ga0207428_10669512All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium744Open in IMG/M
3300028381|Ga0268264_10444370All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → Herbaspirillum lusitanum1255Open in IMG/M
3300028784|Ga0307282_10487332Not Available599Open in IMG/M
3300030006|Ga0299907_11260846All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium527Open in IMG/M
3300031229|Ga0299913_10510387All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1188Open in IMG/M
3300031547|Ga0310887_10657223All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300031716|Ga0310813_11521807All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium623Open in IMG/M
3300031719|Ga0306917_10279456All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1286Open in IMG/M
3300031720|Ga0307469_10998944All Organisms → cellular organisms → Bacteria → Proteobacteria781Open in IMG/M
3300031740|Ga0307468_100556755All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Sinimarinibacterium → unclassified Sinimarinibacterium → Sinimarinibacterium sp. CAU 1509925Open in IMG/M
3300031824|Ga0307413_10034957All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2878Open in IMG/M
3300031824|Ga0307413_10480326All Organisms → cellular organisms → Bacteria993Open in IMG/M
3300031854|Ga0310904_11284256All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium530Open in IMG/M
3300031949|Ga0214473_11273385All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300032001|Ga0306922_10534861Not Available1247Open in IMG/M
3300032004|Ga0307414_11067162All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300032122|Ga0310895_10106498All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1151Open in IMG/M
3300032132|Ga0315336_1302817All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300032157|Ga0315912_10286538All Organisms → cellular organisms → Bacteria1297Open in IMG/M
3300032892|Ga0335081_10712053All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1216Open in IMG/M
3300033417|Ga0214471_11002462All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium643Open in IMG/M
3300034354|Ga0364943_0007469All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3211Open in IMG/M
3300034690|Ga0364923_0008342All Organisms → cellular organisms → Bacteria2228Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere11.11%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil6.94%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.86%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.86%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.17%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands3.47%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.47%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.47%
