| Basic Information | |
|---|---|
| Family ID | F050534 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 145 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VEEVTDEPLYRDRVCGIDIGKAGMAATIRVPSDKDPARRA |
| Number of Associated Samples | 135 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 1.38 % |
| % of genes from short scaffolds (< 2000 bps) | 1.38 % |
| Associated GOLD sequencing projects | 132 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (99.310 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.241 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.138 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.448 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.88% β-sheet: 29.41% Coil/Unstructured: 64.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF02371 | Transposase_20 | 9.66 |
| PF00903 | Glyoxalase | 1.38 |
| PF00589 | Phage_integrase | 1.38 |
| PF00248 | Aldo_ket_red | 1.38 |
| PF13185 | GAF_2 | 0.69 |
| PF05724 | TPMT | 0.69 |
| PF01548 | DEDD_Tnp_IS110 | 0.69 |
| PF02518 | HATPase_c | 0.69 |
| PF11716 | MDMPI_N | 0.69 |
| PF13751 | DDE_Tnp_1_6 | 0.69 |
| PF03575 | Peptidase_S51 | 0.69 |
| PF04672 | Methyltransf_19 | 0.69 |
| PF01348 | Intron_maturas2 | 0.69 |
| PF13546 | DDE_5 | 0.69 |
| PF01381 | HTH_3 | 0.69 |
| PF00208 | ELFV_dehydrog | 0.69 |
| PF03435 | Sacchrp_dh_NADP | 0.69 |
| PF14333 | DUF4389 | 0.69 |
| PF08388 | GIIM | 0.69 |
| PF00011 | HSP20 | 0.69 |
| PF13565 | HTH_32 | 0.69 |
| PF09346 | SMI1_KNR4 | 0.69 |
| PF09107 | SelB-wing_3 | 0.69 |
| PF12796 | Ank_2 | 0.69 |
| PF03050 | DDE_Tnp_IS66 | 0.69 |
| PF00440 | TetR_N | 0.69 |
| PF02945 | Endonuclease_7 | 0.69 |
| PF14104 | DUF4277 | 0.69 |
| PF00196 | GerE | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 10.34 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.69 |
| COG0334 | Glutamate dehydrogenase/leucine dehydrogenase | Amino acid transport and metabolism [E] | 0.69 |
| COG2902 | NAD-specific glutamate dehydrogenase | Amino acid transport and metabolism [E] | 0.69 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 99.31 % |
| All Organisms | root | All Organisms | 0.69 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300012211|Ga0137377_10455820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1217 | Open in IMG/M |
