Metagenome Family F050528

Basic Information
Family ID	F050528
Family Type	Metagenome
Number of Sequences	145
Average Sequence Length	47 residues
Representative Sequence	MLAYCGRPPSASFCDRFPYIGPRYARETIAEICSMGVALATAIISQTGS
Number of Associated Samples	82
Number of Associated Scaffolds	145

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	91.55 %
% of genes near scaffold ends (potentially truncated)	64.83 %
% of genes from short scaffolds (< 2000 bps)	71.72 %
Associated GOLD sequencing projects	68
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.38

Most Common Taxonomy
Group	Bacteria (70.345 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil (15.172 % of family members)
Environment Ontology (ENVO)	Unclassified (40.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (48.276 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Fibrous	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 40.26% β-sheet: 0.00% Coil/Unstructured: 59.74%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 145 Family Scaffolds
PF01738	DLH	2.07
PF13561	adh_short_C2	1.38
PF02775	TPP_enzyme_C	1.38
PF00107	ADH_zinc_N	1.38
PF05036	SPOR	1.38
PF01351	RNase_HII	1.38
PF06325	PrmA	1.38
PF02541	Ppx-GppA	1.38
PF01963	TraB_PrgY_gumN	1.38
PF14031	D-ser_dehydrat	1.38
PF00753	Lactamase_B	1.38
PF02687	FtsX	1.38
PF00590	TP_methylase	1.38
PF13365	Trypsin_2	1.38
PF00501	AMP-binding	0.69
PF01943	Polysacc_synt	0.69
PF00108	Thiolase_N	0.69
PF13278	Obsolete Pfam Family	0.69
PF02602	HEM4	0.69
PF02699	YajC	0.69
PF07075	DUF1343	0.69
PF00005	ABC_tran	0.69
PF00128	Alpha-amylase	0.69
PF05227	CHASE3	0.69
PF01075	Glyco_transf_9	0.69
PF02803	Thiolase_C	0.69
PF01895	PhoU	0.69
PF01336	tRNA_anti-codon	0.69
PF02321	OEP	0.69
PF13502	AsmA_2	0.69
PF09339	HTH_IclR	0.69
PF00116	COX2	0.69
PF13193	AMP-binding_C	0.69
PF01425	Amidase	0.69
PF08245	Mur_ligase_M	0.69
PF13426	PAS_9	0.69
PF13349	DUF4097	0.69
PF08281	Sigma70_r4_2	0.69
PF13183	Fer4_8	0.69
PF00400	WD40	0.69
PF02423	OCD_Mu_crystall	0.69
PF02652	Lactate_perm	0.69
PF04754	Transposase_31	0.69
PF13714	PEP_mutase	0.69
PF03776	MinE	0.69
PF03472	Autoind_bind	0.69
PF11906	DUF3426	0.69
PF12700	HlyD_2	0.69
PF00285	Citrate_synt	0.69
PF13546	DDE_5	0.69
PF12773	DZR	0.69
PF13738	Pyr_redox_3	0.69
PF01618	MotA_ExbB	0.69
PF13380	CoA_binding_2	0.69
PF01914	MarC	0.69
PF01207	Dus	0.69
PF02416	TatA_B_E	0.69
PF13544	Obsolete Pfam Family	0.69
PF04348	LppC	0.69
PF04011	LemA	0.69
PF00072	Response_reg	0.69
PF12627	PolyA_pol_RNAbd	0.69
PF00293	NUDIX	0.69
PF12221	HflK_N	0.69
PF00282	Pyridoxal_deC	0.69
PF00127	Copper-bind	0.69
PF07859	Abhydrolase_3	0.69
PF05977	MFS_3	0.69
PF00440	TetR_N	0.69
PF05768	Glrx-like	0.69
PF07992	Pyr_redox_2	0.69
PF00486	Trans_reg_C	0.69
PF00676	E1_dh	0.69
PF01346	FKBP_N	0.69
PF03150	CCP_MauG	0.69
PF00117	GATase	0.69
PF01694	Rhomboid	0.69
PF00528	BPD_transp_1	0.69
PF13361	UvrD_C	0.69
PF01408	GFO_IDH_MocA	0.69
PF06580	His_kinase	0.69
PF01726	LexA_DNA_bind	0.69
PF03602	Cons_hypoth95	0.69
PF01380	SIS	0.69
PF12833	HTH_18	0.69
PF00106	adh_short	0.69
PF00294	PfkB	0.69
PF01218	Coprogen_oxidas	0.69
PF04413	Glycos_transf_N	0.69
PF13435	Cytochrome_C554	0.69
PF02104	SURF1	0.69
PF02696	SelO	0.69
PF00041	fn3	0.69
PF01751	Toprim	0.69
PF00848	Ring_hydroxyl_A	0.69
PF11839	Alanine_zipper	0.69
PF01323	DSBA	0.69
PF02788	RuBisCO_large_N	0.69
PF00593	TonB_dep_Rec	0.69
PF00990	GGDEF	0.69
PF01367	5_3_exonuc	0.69
PF09363	XFP_C	0.69
PF00933	Glyco_hydro_3	0.69
PF12710	HAD	0.69
PF04751	DUF615	0.69
PF04613	LpxD	0.69
PF03734	YkuD	0.69

COG ID	Name	Functional Category	% Frequency in 145 Family Scaffolds
COG0248	Exopolyphosphatase/pppGpp-phosphohydrolase	Signal transduction mechanisms [T]	2.76
COG2890	Methylase of polypeptide chain release factors	Translation, ribosomal structure and biogenesis [J]	2.07
COG1538	Outer membrane protein TolC	Cell wall/membrane/envelope biogenesis [M]	1.38
COG1039	Ribonuclease HIII	Replication, recombination and repair [L]	1.38
COG2264	Ribosomal protein L11 methylase PrmA	Translation, ribosomal structure and biogenesis [J]	1.38
COG2197	DNA-binding response regulator, NarL/FixJ family, contains REC and HTH domains	Transcription [K]	1.38
COG1916	Pheromone shutdown protein TraB, contains GTxH motif (function unknown)	Function unknown [S]	1.38
COG3897	Protein N-terminal and lysine N-methylase, NNT1/EFM7 family	Posttranslational modification, protein turnover, chaperones [O]	1.38
COG0183	Acetyl-CoA acetyltransferase	Lipid transport and metabolism [I]	1.38
COG0164	Ribonuclease HII	Replication, recombination and repair [L]	1.38
COG4638	Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit	Inorganic ion transport and metabolism [P]	1.38
COG1858	Cytochrome c peroxidase	Posttranslational modification, protein turnover, chaperones [O]	0.69
COG2972	Sensor histidine kinase YesM	Signal transduction mechanisms [T]	0.69
COG1862	Protein translocase subunit YajC	Intracellular trafficking, secretion, and vesicular transport [U]	0.69
COG1850	Ribulose 1,5-bisphosphate carboxylase, large subunit, or a RuBisCO-like protein	Carbohydrate transport and metabolism [G]	0.69
COG2095	Small neutral amino acid transporter SnatA, MarC family	Amino acid transport and metabolism [E]	0.69
COG2242	Precorrin-6B methylase 2	Coenzyme transport and metabolism [H]	0.69
COG2265	tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family	Translation, ribosomal structure and biogenesis [J]	0.69
COG1826	Twin-arginine protein secretion pathway components TatA and TatB	Intracellular trafficking, secretion, and vesicular transport [U]	0.69
COG2423	Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family	Amino acid transport and metabolism [E]	0.69
COG2814	Predicted arabinose efflux permease AraJ, MFS family	Carbohydrate transport and metabolism [G]	0.69
COG1587	Uroporphyrinogen-III synthase	Coenzyme transport and metabolism [H]	0.69
COG3028	Ribosomal 50S subunit-associated protein YjgA, DUF615 family	Translation, ribosomal structure and biogenesis [J]	0.69
COG3034	Murein L,D-transpeptidase YafK	Cell wall/membrane/envelope biogenesis [M]	0.69
COG3107	Outer membrane lipoprotein LpoA, binds and activates PBP1a	Cell wall/membrane/envelope biogenesis [M]	0.69
COG3118	Chaperedoxin CnoX, contains thioredoxin-like and TPR-like domains, YbbN/TrxSC family	Posttranslational modification, protein turnover, chaperones [O]	0.69