Thermal SpringsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs2.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil2.08%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil2.08%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.08%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.08%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment1.39%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.39%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.39%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.39%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.39%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.39%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.39%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.39%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.39%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.39%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.69%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.69%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.69%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.69%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.69%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.69%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.69%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.69%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.69%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.69%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.69%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.69%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.69%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.69%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.69%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.69%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.69%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300002407Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1EnvironmentalOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300004009Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004012Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3FreshEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005888Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103EnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009444Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3EnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300011417Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2EnvironmentalOpen in IMG/M
3300011440Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2EnvironmentalOpen in IMG/M
3300012038Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2EnvironmentalOpen in IMG/M
3300012175Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT399_2EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012514Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510EnvironmentalOpen in IMG/M
3300012517Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610EnvironmentalOpen in IMG/M
3300012673Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT399_2EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300014272Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1EnvironmentalOpen in IMG/M
3300014324Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1EnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300022563OV2_combined assemblyEnvironmentalOpen in IMG/M
3300025157Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 (SPAdes)EnvironmentalOpen in IMG/M
3300025159Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3EnvironmentalOpen in IMG/M
3300025313Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)EnvironmentalOpen in IMG/M
3300025327Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025791Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025792Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027163Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes)EnvironmentalOpen in IMG/M
3300027462Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027511Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027513Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027819Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes)EnvironmentalOpen in IMG/M
3300027840Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032132Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - ASW #5EnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033417Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155EnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M
3300034690Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F14TC_10273054723300000559SoilGVVGPLVMGLIFDLNGNYSTAIWGLIVISALMIPLSLAMASPAELAERIAGC*
C687J29651_1009250033300002407SoilSVAIWGLIVISALMIPMSLAMASPAELANRIGQQRISDKGS*
Ga0055471_1010752033300003987Natural And Restored WetlandsIAAGVIGPMVMGIIFDLNGSYSVAIWGLIVISALMVPLSLAMASPAELAKRIGRV*
Ga0055437_1020961413300004009Natural And Restored WetlandsGVIGPLVMGMIFDLNGNYSVAIWGLIVTSALMMPVSLAMASPAELAKRIGQRID*
Ga0055464_1009327523300004012Natural And Restored WetlandsDINGNYSAAIWGLIVVGALMVPFSLAMSAPAELANRIERQ*
Ga0062593_10083400013300004114SoilVVGPMVMGMIFDLHGNYSAAIWGLIVISAFMIPLSLAMASPAALAIRIEQQPISEKNH*
Ga0062383_1022103223300004778Wetland SedimentVGAGVVGPLVMGIIFDINGNYSVAIWGLIVISALMVPMSLAMASPAELARRLGQLRTGDQGT*
Ga0066674_1012911733300005166SoilVMGLIFDLHGNYSAAIWGLIVISALMVPLSLAMASPAELAKRIGKG*
Ga0066683_1010904243300005172SoilGVIGPLVMGLIFDLHGNYSAAIWGLIVISALMVPLSLAMASPAELAKRIGKG*
Ga0066688_1056740213300005178SoilQGGSIAAGVIGPMVMGLIFDLHGNYSAAIWGLIVISALMVPLSLAMASPAELAKRIGKG*
Ga0066675_1106714813300005187SoilIFDLHGNYSAAIWGLIVISALMVPLSLAMASPAELAKRIGQQRIRE*
Ga0065704_1035568323300005289Switchgrass RhizosphereAGVVGPMVMGMIFDLHGNYSAAIWGLIVISAVMVPLSLAMASPAELIKRIEQQRIS*
Ga0065705_1021827233300005294Switchgrass RhizosphereGLIFDLHGNYSAAIWGLIAISAFMIPLSLAMASPTELAKRIERQPISDKGS*
Ga0070658_1102332333300005327Corn RhizosphereDLHGNYSAAIWGLIVISAVMVPLSLAMASPAELTKRIEQQRIS*
Ga0070669_10003662243300005353Switchgrass RhizosphereVVGPMVMGMIFDLHGNYSAAIWGLIVISAVMVPLSLAMASPAELIKRIEQQRIS*
Ga0070671_10098194413300005355Switchgrass RhizosphereMVMGMIFDLHGNYSAAIWGLIVISAVMVPLSLAMASPAELTKRIEQERIS*