| 3300025942|Ga0207689_10333061 | Not Available | 1261 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.24% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.79% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 7.59% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 6.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.83% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.14% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.14% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.76% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.76% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.07% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.38% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.38% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 1.38% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.38% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.38% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.38% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.69% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.69% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.69% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.69% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.69% |
| Switchgrass, Maize And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Switchgrass, Maize And Miscanthus Rhizosphere | 0.69% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.69% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.69% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2044078000 | Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL | Environmental | Open in IMG/M |
| 2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026817 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 17 (SPAdes) | Environmental | Open in IMG/M |
| 3300026844 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAA (SPAdes) | Environmental | Open in IMG/M |
| 3300026920 | Forest soil microbial communities from Willamette National Forest, Oregon, USA, amended with Nitrogen - NN397 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028779 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ZMB_2292850 | 2044078000 | Switchgrass, Maize And Miscanthus Rhizosphere | VEEVTDEPLYRDRVCGIDIGKAGMAATIRVPSDRDPARRPARPAASRPRT |
| FD1_05512400 | 2170459024 | Grass Soil | VEEVTDEPLYRDRVCGIDIGKAGMVATIRVPSDRDPA |
| FG2_07882170 | 2189573004 | Grass Soil | VTDEPLYRDRVCGIDIGKAGMVATIRVPSDRDPARRMQE |
| INPhiseqgaiiFebDRAFT_1015173701 | 3300000364 | Soil | MEEVADEPLYRDRVCGIKIGKAGIVATIRVPSDKDPARRVAETRSFGIT |
| JGI10216J12902_1098510781 | 3300000956 | Soil | VEEVTGEPLHRDRVCGTGTGKAGMAAAIRVPSGKDPSRRMAETRMFGTTRREVLALAGWLRCWQ |
| JGI12627J18819_102619511 | 3300001867 | Forest Soil | MEEVTDEPLYRDRVCGIDIGKAELYATIRVPSDKD |
| JGI25615J43890_10909242 | 3300002910 | Grasslands Soil | VDEVTDEPLYRDRVCGIDIGKAELYATIRVPSENNPARRAA |
| JGI25617J43924_100207591 | 3300002914 | Grasslands Soil | VDEVTDEPLYRDRVCGIDIGKAELYATIRVPSENNPARRA |
| Ga0070660_1012344741 | 3300005339 | Corn Rhizosphere | VEEVTGEPLHRDRVCDTGIGKAEMYATIRVPSEKNPARRASETRSFATTKRGVLAL |