COG3275	Sensor histidine kinase, LytS/YehU family	Signal transduction mechanisms [T]	0.69
COG3280	Maltooligosyltrehalose synthase	Carbohydrate transport and metabolism [G]	0.69
COG3346	Cytochrome oxidase assembly protein ShyY1	Posttranslational modification, protein turnover, chaperones [O]	0.69
COG3876	Exo-beta-N-acetylmuramidase YbbC/NamZ, DUF1343 family	Cell wall/membrane/envelope biogenesis [M]	0.69
COG4263	Nitrous oxide reductase	Inorganic ion transport and metabolism [P]	0.69
COG5464	Recombination-promoting DNA endonuclease RpnC/YadD	Replication, recombination and repair [L]	0.69
COG0742	16S rRNA G966 N2-methylase RsmD	Translation, ribosomal structure and biogenesis [J]	0.69
COG0076	Glutamate or tyrosine decarboxylase or a related PLP-dependent protein	Amino acid transport and metabolism [E]	0.69
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	0.69
COG0258	5'-3' exonuclease Xni/ExoIX (flap endonuclease)	Replication, recombination and repair [L]	0.69
COG0296	1,4-alpha-glucan branching enzyme	Carbohydrate transport and metabolism [G]	0.69
COG0366	Glycosidase/amylase (phosphorylase)	Carbohydrate transport and metabolism [G]	0.69
COG0372	Citrate synthase	Energy production and conversion [C]	0.69
COG0397	Protein adenylyltransferase (AMPylase) SelO/YdiU (selenoprotein O)	Posttranslational modification, protein turnover, chaperones [O]	0.69
COG0408	Coproporphyrinogen-III oxidase HemH, oxygen-dependent	Coenzyme transport and metabolism [H]	0.69
COG0545	FKBP-type peptidyl-prolyl cis-trans isomerase	Posttranslational modification, protein turnover, chaperones [O]	0.69
COG0567	2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes	Energy production and conversion [C]	0.69
COG0657	Acetyl esterase/lipase	Lipid transport and metabolism [I]	0.69
COG0695	Glutaredoxin	Posttranslational modification, protein turnover, chaperones [O]	0.69
COG0705	Membrane-associated serine protease, rhomboid family	Posttranslational modification, protein turnover, chaperones [O]	0.69
COG1704	Magnetosome formation protein MamQ, lipoprotein antigen LemA family	Cell wall/membrane/envelope biogenesis [M]	0.69
COG0851	Septum formation topological specificity factor MinE	Cell cycle control, cell division, chromosome partitioning [D]	0.69
COG0859	ADP-heptose:LPS heptosyltransferase	Cell wall/membrane/envelope biogenesis [M]	0.69
COG1044	UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase	Cell wall/membrane/envelope biogenesis [M]	0.69
COG1071	TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha	Energy production and conversion [C]	0.69
COG1092	23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI	Translation, ribosomal structure and biogenesis [J]	0.69
COG1376	Lipoprotein-anchoring transpeptidase ErfK/SrfK	Cell wall/membrane/envelope biogenesis [M]	0.69
COG1472	Periplasmic beta-glucosidase and related glycosidases	Carbohydrate transport and metabolism [G]	0.69
COG1519	3-deoxy-D-manno-octulosonic-acid transferase	Cell wall/membrane/envelope biogenesis [M]	0.69
COG1523	Pullulanase/glycogen debranching enzyme	Carbohydrate transport and metabolism [G]	0.69
COG0042	tRNA-dihydrouridine synthase	Translation, ribosomal structure and biogenesis [J]	0.69
COG1620	L-lactate permease	Energy production and conversion [C]	0.69
COG1622	Heme/copper-type cytochrome/quinol oxidase, subunit 2	Energy production and conversion [C]	0.69

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	71.03 %
Unclassified	root	N/A	28.97 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	71.03 %
Unclassified	root	N/A	28.97 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	70.34 %
Unclassified	root	N/A	28.97 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.69 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	55.86 %
Unclassified	root	N/A	28.97 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.69 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.69 %

Name	Rank	Taxonomy	Distribution
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	30.34 %
Unclassified	root	N/A	28.97 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4.83 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2.07 %
unclassified Proteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria	1.38 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.69 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.97 %
unclassified Gammaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria	6.90 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.07 %
Nevskiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales	1.38 %
Sphingomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	1.38 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	1.38 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.38 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	0.69 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.69 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.69 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.69 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.97 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	6.90 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.07 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	1.38 %
Steroidobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae	1.38 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	1.38 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.38 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.69 %
Zoogloeaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae	0.69 %
Planctomycetales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales	0.69 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.69 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.97 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	6.90 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.07 %
Steroidobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter	1.38 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	1.38 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.38 %
Planctomycetaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	0.69 %
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	0.69 %