Ga0070705_10123965213300005440Corn, Switchgrass And Miscanthus RhizosphereFDLHGNYSAAIWGLIVISAAMVPLSLAMASPAELTKRIEQQRIS*
Ga0070678_10177522223300005456Miscanthus RhizosphereMIFDLHGNYSAAIWGLIVISAFMIPLSLAMASPAALAMRLAQQRISEKNL*
Ga0070662_10170844313300005457Corn RhizosphereIFDLHGNYSAAIWGLIVISAVMVPLSLAMASPAELTKRIEQQRIS*
Ga0066698_1011436013300005558SoilVMGLIFDLHGNYSAAIWGLIVISALMVPLSLAMASPAELANRIERQQIGDKGG*
Ga0074479_1099165413300005829Sediment (Intertidal)GIWGLIIISALMMPISLAMAAPAELAKRLGQEPI*
Ga0068863_10183135213300005841Switchgrass RhizosphereGMIFDLHGNYSAAIWGLIVISAFMIPLSLAMASPAALAIRIEQQPISEKNH*
Ga0075289_100133413300005888Rice Paddy SoilPMVMGIIFDLNGSYSVAIWGLIVISALMVPLSLAMASPAELAKRIGRV*
Ga0075432_1005691813300006058Populus RhizosphereGMIFDLNGNYSVAIWGLIVISALMVPLSLAMASPAALAKRIGAAANQRYE*
Ga0079037_10225746513300006224Freshwater WetlandsIGPFVMGIIFDLDGNYSTAIWGLIVISALMMPLSLAMASPAELAKRIGQQPIGNTGS*
Ga0079222_1017850613300006755Agricultural SoilGNYSAAIWGLIVVGALMVPLSLAMTSPAELANRVAR*
Ga0066658_1064107123300006794SoilGLIFDLHGNYSAAIWGLIVISALMVPLSLAMASPAELAKRIGQQRIRE*
Ga0066659_1008116643300006797SoilMIFDLNGNYSAAIWGLIIISAFMMPLSLAMSSPAELAKRIGQQRIGDK
Ga0075421_10094283023300006845Populus RhizosphereLHGNYSAAIWGLIAISAFMVPLSLAMASPAELAKRIGQQPIN*
Ga0075421_10125831823300006845Populus RhizosphereNGNYSVGIWGLIVISAFMMPVSLAMASPADLAKRIGKQRIDEQV*
Ga0075430_10011721013300006846Populus RhizosphereLIVISALMVPLSLAMASPAALAKRIGAAANQRYE*
Ga0075431_10120012813300006847Populus RhizosphereLNGNYSVAIWGLIVISALMVPLSLAMASPAALAKRIGAAANQRYE*
Ga0075433_1014240913300006852Populus RhizosphereVVGPMVMGMIFDLHGNYSAAIWGLIVTSAFMIPLSLAMASPAELALRIEQQMNKVGD*
Ga0075426_1041957113300006903Populus RhizosphereAGVVGPMVMGMIFDLHGNYSAAIWGLIVTSAFMIPLSLAMASPAELALRIEQQMNKVGD*
Ga0075424_10096977313300006904Populus RhizosphereIFDLHGNYSAAIWGLIAISALMVPLSLAMASPTELAKRIERQ*
Ga0075424_10116301943300006904Populus RhizosphereAGVIGPFVMGMIFDLHGNYSAAIWGLIVISALMVPLSLAMASPAALAKRIGAARRL*
Ga0075436_10006384543300006914Populus RhizosphereGNYSAAIWGLIVISAFMIPLSLAMASPAALAMRIEQQRISEKNL*
Ga0075418_1285725323300009100Populus RhizosphereYSAAIWGLIAISAFMVPLSLAMASPAELAKRIGQQPIN*
Ga0114129_1068933713300009147Populus RhizosphereMGLIFDLHGNYSAAIWGLIVISALMVPLSLAMASPAELANRIEHQASEQPC*
Ga0105243_1042006013300009148Miscanthus RhizosphereVVGPMVMGMIFDLHGNYSAAIWGLIVISAFMIPLSLAMASPAALAMRIEQQRISEKNL*
Ga0111538_1077542623300009156Populus RhizosphereMGMIFDLNGNYSVAIWGLIVISGLMVPLSLAMASPAALAKRIGAAVDQR*
Ga0075423_1091821113300009162Populus RhizosphereIGPFVMGMIFDLNGNYSVAIWGLIVISALMVPLSLAMASPAALAKRIGAAANQRYE*
Ga0075423_1230260923300009162Populus RhizosphereGVVGPMVMGMIFDLHGNYSAAIWGLIVISAFMIPLSLAMASPAALAMRIEQQRISEKNL*
Ga0105104_1011897813300009168Freshwater SedimentLNGNYSVAIWGIIVISALMVPLSLAMASPAALAKRIGSAAGNS*
Ga0114945_1009196143300009444Thermal SpringsGPLVMGIIFDLNGNYSVAIWGLIVISALMVPLSLAMASPAELAKRIGQRRTSDRGS*
Ga0105249_1265975613300009553Switchgrass RhizosphereNYSAAIWGLIVTSALMVPLSLAMASPTELATRIEQQQRI*
Ga0105347_102314623300009609SoilVMGIIFDLDGNYSTAIWGLIVISALMMPLSLAMASPAELANRIGQQPIGDTGS*