| Ga0070681_102661031 | 3300005458 | Corn Rhizosphere | VEEVTGEPLHRDRVCGTGIGKAEMYATIRVPSEKNPAWRASETRSFATTKRGVLALADWL |
| Ga0070706_1000278201 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MEEVTGGPLYRDRVCGIGIGKAELYATIRVPSDSNPARRASGTRRFAATRRGVLAL |
| Ga0066695_108054021 | 3300005553 | Soil | VRRVEEVTDEPLYRDRVCGIDIGKAQMVATIRVPSDRDLARRM |
| Ga0068852_1013637761 | 3300005616 | Corn Rhizosphere | VEEVTGEPLHRDRVCGTGIGKAEMYATIRVPSEKNPARR |
| Ga0066903_1054529332 | 3300005764 | Tropical Forest Soil | MRSRPRTSPLYRSRVCGVDVGKAELYATIRVPSDGNPARRASETRRFA |
| Ga0075017_1001693091 | 3300006059 | Watersheds | VEEVTDEPLYRDRVCGIDIGKAGMVATIRVPSDKD |
| Ga0070712_1012381992 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MEEVTDEPLYRDRVCGIDIGKAGMVATIRVPSDKDPARRM |
| Ga0099830_111143271 | 3300009088 | Vadose Zone Soil | VEEVTDEPLHRDRVCGIDIGKAGMVVTIRVPSDANPARR |
| Ga0116214_10047681 | 3300009520 | Peatlands Soil | VDEVTDEPLYRDRVCGIDIGKAQMAATIRVPSDKDPARRMAETR |
| Ga0116222_11070561 | 3300009521 | Peatlands Soil | MRGDEMTDEPLYRNRVCGIDIGKAQMVATIRVPSDRDPARRAAETRTFATTK |
| Ga0116136_10652651 | 3300009547 | Peatland | VEEVTDEPLYRDRVCGIDIGKAGMAATIRVPSDKDPARRAAE |
| Ga0116224_102907631 | 3300009683 | Peatlands Soil | MRERSGEQRVEEVTDEPLYRDRVCGIDIGKAGLVATIRVPSDRDP |
| Ga0126374_115060491 | 3300009792 | Tropical Forest Soil | VEEVTGGPLYRDRMCGIDIGKAAMVATIRVPSESN |
| Ga0116219_101130801 | 3300009824 | Peatlands Soil | MEEVTDEPLYRDRVCGIDIGKAQLYATIRVPSDGNPARRASETRS |
| Ga0126373_123594232 | 3300010048 | Tropical Forest Soil | VEEVRDEPLYRDRVCGIDIGKAQLYATIRVPSDANPARRASETREVAIT |
| Ga0134063_106112772 | 3300010335 | Grasslands Soil | VEDVRDEPLYRSRVCGIDVGKAELYATIRVPSDGNPARRASETRRFATT |
| Ga0134071_103294121 | 3300010336 | Grasslands Soil | VEEVTDEPLYRDRVCGIDIGKAEMHATIRVPSDANPARRMSETR |
| Ga0126376_124105511 | 3300010359 | Tropical Forest Soil | VDEVADEPLYRDRVCGIDIGKAGMAATIRVPSEKDPLRRASETRLFPATR |
| Ga0126372_131793702 | 3300010360 | Tropical Forest Soil | VEDVRDEPLYRSRVCGVDVGKAELYATIRVPSDGNPARRASETRRFATTR |
| Ga0126378_115361592 | 3300010361 | Tropical Forest Soil | VEEVTGEPLYRDRVCGIDIGKAEMHATIRVPSEANPARRAAETRSFATT |
| Ga0126381_1030727052 | 3300010376 | Tropical Forest Soil | VEDVTDEPLYRDRVCGIDIGKAGMAATIRVPSDKDPLRRAQET |
| Ga0136449_1031732701 | 3300010379 | Peatlands Soil | MEEVTDEPLYRDRVCGIDIGKAQLYATIRVPSDGNP |
| Ga0136449_1038139761 | 3300010379 | Peatlands Soil | MRERSGEGRVEEVTDEPLYRDRVCGIDIGKAQMVATIRVPSDRDPAR |
| Ga0134126_122871591 | 3300010396 | Terrestrial Soil | VEEVTDEPLYRDRACCIDIGKAQMAATIRVPSDSNPARRASETRSLGTTKRE |
| Ga0137392_111406731 | 3300011269 | Vadose Zone Soil | VDEVTDEPLYRDRVCGIDIGKAGMAATIRVPSDRDPARRAAETRS |