Thauera	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera	0.69 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.69 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.69 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.97 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	6.90 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.07 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	1.38 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	1.38 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.38 %
unclassified Thauera	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera	0.69 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.69 %
Planctomycetaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	0.69 %
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	0.69 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.69 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.97 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	6.90 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.07 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	1.38 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	1.38 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.38 %
Thauera sp. 63	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera → Thauera sp. 63	0.69 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.69 %
Planctomycetaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	0.69 %
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	0.69 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.69 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.97 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	6.90 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.07 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	1.38 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	1.38 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.38 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.69 %
Thauera sp. 63	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera → Thauera sp. 63	0.69 %
Planctomycetaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	0.69 %
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	0.69 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.69 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.97 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	6.90 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.07 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	1.38 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	1.38 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.38 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.69 %
Thauera sp. 63	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera → Thauera sp. 63	0.69 %
Planctomycetaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	0.69 %
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	0.69 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.69 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.97 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	6.90 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.07 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	1.38 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	1.38 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.38 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	0.69 %
Thauera sp. 63	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera → Thauera sp. 63	0.69 %
Planctomycetaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	0.69 %
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	0.69 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.69 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.97 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	6.90 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.07 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	1.38 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	1.38 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.38 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	0.69 %
Thauera sp. 63	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera → Thauera sp. 63	0.69 %
Planctomycetaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	0.69 %
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	0.69 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.69 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.97 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	6.90 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.07 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	1.38 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	1.38 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.38 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	0.69 %
Thauera sp. 63	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera → Thauera sp. 63	0.69 %
Planctomycetaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	0.69 %
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	0.69 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.69 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.97 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	6.90 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.07 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	1.38 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	1.38 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.38 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	0.69 %
Thauera sp. 63	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera → Thauera sp. 63	0.69 %
Planctomycetaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	0.69 %
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	0.69 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.69 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.97 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	6.90 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.07 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	1.38 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	1.38 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.38 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	0.69 %
Thauera sp. 63	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera → Thauera sp. 63	0.69 %
Planctomycetaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	0.69 %