Ga0105347_113461413300009609SoilIWGLIVISAFMIPLSLAMASPAELAKRIGQQRIN*
Ga0105347_113605223300009609SoilVMGIIFDLDGNYSTAIWGLIVISALMMPLSLAMASPAELAKRIGQQPIGDTGS*
Ga0105340_145180323300009610SoilVMGLIFDLHGNYSAAIWGLIAISAFMVPLSLAMASPAELAKRIGQQPIN*
Ga0126308_1067728023300010040Serpentine SoilPFIMGLIFDLNGNYSVAIWGLIVLGALMVPLSLAMGSPAELAKRIGQQPTS*
Ga0126380_1068258313300010043Tropical Forest SoilMGVIFDMKGNYSIGIWGLIIISALMVPLSLAMASPAELARRIEQRQ*
Ga0126382_1177439323300010047Tropical Forest SoilVMGVIFDMKGNYSIGIWGLIIISALMVPLSLAMASPAELARRVEQRQ*
Ga0134111_1004184623300010329Grasslands SoilLVMGIIFDLDGNYSVAIWALIVISALMVPLSLAMASPAELAKRIGQQRIRE*
Ga0134071_1008750213300010336Grasslands SoilYSAAIWGLIVIGALMMPLSLAMASPAELAKRIGQQRIRE*
Ga0134071_1038262813300010336Grasslands SoilIWGLIVISALMVPLSLAMASPAELANRIERQQIGDKGG*
Ga0126377_1012111733300010362Tropical Forest SoilYSAAIWGLIVISAFMVPLSLAMASPAELAKRIEQHHLA*
Ga0126377_1339387513300010362Tropical Forest SoilPIAAGVIGPLVMGMIFDLNGNYSAAIWGLIVISAFMVPLSLAMASPAELAERIEQHHLA*
Ga0126377_1341100423300010362Tropical Forest SoilGPLVMGVIFDMKGNYSIAIWGLIIISALMVPLSLAMASPAELARRIEQRQ*
Ga0126381_10464542813300010376Tropical Forest SoilLQGAPVAAGVIGPLVMGVIFDMKGNYSIAIWGLIIISALMVPLSLAMASPAELARRIEQRQ*
Ga0136847_1190258043300010391Freshwater SedimentLIVISAFMMPLSLAMASPAELAKRIGQQRINDKDS*
Ga0134126_1076264113300010396Terrestrial SoilHGNYSAAIWGLIVISAVMVPLSLAMASPAELTKRIEQQRIS*
Ga0137326_104248323300011417SoilAPIAAGVIGPLVMGIIFDLNGNYSVAIWGLIVISALMVPLSLAMASPAALAKRIGAAAD*
Ga0137433_110002613300011440SoilSVAICGLIVISALMVPLSLAMASPAALAKRIGAAAD*
Ga0137431_101761913300012038SoilGVIGPLVMGIIFDLNGNYSVAICGLIVISALMVPLSLAMASPAALAKRIGAAAD*
Ga0137321_109368323300012175SoilMGIIFDLNGNYSTAIWGLIVVSALMIPMSLAMASPAELAKRIEQQRT*
Ga0137364_1047372413300012198Vadose Zone SoilLIVISALMVPLSLAMASPAELANRIERQQIGDKGS*
Ga0137382_1056605113300012200Vadose Zone SoilLHGNYSAAIWGLIAISTLMVPLSLAMASPAELAKRIAGC*
Ga0137387_1055227313300012349Vadose Zone SoilIFDLHGNYSAAIWGLIVISALMVPLSLAMASPAELANRIERQQIGDKGG*
Ga0137372_1008815713300012350Vadose Zone SoilNGNYSVAIWGLIVISALMVPLSLAMASPTELAKRIGAAANQR*
Ga0157330_106795913300012514SoilGPLVMGLIFDLHGNYSAAIWGLIAISALMVPLSLVMASPTELAKRIERQ*
Ga0157354_101402613300012517Unplanted SoilPLVMGLIFDLHGNYSAAIWGLIAISAFMVPLSLAMASPAELAKRIERQ*
Ga0137339_101548423300012673SoilAGIWGLIVISAFMMPLSLAMASPAELAKRIGQQRISDKGS*
Ga0137394_1021029713300012922Vadose Zone SoilHGNYSAAIWGLIVISALMVPLSLAMASPAVLAKRIGAARSL*
Ga0137394_1100107523300012922Vadose Zone SoilGLIFDLHGNYSAAIWGLIAISDLMVPLSLAMASPSELDKRIGQQPISNDKGS*
Ga0137404_1163891813300012929Vadose Zone SoilMIGPMVMGIIFDLNGSYSVAIWGLIVISALMVPLSLAMASPAALAKRIGAAVDQR*
Ga0137407_1221684313300012930Vadose Zone SoilLVMGLIFDLHGNYSAAIWGLIAISAFMVPLSLAMASPAELAKRIAGC*
Ga0126375_1171919513300012948Tropical Forest SoilVIFDMKGNYSIGIWGLIIISALMVPLSLAMASPAELARRIEQRQ*
Ga0153916_1037758533300012964Freshwater WetlandsGNYSAAIWGLIVVGALMVPLSLAMSSPAELANRIERQRF*
Ga0134110_1062913913300012975Grasslands SoilNGNYSTAIWGLIVISALMVPLSLAMASPAELAKRIGKG*