| Ga0137364_101343902 | 3300012198 | Vadose Zone Soil | VEDVRDEPLYRSRVCGIDVGKAELYATIRVPSDGNP |
| Ga0137383_103933642 | 3300012199 | Vadose Zone Soil | MEEVTGEPLYRDRVCGIDIGKAELYATIRVPSDSNPARRASETRRFAATR* |
| Ga0137399_103041322 | 3300012203 | Vadose Zone Soil | MEEVTDEPLYRDRVCGTGIGKAQLYATIRVPSDQNPARRASETRSFGTTK* |
| Ga0137376_100930104 | 3300012208 | Vadose Zone Soil | MEEVTDEPLYRDRVCGIDIGKAGLVATIRVPSEKDPARRS* |
| Ga0137379_109566951 | 3300012209 | Vadose Zone Soil | MEEVTGEPLYRDRVCGIDIGKAELYATIRVPSDKNPARRASETRS |
| Ga0137379_111412091 | 3300012209 | Vadose Zone Soil | VEDVRDEPLYRSRVCGIDVGKAELYATIRVPSDNDPARR |
| Ga0137378_101280301 | 3300012210 | Vadose Zone Soil | MEEVTDEPLYRDRVCGTGIGKAEMYATIRVPSETN |
| Ga0137378_105739572 | 3300012210 | Vadose Zone Soil | MEEVTDEPLYRDRVCGTGIGKAELYATIRVPSDSNPARRASETRRFAATR* |
| Ga0137378_106105211 | 3300012210 | Vadose Zone Soil | VEEVTDEPLYRDRVCGTGIGKTEMHATIRVPSDTNPERRMSETRAFATTKRGV |
| Ga0137378_106892841 | 3300012210 | Vadose Zone Soil | MRVDEVTDEPLYRDRVCGIDIGKAGMAATIRVPSERDPSRRAAETR |
| Ga0137377_103850182 | 3300012211 | Vadose Zone Soil | MEEVTGEPLYRDRVCGTGIGKAELYATIRVPSDSNPARRASETRRFAATR* |
| Ga0137377_104558203 | 3300012211 | Vadose Zone Soil | MEEVTDEPLYRDRVCGIDIGKAQMVATIRGPSDRDPSRRMQYSRGSGTTKRE |
| Ga0137386_102150242 | 3300012351 | Vadose Zone Soil | VDEVTDEPLYRDRVCGIDIGKAELYATIRVPSDKDPAR |
| Ga0137360_111212311 | 3300012361 | Vadose Zone Soil | MEEVTDEPLYRDRVCGIDIGKAELYATIRVPSDKNPARRAS |
| Ga0137410_109727472 | 3300012944 | Vadose Zone Soil | MRERSGEGQVQEVTGEPRYRDRVCGIDIGRAGLVATIRVPSDRDPARR |
| Ga0126369_135440121 | 3300012971 | Tropical Forest Soil | MDEVTDEPLYRDRVCGIDIGKAGLAATIRVPSEENPARRASETRLFPAT |
| Ga0164306_105957161 | 3300012988 | Soil | VDEVGDEPLYRDRVCGIDIGKAGMAVTIRVPSGKNPGRRMAETRTFGTTRREVLALA |
| Ga0182000_101138402 | 3300014487 | Soil | VDEVTDEPLYRDRVCGIDIGKAQMVATIRVPSDRDPARRASET |
| Ga0137403_108931682 | 3300015264 | Vadose Zone Soil | VEEVTDEPLYRDRVCGIDIGKAGKVAPIRVPSDGDAARRAAETRGLGTT |
| Ga0182033_112771382 | 3300016319 | Soil | VDEVTDEPLYRDRVGGIDIGKAEMYATIRVPSGKNPAR |
| Ga0182038_106793171 | 3300016445 | Soil | MEEVTDEPLYRDRVCGIDIGKAGLVATIRVPSGRDPARRA |
| Ga0181505_108577652 | 3300016750 | Peatland | MEEVTDEPLYRDRVCGIDIGKAELYATIRVPSDKDPARRASET |
| Ga0187802_101178232 | 3300017822 | Freshwater Sediment | VEEVTEEPLYRDRVCGIDIGKAQMLATIRVPADKDPARRAQET |
| Ga0187802_104440271 | 3300017822 | Freshwater Sediment | MEEVTDEPLYRDRVCGIDIGKAELYATIRVPSDKDPARRASE |
| Ga0187820_11988162 | 3300017924 | Freshwater Sediment | VDEVSDEPLYRDRVCGIDIGKAQMAATIRVPSDRDPARRSAETRTFATTK |
| Ga0187856_13215061 | 3300017925 | Peatland | VEEVTDEPLYRDRVCGIDIGKAGMAATIRVPSDKDPARRA |