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	0.69 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.69 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.97 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	6.90 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.07 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	1.38 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	1.38 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.38 %
Fabales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales	0.69 %
Thauera sp. 63	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera → Thauera sp. 63	0.69 %
Planctomycetaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	0.69 %
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	0.69 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.69 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.97 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	6.90 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.07 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	1.38 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	1.38 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.38 %
Fabaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	0.69 %
Thauera sp. 63	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera → Thauera sp. 63	0.69 %
Planctomycetaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	0.69 %
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	0.69 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.69 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.97 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	6.90 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.07 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	1.38 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	1.38 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.38 %
Papilionoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae	0.69 %
Thauera sp. 63	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera → Thauera sp. 63	0.69 %
Planctomycetaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	0.69 %
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	0.69 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.69 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.97 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	6.90 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.07 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	1.38 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	1.38 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.38 %
50 kb inversion clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade	0.69 %
Thauera sp. 63	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera → Thauera sp. 63	0.69 %
Planctomycetaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	0.69 %
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	0.69 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.69 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.97 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	6.90 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.07 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	1.38 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	1.38 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.38 %
genistoids sensu lato	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato	0.69 %
Thauera sp. 63	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera → Thauera sp. 63	0.69 %
Planctomycetaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	0.69 %
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	0.69 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.69 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.97 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	6.90 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.07 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	1.38 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	1.38 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.38 %
core genistoids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids	0.69 %
Thauera sp. 63	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera → Thauera sp. 63	0.69 %
Planctomycetaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	0.69 %
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	0.69 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.69 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.97 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	6.90 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.07 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	1.38 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	1.38 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.38 %
Genisteae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae	0.69 %
Thauera sp. 63	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera → Thauera sp. 63	0.69 %
Planctomycetaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	0.69 %
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	0.69 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.69 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.97 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	6.90 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.07 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	1.38 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	1.38 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.38 %
Lupinus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus	0.69 %
Thauera sp. 63	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera → Thauera sp. 63	0.69 %
Planctomycetaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	0.69 %
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	0.69 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.69 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.97 %
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	6.90 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.07 %
Steroidobacter denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	1.38 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	1.38 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.38 %
Lupinus albus	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	0.69 %
Thauera sp. 63	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera → Thauera sp. 63	0.69 %
Planctomycetaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	0.69 %