Ga0134076_1055981813300012976Grasslands SoilAIWGFIVISALMVPLSLAMASPAELANRIERQQIGDKGS*
Ga0075327_102854723300014272Natural And Restored WetlandsIIFDLNGNYSVAIWGLIVISALMVPLSLAMASPAALAKRMGAAKDQG*
Ga0075352_126577913300014324Natural And Restored WetlandsMIFDLNGNYSVAIWGLIVTSAMMMPVSLAMASPAELAKRIGQRID*
Ga0157379_1058309523300014968Switchgrass RhizospherePMVMGMIFDLHGNYSAAIWGLIVISAVMVPLSLAMASPAELTKRIEQQRIS*
Ga0137403_1021879723300015264Vadose Zone SoilQGGPIAAGVIGPFVMGMIFDLDGYSVAIWGLIVISALMVPLSLAMASPAALAQRIGAAASQRYE*
Ga0134072_1037949913300015357Grasslands SoilDLNGNYSTAIWGLIVISALMVPLSLAMASPAELAKRIGQQRIRE*
Ga0132256_10104535623300015372Arabidopsis RhizosphereVIFDLNGNYSVAIWGLVVIGALMVPLSLAMASPAELTNRIELQRIAAE*
Ga0132256_10152744213300015372Arabidopsis RhizosphereIWGLIVISAFMIPLSLAMASPAALAIRIEQQPEE*
Ga0132257_10031496513300015373Arabidopsis RhizosphereSAAIWGLIVISAFMIPLSLAMASPAALAMRIEQQRISEKNL*
Ga0132255_10176314123300015374Arabidopsis RhizosphereGNYSAAIWGLIVISAFMIPLSLAMASPAALAMRIEQQPISEKNY*
Ga0132255_10452867523300015374Arabidopsis RhizosphereAAIWGLIVISAFMIPLSLAMASPAALAIRIEQQPEE*
Ga0132255_10529875423300015374Arabidopsis RhizosphereAAIWGLIVISAFMIPLSLAMASPAALAIRIEQQPISEKKNH*
Ga0132255_10619465123300015374Arabidopsis RhizosphereAPVAAGGIGPLVMGIIFDLRGNYSVAIWGLIIISALMVPLSLAMASPAALAKRIGAAASQR*
Ga0182041_1035878413300016294SoilMGMIFDLNGNYSAAIWGLIVISAVMMPLSLAMAPPGELAKRIGQQRISDKSSWPS
Ga0184608_1011223223300018028Groundwater SedimentIIFDLNGNYSTAIWGLIVISALMVPLSLAMASPAELAKRIGQQRNDDKGS
Ga0184635_10000154243300018072Groundwater SedimentIFDLNGNYSVAIWGLIVISALMVPLSLAMASPAALAKRIGAAADQR
Ga0184640_1051068323300018074Groundwater SedimentVMGLIFDLNGNYSVAIWGLIVISAFMIPLSLAMASPAELARRIGQQRTSDRGS
Ga0184632_1015861813300018075Groundwater SedimentVAAGVIGPFVMGMIFDLHGNYSAAIWGLIVISALMVPLSLAMASPAALAKRIGAAVVEHAAR
Ga0184628_1000320713300018083Groundwater SedimentVMGIIFDLNGNYSAAIWGLAIISALMMPVSLAMASPAELAKRIGQ
Ga0190265_1035770313300018422SoilAAGVIGPFVMGVIFDLDGNYSAAIWGLVVISALMMPVSLAMASPAELAKRIGH
Ga0066667_1081440013300018433Grasslands SoilMGLIFDLHGNYSAAIWGLIVIGALMMPLSLAMASPAELAKRIGQQRIRE
Ga0190268_1023373813300018466SoilFDLHGNYSAAIWGLIAISAFMIPLSLAMASPAELAKRIERQPID
Ga0212128_1007239613300022563Thermal SpringsVAAGVIGPLVMGIIFDLNGNYSVAIWGLIVISSLMVPLSLAMASPSELAKRIGQQQTSDKAS
Ga0209399_1020523013300025157Thermal SpringsGPLVMGIIFDLNGNYSVAIWGLIVISALMVPLSLAMASPAELAKRIGQRRTSDRGS
Ga0209619_1040925723300025159SoilIAAGVIGPLVMGIIFDLNGNYSVGIWGLIVISALMVPLSLAMASPTELAKRIAQQPINDDDI
Ga0209431_1051824913300025313SoilPLVMGIIFDLNGNYSVAIWGLIVISALMIPMSLAMASPAELANRIGQQRISDKGS
Ga0209751_1079119713300025327SoilGGSIAAGVIGPLVMGIIFDLNGNYSAAIWGLIVISALMIPMSLAMASPAELANRIGQQRISDKGS
Ga0210115_101039553300025791Natural And Restored WetlandsIAAGVIGPMVMGIIFDLNGSYSVAIWGLIVISALMVPLSLAMASPAELAKRIGRV
Ga0210143_100167813300025792Natural And Restored WetlandsLIFDLNGNYSVAIWGLVVISALMVPVSVVMASPAELAKRVGQQRASNTKS
Ga0207654_1058415113300025911Corn RhizosphereMIFDLHGNYSAAIWGLIVISAVMVPLSLAMASPAELTKRIEQQRIS
Ga0207709_1044798013300025935Miscanthus RhizosphereGNYSAAIWGLIAISAFMVPLSLAMASPAELAKRIERQ