| Ga0187824_103392201 | 3300017927 | Freshwater Sediment | VTDEPLYRDRVCGIDIGKAGLYATIRVPSDSNPARRASET |
| Ga0187806_12272941 | 3300017928 | Freshwater Sediment | VEEVTDEPLYRDRVCGIDIGKAQMVATIRVPSDKDPARR |
| Ga0187814_102550121 | 3300017932 | Freshwater Sediment | VDEVSDEPLYRNRVCGIDIGKAQMVATIRVPSDRDPV |
| Ga0187775_105335191 | 3300017939 | Tropical Peatland | VEEVTDEPLYRDRVCGIDIGKAGMVATIRVPSDPNQRIER |
| Ga0187808_101183392 | 3300017942 | Freshwater Sediment | MEEVTGEPLYRDRVCGIDIGKAGMVATIRVPSDKDPSRRAQ |
| Ga0187817_104069051 | 3300017955 | Freshwater Sediment | VEEVTDEPLYRDRACGIDIGKAGMVATIRVPSGKDPARRAAE |
| Ga0187817_104109881 | 3300017955 | Freshwater Sediment | MEEVTDEPLYRDRVCGIDIGKAQMVATIRVPSDKDPSR |
| Ga0180437_109885462 | 3300017963 | Hypersaline Lake Sediment | VEEVTDEPLYRDRVCGIDIGKAELYATIRVPSEKNPARRAAE |
| Ga0187776_100950211 | 3300017966 | Tropical Peatland | VEEVIDEPLYRDRVCGIDIGKAGLVATIRVPSEKDPA |
| Ga0187783_108469311 | 3300017970 | Tropical Peatland | MEEEALEEVTDEPLCRERVCVIDIGKAVMVATIRVPSDK |
| Ga0187782_105596891 | 3300017975 | Tropical Peatland | VEEVTDEPLYRDRVCGIDIGKAGLVATIRVPSDRDPAR |
| Ga0187767_101671501 | 3300017999 | Tropical Peatland | VEEVTDEPLYRDRVCGIDIGKAQMVATIRVPSDKDPA |
| Ga0187805_103440161 | 3300018007 | Freshwater Sediment | MEEVTDEPLYRNRVCGIDIGKAGMVATIRVPSDKDRSRRAAETRS |
| Ga0187863_101793982 | 3300018034 | Peatland | VEEVTDEPLYRDRVCGIDIGKAGMAATIRVPSDKDP |
| Ga0187766_100982403 | 3300018058 | Tropical Peatland | VEEVTDEPLYRDRVCGIDIGKAGLAATIRVPSEKNPARR |
| Ga0187765_109510472 | 3300018060 | Tropical Peatland | MEEVTDEPLYRDRVCGIDIGNAGMVATIRVPSDKNRA |
| Ga0187784_108575921 | 3300018062 | Tropical Peatland | VEEVTGEPLHRDRVCGIDIGKAQLVATIRVPSDRD |
| Ga0187773_101518361 | 3300018064 | Tropical Peatland | VEEVTDEPLYRDRVCGIDIGKAGMAVTIRVPSDRDPARRASETR |
| Ga0187773_108066101 | 3300018064 | Tropical Peatland | VEEVTDEPLYRDLVCGIDSGKAAMVATIRVPSDKDPSRRAQETRSFGTTKKEALALA |
| Ga0187772_102970582 | 3300018085 | Tropical Peatland | VEEVTDEPLYRDRVCGVDIGKAEMHATIRVPSDENPQRRMSETR |
| Ga0210407_101499671 | 3300020579 | Soil | VDEVTDEPLYRDRVCGIDIGTAQMVATIRVPSDRNPARRMAETRTF |
| Ga0210399_101550722 | 3300020581 | Soil | VEDVRDEPLYRSRVCGIDVGKAELYATIRVPSDGNPARRASETRRF |
| Ga0210401_111115421 | 3300020583 | Soil | VDEVTDEPLYRDRVCGIDIGKAQMVATIRVPSDRDPA |
| Ga0154015_12622333 | 3300020610 | Corn, Switchgrass And Miscanthus Rhizosphere | VEEVTDEPLYRDRVCGIDIGKAEMYATIRVPSEANPARRAQ |
| Ga0213881_100261943 | 3300021374 | Exposed Rock | VEEVTDEPLYRDRVCGIDIGKAGMAVTIGVPPDKDPARRASETRGFGTTKREV |
| Ga0210389_107655652 | 3300021404 | Soil | VDEVRDEPLHRDRVCGIDIGKSGMAATIRVPSDRD |
| Ga0210394_108892591 | 3300021420 | Soil | VEEVTDEPLYRDRVCGIDIGKAGMVATIRVPSDKDPARRMAG |