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	0.69 %
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.69 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.69 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2162886015\|FOassembled-_contig28870	All Organisms → cellular organisms → Bacteria	553	Open in IMG/M
3300003320\|rootH2_10009794	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2253	Open in IMG/M
3300005260\|Ga0074072_1000550	All Organisms → cellular organisms → Bacteria → Proteobacteria	24251	Open in IMG/M
3300005329\|Ga0070683_100838151	All Organisms → cellular organisms → Bacteria → Proteobacteria	882	Open in IMG/M
3300005335\|Ga0070666_10416927	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	967	Open in IMG/M
3300005367\|Ga0070667_100727808	All Organisms → cellular organisms → Bacteria → Proteobacteria	919	Open in IMG/M
3300005367\|Ga0070667_101385198	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	659	Open in IMG/M
3300005435\|Ga0070714_100536395	All Organisms → cellular organisms → Bacteria	1119	Open in IMG/M
3300005436\|Ga0070713_100181269	All Organisms → cellular organisms → Bacteria → Proteobacteria	1893	Open in IMG/M
3300005436\|Ga0070713_100260922	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	1583	Open in IMG/M
3300005436\|Ga0070713_101657788	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	621	Open in IMG/M
3300005439\|Ga0070711_100803819	Not Available	798	Open in IMG/M
3300005439\|Ga0070711_101916556	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	521	Open in IMG/M
3300005529\|Ga0070741_10011993	All Organisms → cellular organisms → Bacteria → Proteobacteria	15813	Open in IMG/M
3300005529\|Ga0070741_10018247	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	11395	Open in IMG/M
3300005529\|Ga0070741_10021747	All Organisms → cellular organisms → Bacteria → Proteobacteria	9933	Open in IMG/M
3300005529\|Ga0070741_10059932	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	4447	Open in IMG/M
3300005529\|Ga0070741_10060190	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4433	Open in IMG/M
3300005529\|Ga0070741_10128531	All Organisms → cellular organisms → Bacteria	2596	Open in IMG/M
3300005548\|Ga0070665_100002654	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	19446	Open in IMG/M
3300005548\|Ga0070665_100012682	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	8488	Open in IMG/M
3300005548\|Ga0070665_100022794	All Organisms → cellular organisms → Bacteria → Proteobacteria	6304	Open in IMG/M
3300005548\|Ga0070665_100031690	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5320	Open in IMG/M
3300005548\|Ga0070665_100036447	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	4947	Open in IMG/M
3300005548\|Ga0070665_100053034	All Organisms → cellular organisms → Bacteria	4067	Open in IMG/M
3300005548\|Ga0070665_102227927	Not Available	551	Open in IMG/M
3300005563\|Ga0068855_100787309	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Thauera → unclassified Thauera → Thauera sp. 63	1012	Open in IMG/M
3300005563\|Ga0068855_102039692	Not Available	579	Open in IMG/M
3300005591\|Ga0070761_10598320	All Organisms → cellular organisms → Bacteria	686	Open in IMG/M
3300005591\|Ga0070761_10650894	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	658	Open in IMG/M
3300005591\|Ga0070761_10706041	Not Available	632	Open in IMG/M
3300005591\|Ga0070761_10790602	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	597	Open in IMG/M
3300005602\|Ga0070762_10036431	All Organisms → cellular organisms → Bacteria → Proteobacteria	2661	Open in IMG/M
3300005602\|Ga0070762_10043318	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2459	Open in IMG/M
3300005602\|Ga0070762_10154025	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1377	Open in IMG/M
3300005602\|Ga0070762_10195096	Not Available	1236	Open in IMG/M
3300005602\|Ga0070762_11177514	Not Available	530	Open in IMG/M
3300005610\|Ga0070763_10168335	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1154	Open in IMG/M
3300005614\|Ga0068856_100895064	Not Available	906	Open in IMG/M
3300005614\|Ga0068856_102432904	All Organisms → cellular organisms → Bacteria → Proteobacteria	531	Open in IMG/M
3300005616\|Ga0068852_101281087	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	754	Open in IMG/M
3300005712\|Ga0070764_10000616	All Organisms → cellular organisms → Bacteria	14213	Open in IMG/M
3300005712\|Ga0070764_10227962	All Organisms → cellular organisms → Bacteria → Proteobacteria	1054	Open in IMG/M
3300005841\|Ga0068863_101719351	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	637	Open in IMG/M
3300005841\|Ga0068863_102035990	All Organisms → cellular organisms → Bacteria	584	Open in IMG/M
3300005842\|Ga0068858_100734055	Not Available	962	Open in IMG/M
3300005842\|Ga0068858_100989481	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	824	Open in IMG/M
3300005842\|Ga0068858_101290434	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	718	Open in IMG/M
3300005843\|Ga0068860_100666276	All Organisms → cellular organisms → Bacteria → Proteobacteria	1049	Open in IMG/M
3300006175\|Ga0070712_101349684	All Organisms → cellular organisms → Bacteria → Proteobacteria	622	Open in IMG/M
3300006176\|Ga0070765_100656771	All Organisms → cellular organisms → Bacteria	990	Open in IMG/M
3300006176\|Ga0070765_100973936	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	802	Open in IMG/M
3300006176\|Ga0070765_101715818	Not Available	590	Open in IMG/M
3300006893\|Ga0073928_10283712	All Organisms → cellular organisms → Bacteria → Proteobacteria	1251	Open in IMG/M
3300006893\|Ga0073928_10612266	Not Available	768	Open in IMG/M
3300009101\|Ga0105247_10050864	Not Available	2550	Open in IMG/M
3300009545\|Ga0105237_10333816	Not Available	1520	Open in IMG/M
3300009545\|Ga0105237_11807749	Not Available	619	Open in IMG/M
3300009551\|Ga0105238_12052217	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	606	Open in IMG/M
3300010048\|Ga0126373_12263144	Not Available	604	Open in IMG/M
3300010361\|Ga0126378_10284089	Not Available	1755	Open in IMG/M
3300010361\|Ga0126378_13142801	Not Available	525	Open in IMG/M
3300010371\|Ga0134125_11154652	Not Available	847	Open in IMG/M
3300010379\|Ga0136449_100328541	All Organisms → cellular organisms → Bacteria	2765	Open in IMG/M