Ga0207678_1002597363300026067Corn RhizosphereVGPMVMGMIFDLHGNYSAAIWGLIVISAVMVPLSLAMASPAELTKRIEQERIS
Ga0209156_1007265333300026547SoilGVIGPLVMGLIFDLHGNYSTAIWGLIVISAFMIPLSLAMASPAELAKRIGKDFL
Ga0209474_1071232613300026550SoilAGVIGPMVMGLIFDLHGNYSAAIWGLIVISALMVPLSLAMASPAELAKRIGQQRIRE
Ga0209878_103238113300027163Groundwater SandGVIGPLVMGIIFDLNGNYSVAIWGLIVISALMVPLSLAMATPAALAKRIGAAADQR
Ga0210000_103631723300027462Arabidopsis Thaliana RhizosphereMGIIFDLNGSYSVAIWGLIVISALMVPLSLAMASPAELAKRIGRL
Ga0209843_107546613300027511Groundwater SandVAIWGLIVISALMVPLSLAMATPAALAKRIGAAADQR
Ga0208685_101282123300027513SoilWGLIVISALMMPLSLAMASPAELANRIGQQPIGDTGS
Ga0209177_1007794113300027775Agricultural SoilLHGNYSAAIWGLIVISAFMIPLSLAMASPAALAIRIEQQREE
Ga0209514_1008837413300027819GroundwaterDLNGNYSAAIWGLIVISALMIPMSLAMASPAELAKRIGQQRISDKGS
Ga0209683_1050937813300027840Wetland SedimentGVGGPLVMGIIFDINGNYSVAIWGLIVISALMVPMSLAMASPAELARRLGQLRTGDQGT
Ga0207428_1066951213300027907Populus RhizosphereGMIFDLNGNYSVAIWGLIVISALMVPLSLAMASPAALAKRIGAAANQRYE
Ga0268264_1044437023300028381Switchgrass RhizosphereGNYSAAIWGLIVISAVMVPLSLAMASPAELTKRIEQQRIS
Ga0307282_1048733223300028784SoilGLIAISALMVPLSLAMASPSELDKRIGQQPISDKGS
Ga0299907_1126084613300030006SoilDLNGHYSVAIWGLIVLSALMVPLSLAMASPADLAKRIGQRRTG
Ga0299913_1051038713300031229SoilFDLNGNYSVGIWGLIVISALMVPLSLAMASPADLAKRIGRAPDQR
Ga0310887_1065722323300031547SoilLQGGPIAAGVIGPLVMGLIFDLNGNYSTAIWGLIVISALMIPLSLAMGSPADLAKRIGASDQR
Ga0310813_1152180713300031716SoilYSVAIWGLVVIGALMVPLSLAMASPAELTNRIELQRIAAE
Ga0306917_1027945613300031719SoilFVMGMIFDLNGNYSAAIWGLIVISALMMPLSLAMASPAELAKRIGQQRISDKGS
Ga0307469_1099894413300031720Hardwood Forest SoilNYSVAIWGLIAISALVMPLSLAMASPAELAKRIGQQRINDKGS
Ga0307468_10055675513300031740Hardwood Forest SoilAGVVGPLVMGLIFDLHGNYSAAIWGLIAISALMVPLSLAMASPAELAKRIERQ
Ga0307413_1003495733300031824RhizosphereLNGNYSTAIWGLIVISALMIPLSLAMGAPADLAKRIGATDQR
Ga0307413_1048032613300031824RhizosphereNGNYSTAIWGLIVISALMIPMSLAMGSPADLARRIRAADSDRRS
Ga0310904_1128425613300031854SoilFDLHGNYSAAIWGLIVTSALMVPLSLAMASPTELATRIEQQRI
Ga0214473_1127338513300031949SoilSVAIWGLIVISALMVPLSLAMASPAELAKRIGAAAEQR
Ga0306922_1053486113300032001SoilMGLIFDLHGNYSAAIWGLIVISALMVPLSLAMASPAELAKRIEQPAGPNKDS
Ga0307414_1106716233300032004RhizosphereGNYSTAIWGLIVISALMIPMSLAMGSPADLAMRIRAADSDRRS
Ga0310895_1010649813300032122SoilLHGNYSVAIWGLIIISALMVPLSLAMASPAALAKRVGAAASQR
Ga0315336_130281723300032132SeawaterVMGIIFDLDGNYSVGIWGLMALSALMVPVSLAMASPADLAQRIESDRRSKATSLSVS
Ga0315912_1028653813300032157SoilDLHGNYSAAIWGLIVTSALMVPLSLAMASPTELATRIEQQRI
Ga0335081_1071205323300032892SoilIFDLNGNYSAAIWGLVAIGALMVPLSLAMASPAELTTRIER
Ga0214471_1100246213300033417SoilAGVIGPLVMGIIFDLNGNYSVAIWGLIVISALMVPLSLAMASPAALAKRIGAAAEQR
Ga0364943_0007469_3029_31963300034354SedimentMIGPLVMGIIFDLNGNYSVAIWGLIVISALMVPLSLAMASPAALAKRIGAAADQR
Ga0364923_0008342_2081_22243300034690SedimentMGIIFDLNGNYSVAIWGLIVISALMVPLSLAMASPAALATRIGAAAD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.