| Ga0224564_11168541 | 3300024271 | Soil | VEEVTDEPLYRDRVCGIDIGKAQMVATIRVPSDRDPARRAAETGTFA |
| Ga0179589_103958752 | 3300024288 | Vadose Zone Soil | VEEVTDEPLYRDRVCGIDIGKAEMHATIRVPSDANPARRM |
| Ga0207692_110794691 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VEDVRDEPLYRSRVCGIDVGKAELYATIRVPSDDNPAWRASETRRFATTKR |
| Ga0207663_107803992 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VVEEARVDEVTDEPLYRDRVCGIDIGKAGMAATIRVPSDRDRSRR |
| Ga0207700_111355362 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VEEVTDEPLYRDRVCGIDIGKAGMAATIRVPSDRDP |
| Ga0207689_103330611 | 3300025942 | Miscanthus Rhizosphere | VEEVTDEPLYRDRVCGIDIGKAQMAATIRVPSDSNP |
| Ga0209027_12380911 | 3300026300 | Grasslands Soil | VEEVTDEPLYRDRVCGIDIGKAGLVATIRVPSDRDRSRRAAET |
| Ga0209131_10816401 | 3300026320 | Grasslands Soil | VRPVDEVTDEPLYQDRVCGIDIGKAEMYATIRVPSDTNPQ |
| Ga0209152_103938411 | 3300026325 | Soil | VDEVTDEPLYRDRVCGIDIGKAQLVATIRVPSDRDPARRMAETRT |
| Ga0257147_10487652 | 3300026475 | Soil | MEEVTDEPLYRDRVCGIDIGKAQIAATIRVPSEKNP |
| Ga0257165_10774031 | 3300026507 | Soil | VRDAEEVTDEPLYRDRVCGIDIGRAGLVATIRVSSDRDPARRMRE |
| Ga0179593_10266271 | 3300026555 | Vadose Zone Soil | LEEVTDEPLYRDRVCGIDIGKAGMAATIRVPSDKDPARRASENPRVRHH |
| Ga0207775_1161752 | 3300026817 | Tropical Forest Soil | VEEITDEPLYRDRVCGVDIGKAGMVATIRVPSDRDPARR |
| Ga0208760_1005972 | 3300026844 | Soil | MEEVTDEPLYRDRVCGIDIGKAGMAATIRVPSDANP |
| Ga0208575_10222281 | 3300026920 | Soil | MEEVTDEPLYRDRVCGIDIGKAGLYATIRVPSDSNPARRA |
| Ga0209040_100253147 | 3300027824 | Bog Forest Soil | MRERSGEGRVEEVTGEPLYRDRVCGIDIGKAGLVATIRVPSDRDPAR |
| Ga0209006_108400562 | 3300027908 | Forest Soil | VDEVTDEPLHRDRVCGIDIGKAVMAVTVRVPSDRDP |
| Ga0307322_101282021 | 3300028710 | Soil | VEEVTDEPLYRDRVCGIDVGKAQMVATIRVPSDRDPARRA |
| Ga0302266_103446261 | 3300028779 | Bog | VEEVSDEPLYRDRVCGIDIGKAGMAATIRVPSDKDPARR |
| Ga0302232_105435421 | 3300028789 | Palsa | VDEVTDEPLYRDRVCGIDIGKAQIAATIRVPSDRDP |
| Ga0307312_111700161 | 3300028828 | Soil | VEEVTDEPLYRDRVCGIDVGKAQMVATIRVPSDRDPARR |
| Ga0311371_112131231 | 3300029951 | Palsa | VEEVSDEPLYRDRVCGIGIGKAGMAATIRVPSDKDPARRAAGT |
| Ga0302181_100326936 | 3300030056 | Palsa | MDEVTDEPLYRDRVCGIDIGKAQMVATIRVPSDSNPAR |
| Ga0311354_113399361 | 3300030618 | Palsa | MEEVTDEPLYRDRVCGIDIGKAQLYATIRVPSDGNPARRASETRSF |
| Ga0307497_106153901 | 3300031226 | Soil | VDEVTGGPLYRDRVGGTGTGTAGLAATIRVPSDRDPARRVAETRSFGAAKKE |
| Ga0318516_107444251 | 3300031543 | Soil | VEEVTDEPLYRDRVCGIDIGKAQMVATIRVPSDRDPARRSAETRIFA |
| Ga0318541_108563571 | 3300031545 | Soil | VDEVTGEPLYRDRVCGIDIGEAGLVATIRVPSEKNPARRAAGTRS |
| Ga0318538_104699732 | 3300031546 | Soil | MEEVTDEPLYRDRVCGIDIGKAAMVATIRVPSDNNPARRA |
| Ga0318528_101311301 | 3300031561 | Soil | MDEVTDEPLYRDRVCSIDIGKAGMAATIRVPPDKNPSRRA |