3300010379\|Ga0136449_102586810	All Organisms → cellular organisms → Bacteria	724	Open in IMG/M
3300010379\|Ga0136449_103478644	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	600	Open in IMG/M
3300011120\|Ga0150983_10131742	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	525	Open in IMG/M
3300012359\|Ga0137385_10443600	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1103	Open in IMG/M
3300012927\|Ga0137416_10000054	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	40057	Open in IMG/M
3300012927\|Ga0137416_11324508	All Organisms → cellular organisms → Bacteria	651	Open in IMG/M
3300013296\|Ga0157374_11030153	Not Available	843	Open in IMG/M
3300013296\|Ga0157374_12722502	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	522	Open in IMG/M
3300014325\|Ga0163163_10097812	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2955	Open in IMG/M
3300014325\|Ga0163163_10734796	All Organisms → cellular organisms → Bacteria	1050	Open in IMG/M
3300014325\|Ga0163163_11918697	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	652	Open in IMG/M
3300014968\|Ga0157379_10057092	All Organisms → cellular organisms → Bacteria	3489	Open in IMG/M
3300014968\|Ga0157379_10075269	All Organisms → cellular organisms → Bacteria → Proteobacteria	3023	Open in IMG/M
3300014968\|Ga0157379_10075632	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3015	Open in IMG/M
3300014968\|Ga0157379_10345855	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1361	Open in IMG/M
3300014968\|Ga0157379_10465025	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	1169	Open in IMG/M
3300014968\|Ga0157379_11157684	Not Available	742	Open in IMG/M
3300015242\|Ga0137412_10051797	All Organisms → cellular organisms → Bacteria	3347	Open in IMG/M
3300020580\|Ga0210403_10812134	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	743	Open in IMG/M
3300020582\|Ga0210395_11363399	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	518	Open in IMG/M
3300021086\|Ga0179596_10602785	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	557	Open in IMG/M
3300021170\|Ga0210400_10835697	Not Available	754	Open in IMG/M
3300021180\|Ga0210396_10497543	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1067	Open in IMG/M
3300021402\|Ga0210385_10616663	All Organisms → cellular organisms → Bacteria → Proteobacteria	828	Open in IMG/M
3300021402\|Ga0210385_10724523	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	762	Open in IMG/M
3300021405\|Ga0210387_10381059	All Organisms → cellular organisms → Bacteria	1249	Open in IMG/M
3300021405\|Ga0210387_10769946	All Organisms → cellular organisms → Bacteria	851	Open in IMG/M
3300021405\|Ga0210387_11563856	Not Available	562	Open in IMG/M
3300021406\|Ga0210386_11633802	Not Available	534	Open in IMG/M
3300021407\|Ga0210383_11453408	Not Available	569	Open in IMG/M
3300021407\|Ga0210383_11568710	Not Available	543	Open in IMG/M
3300021433\|Ga0210391_10381775	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1106	Open in IMG/M
3300021475\|Ga0210392_10574494	Not Available	835	Open in IMG/M
3300021477\|Ga0210398_10067116	All Organisms → cellular organisms → Bacteria → Proteobacteria	2922	Open in IMG/M
3300021479\|Ga0210410_10128666	All Organisms → cellular organisms → Bacteria → Proteobacteria	2249	Open in IMG/M
3300024288\|Ga0179589_10030961	All Organisms → cellular organisms → Bacteria → Proteobacteria	1878	Open in IMG/M
3300025914\|Ga0207671_10370290	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1137	Open in IMG/M
3300025928\|Ga0207700_10958567	Not Available	766	Open in IMG/M
3300025929\|Ga0207664_11357291	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	631	Open in IMG/M
3300025939\|Ga0207665_10127773	Not Available	1801	Open in IMG/M
3300025944\|Ga0207661_10811882	All Organisms → cellular organisms → Bacteria	861	Open in IMG/M
3300026035\|Ga0207703_11171765	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	739	Open in IMG/M
3300026035\|Ga0207703_11510407	All Organisms → cellular organisms → Bacteria → Proteobacteria	646	Open in IMG/M
3300026035\|Ga0207703_11612344	Not Available	624	Open in IMG/M
3300026078\|Ga0207702_11403214	Not Available	692	Open in IMG/M
3300026088\|Ga0207641_11881188	All Organisms → cellular organisms → Bacteria	600	Open in IMG/M
3300026557\|Ga0179587_11128361	All Organisms → cellular organisms → Bacteria → Proteobacteria	516	Open in IMG/M
3300027853\|Ga0209274_10482923	Not Available	641	Open in IMG/M
3300027879\|Ga0209169_10001829	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	12907	Open in IMG/M
3300027879\|Ga0209169_10006263	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	6816	Open in IMG/M
3300027879\|Ga0209169_10037894	All Organisms → cellular organisms → Bacteria → Proteobacteria	2532	Open in IMG/M
3300027879\|Ga0209169_10099887	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1502	Open in IMG/M
3300027884\|Ga0209275_10045383	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2091	Open in IMG/M
3300027908\|Ga0209006_10450620	All Organisms → cellular organisms → Bacteria	1078	Open in IMG/M
3300027908\|Ga0209006_11467596	Not Available	518	Open in IMG/M
3300028379\|Ga0268266_10000228	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	97214	Open in IMG/M
3300028379\|Ga0268266_10000632	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	47843	Open in IMG/M
3300028379\|Ga0268266_10025233	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	5059	Open in IMG/M
3300028379\|Ga0268266_10031789	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4484	Open in IMG/M
3300028536\|Ga0137415_10000036	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	102002	Open in IMG/M
3300028536\|Ga0137415_10575133	Not Available	937	Open in IMG/M
3300028906\|Ga0308309_11290779	Not Available	628	Open in IMG/M
3300029999\|Ga0311339_10990250	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	789	Open in IMG/M
3300030520\|Ga0311372_10224619	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3091	Open in IMG/M
3300030520\|Ga0311372_10506374	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans	1770	Open in IMG/M
3300030521\|Ga0307511_10445352	Not Available	514	Open in IMG/M
3300030580\|Ga0311355_10744992	All Organisms → cellular organisms → Bacteria → Proteobacteria	906	Open in IMG/M
3300030580\|Ga0311355_11811127	All Organisms → cellular organisms → Bacteria → Proteobacteria	518	Open in IMG/M
3300030617\|Ga0311356_11142746	Not Available	720	Open in IMG/M
3300030618\|Ga0311354_10905941	All Organisms → cellular organisms → Bacteria → Proteobacteria	822	Open in IMG/M
3300030693\|Ga0302313_10143081	All Organisms → cellular organisms → Bacteria	978	Open in IMG/M
3300030906\|Ga0302314_10147897	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3012	Open in IMG/M
3300031231\|Ga0170824_112525571	All Organisms → cellular organisms → Bacteria → Proteobacteria	1027	Open in IMG/M
3300031708\|Ga0310686_101918592	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	743	Open in IMG/M
3300031715\|Ga0307476_10824483	Not Available	686	Open in IMG/M
3300031962\|Ga0307479_11422882	Not Available	652	Open in IMG/M
3300032160\|Ga0311301_10627912	Not Available	1538	Open in IMG/M
3300032515\|Ga0348332_13204325	Not Available	1169	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	66.21%
Host-Associated	Host-Associated	33.79%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	64.83%
Plants	Host-Associated → Plants	33.79%
Aquatic	Environmental → Aquatic	1.38%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	57.93%
Rhizosphere	Host-Associated → Plants → Rhizosphere	19.31%
Rhizoplane	Host-Associated → Plants → Rhizoplane	11.03%
Peat	Environmental → Terrestrial → Peat	6.21%
Roots	Host-Associated → Plants → Roots	2.76%
Thermal Springs	Environmental → Aquatic → Thermal Springs	1.38%
Plant Litter	Environmental → Terrestrial → Plant Litter	0.69%
Rhizome	Host-Associated → Plants → Rhizome	0.69%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	32.41%
Loam	Environmental → Terrestrial → Soil → Loam	25.52%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	11.03%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	9.66%
Soil	Host-Associated → Plants → Rhizosphere → Soil	9.66%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	6.21%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	2.07%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	1.38%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified	0.69%
Unclassified	Host-Associated → Plants → Roots → Unclassified	0.69%
Unclassified	Host-Associated → Plants → Rhizome → Unclassified	0.69%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	18.62%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	17.24%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	13.10%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	11.03%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	9.66%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	9.66%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	8.28%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	6.21%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	2.07%
Acidic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic	1.38%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.69%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified	0.69%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	0.69%
Unclassified	Host-Associated → Plants → Rhizome → Unclassified → Unclassified	0.69%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	15.17%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	11.03%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	9.66%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	7.59%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	6.90%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	6.21%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	5.52%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	4.83%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	4.14%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	4.14%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	2.76%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.76%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	2.07%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	2.07%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	2.07%
Iron-Sulfur Acid Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring	1.38%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.38%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.38%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	1.38%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.38%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.69%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.69%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil	0.69%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.69%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.69%
Plant Litter	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter	0.69%
Ectomycorrhiza	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza	0.69%
Sugarcane Root And Bulk Soil	Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil	0.69%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.69%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2162886015	Grass soil microbial communities from Rothamsted Park, UK - FO (Mercury 0.02g/kg) assembled	Environmental	Open in IMG/M
3300003320	Sugarcane root Sample H2	Host-Associated	Open in IMG/M
3300005260	Microbial communities on the surface of kaolinite enhanced biochar from soil with fertiliser in Sydney, Australia	Environmental	Open in IMG/M
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental	Open in IMG/M
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental	Open in IMG/M
3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Environmental	Open in IMG/M
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental	Open in IMG/M
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005591	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1	Environmental	Open in IMG/M
3300005602	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2	Environmental	Open in IMG/M
3300005610	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3	Environmental	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005712	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4	Environmental	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006176	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5	Environmental	Open in IMG/M