| Ga0318542_101122731 | 3300031668 | Soil | VEEVTDEPLYRDRVCGIDIGKAGMVATIRVPSDRDRSRRAA |
| Ga0307476_109743871 | 3300031715 | Hardwood Forest Soil | MEEVTDEPLYRDRVCGIDIGKAEMYATIRVPSERDPA |
| Ga0318500_100768131 | 3300031724 | Soil | VQEVTGEPLYRDRVCGIDIGKAELYATIRVPSDKNPARRASETR |
| Ga0318501_100738501 | 3300031736 | Soil | VEEVTDEPLYRDRVCGIDIGKAQMVATIRVPSDKDPARRVSW |
| Ga0307477_108903911 | 3300031753 | Hardwood Forest Soil | VRNVEEVTDEPLYRDRVCGIDIGKAQVAATIRAPSETNPARR |
| Ga0318546_103170073 | 3300031771 | Soil | VEEVTDEPLYRDRVCGIDIGKAGMAATIRVPSGRDRSR |
| Ga0318547_106576872 | 3300031781 | Soil | VDEVTDEPLYRDRVCGVDIGKAAMVATIRVPSDADPARRMAETR |
| Ga0302319_108900751 | 3300031788 | Bog | VEEVSDEPLYRDRVCGIGIGKAGMAATIRVPSDKDPARRAAETRSFGTTR |
| Ga0318523_105560691 | 3300031798 | Soil | VEEVTDEPLYRDRVCGIDIGKAQMVATIRVPSDKDPAR |
| Ga0318495_104754261 | 3300031860 | Soil | VEEVTDEPLYRDRVCGIDIGKAGMAATIRVPSDKNPAR |
| Ga0306925_104812372 | 3300031890 | Soil | VEEVTDEPLYRDRVCGIDIGKAGLVATIRVPSDRD |
| Ga0318551_103293182 | 3300031896 | Soil | MDEVTDEPLYRDRVCGIDIGKAQMVATIRVPSDRDPARRSAETRIFATTKRG |
| Ga0318520_105996981 | 3300031897 | Soil | MEEVTDEPLYRDRVCGIDIGKAQMVATIRVPSEKDPARRAAETRSFGT |
| Ga0306923_121121191 | 3300031910 | Soil | VEEITDEPLYRDRVCGVDLGKAGLVATIRVPSDANPA |
| Ga0310916_101148343 | 3300031942 | Soil | MRERSGGQRVEEVTDEPLYRDRVCGIDIGKAGLAATIRVPSDRDP |
| Ga0318562_101276321 | 3300032008 | Soil | VDEVTDEPLYRDRVCGIDIGKAAMAATIRVPSDADPAR |
| Ga0318524_107345711 | 3300032067 | Soil | VDEVTDEPLYRDRVCGIDIGKAGLVATIRVPSERNPARRAA |
| Ga0318525_106526252 | 3300032089 | Soil | VEEVAGKPLYRDRVRGVGIGKAGMVATIRVPSDRDRSPRAAETRSFGTT |
| Ga0318518_100660242 | 3300032090 | Soil | VDEVTDEPLYRDRVCGIDIGKAGLVATIRVPSERDPARRAA |
| Ga0311301_123418392 | 3300032160 | Peatlands Soil | MEEVTDEPLYRDRVCGIDIGKAGMVATIRVPSDKDPA |
| Ga0307471_1041304031 | 3300032180 | Hardwood Forest Soil | MEEVTDEPLYRDRVCGIDIGKAQIAATIRVPSETNPA |
| Ga0335078_105900251 | 3300032805 | Soil | VEEVTDEPLYRDRVCGIDIGKAGMAVTIRVPSDRDP |
| Ga0335080_107137582 | 3300032828 | Soil | VTDEPLYRDRVCGIDIGKAAMAATIRVPSDKNPARR |
| Ga0335083_104550002 | 3300032954 | Soil | MEEVTDEPLYRDRVCGIDIGKAQMAATIRVPSDANP |
| Ga0335073_120640851 | 3300033134 | Soil | MEEVTDEPLYRDRVCGIDIGKAGMVATIRVPSDKDPSRRS |
| Ga0335077_113896681 | 3300033158 | Soil | VTDEPLYRDRVCGIDIGKAQMAATIRVPSDKDPARRMQETRGFGTTKKEV |
| Ga0335077_120719122 | 3300033158 | Soil | VEEVTDEPLYRDRVCGIDIGKARMAVTIRVPSDRDPARRMQET |
| Ga0310811_108518751 | 3300033475 | Soil | MEEATDEPLYRDRVCGIDIGKAQLYATIRVPSDGNPARRASETRS |
| Ga0370515_0269510_3_116 | 3300034163 | Untreated Peat Soil | MEEVTDEPLYRDRVCGIDIGKAGMVATIRVPSDKDPSR |
| ⦗Top⦘ |