3300006893	Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG	Environmental	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010379	Sb_50d combined assembly	Environmental	Open in IMG/M
3300011120	Combined assembly of Microbial Forest Soil metaT	Environmental	Open in IMG/M
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental	Open in IMG/M
3300012927	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015242	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300020580	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M	Environmental	Open in IMG/M
3300020582	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O	Environmental	Open in IMG/M
3300021086	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental	Open in IMG/M
3300021180	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O	Environmental	Open in IMG/M
3300021402	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O	Environmental	Open in IMG/M
3300021405	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O	Environmental	Open in IMG/M
3300021406	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O	Environmental	Open in IMG/M
3300021407	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O	Environmental	Open in IMG/M
3300021433	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O	Environmental	Open in IMG/M
3300021475	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O	Environmental	Open in IMG/M
3300021477	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O	Environmental	Open in IMG/M
3300021479	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M	Environmental	Open in IMG/M
3300024288	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal	Environmental	Open in IMG/M
3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026557	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal	Environmental	Open in IMG/M
3300027853	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)	Environmental	Open in IMG/M
3300027879	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)	Environmental	Open in IMG/M
3300027884	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)	Environmental	Open in IMG/M
3300027908	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)	Environmental	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028536	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300028906	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)	Environmental	Open in IMG/M
3300029999	I_Palsa_E3 coassembly	Environmental	Open in IMG/M
3300030520	III_Palsa_N2 coassembly	Environmental	Open in IMG/M
3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Host-Associated	Open in IMG/M
3300030580	II_Palsa_N1 coassembly	Environmental	Open in IMG/M
3300030617	II_Palsa_N2 coassembly	Environmental	Open in IMG/M
3300030618	II_Palsa_E3 coassembly	Environmental	Open in IMG/M
3300030693	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2	Environmental	Open in IMG/M
3300030906	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031708	FICUS49499 Metagenome Czech Republic combined assembly	Environmental	Open in IMG/M
3300031715	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05	Environmental	Open in IMG/M
3300031962	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515	Environmental	Open in IMG/M
3300032160	Sb_50d combined assembly (MetaSPAdes)	Environmental	Open in IMG/M
3300032515	FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.38
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.38
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F050528

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
FOassembled-_0870.00001900	2162886015	Grass Soil	MLAYCGRPPSASFCDRFPYIGPRYARETIAEICSMGVALATAIISQTGS
rootH2_100097943	3300003320	Sugarcane Root And Bulk Soil	MIAYCGRPAAASFCDQLTHSDDYARELIAKICSLWVALVTAIIRQTGSSP*
Ga0074072_100055016	3300005260	Soil	MIAYCGRPPTASFGDRLPYIEPRYARETIAETCSLGVALATAIITQTGS*
Ga0070683_1008381512	3300005329	Corn Rhizosphere	MIAYCGRPPAASSGDRFPYIEPRYARETIAGICSLGVALATAIITQAGS*
Ga0070666_104169271	3300005335	Switchgrass Rhizosphere	MLAYCGRPSTASSGDPSSYIVPRYARVTIAGSCSLRVALATAIISQTGS
Ga0070667_1007278082	3300005367	Switchgrass Rhizosphere	MLAYCGRPAAAPFGDRSSYIVPRYARVTIAEMYSLQVALATAIISQTGSWAAGAF*
Ga0070667_1013851981	3300005367	Switchgrass Rhizosphere	MLAYCGRPPAASFGDRSSYIVPRYARVTIAETCSLGVALATAII
Ga0070714_1005363952	3300005435	Agricultural Soil	MIAYCGRPPAASSGDRFPYIEPRYARETIAGICSLGVALATAIITQTGS*
Ga0070713_1001812692	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	MIAYCGRPPAASSGDRFPYIEPRYAREAIAEICSLGVALATAIITQAGS*
Ga0070713_1002609222	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	MLAYCGRPPAASSGDRFPYIEPRYARETIAGICSLGVALATAIITQTGS*
Ga0070713_1016577881	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	MIAYCGRPPAASSGDPFAYIVPCYARETIAEICSLGVALATAII
Ga0070711_1008038191	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	MIAYCGRPSAAYFCDRFPYIEPSYARETIAEICSLRVALATAIISQTGS*
Ga0070711_1019165562	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	PMLAYCGRPSAASFGDRSSYIVPRYARVTIAEMYSLQVALATAIISQTGSWAAGAF*
Ga0070741_1001199311	3300005529	Surface Soil	MLAYCGRPAAASFCDPFPYIEPRYARETIAESCSLPVVLATAIISQTGS*
Ga0070741_100182477	3300005529	Surface Soil	MLAYCGRPAVASCCDPFPYIEHRYARETIAAICSLPGALATAIIRQTGSYPT*
Ga0070741_100217474	3300005529	Surface Soil	MLAYCGRPAAASSCDPFPYIEHSYARETIAGICSLTVALATAIIGQTGS*
Ga0070741_100599322	3300005529	Surface Soil	MLAYCGRPAAASFCDPFPYIEPRYARETITEICSLPVVLATAIMGQTGSFT*
Ga0070741_100601902	3300005529	Surface Soil	MIAYCGRPSAASCRDHFPYIDPRYARETIAAICSLAVVLATAIISQTGS*
Ga0070741_101285313	3300005529	Surface Soil	MLAYCGRPAAAAFCDPFPYIEPRYARETIAEIRSLGVALATAIITQTGS*
Ga0070665_10000265417	3300005548	Switchgrass Rhizosphere	MIAYCGRPPAASFGDRYSYIVPRYARVTIAETCSLGVALAT
Ga0070665_1000126823	3300005548	Switchgrass Rhizosphere	MLAYCGRPPAASFGDRYPYIEPRYARVTITETCSLGVALATAIITHTGS*
Ga0070665_1000227946	3300005548	Switchgrass Rhizosphere	MLAYCGRPPAASFGDRSSYIVPRYARVTIAETCSLGVALA
Ga0070665_1000316901	3300005548	Switchgrass Rhizosphere	MLAYCGRPPAASFGDRSSYIVPRYARVTIAETCSLGVAL
Ga0070665_1000364471	3300005548	Switchgrass Rhizosphere	MLAYCGRPPAAYSGDPSSYIVPRYARVTIAGICSLGVALATAI
Ga0070665_1000530342	3300005548	Switchgrass Rhizosphere	MLAYCGRPPAASFGDRFPYIVPAMPRETIAEICSLGVALATAIISQTGSREKYQ*
Ga0070665_1022279272	3300005548	Switchgrass Rhizosphere	MLAYCGRPPAASFGDRFPHSTRYARVTIAESCSLAVALATAIITQPGS*
Ga0068855_1007873091	3300005563	Corn Rhizosphere	MLAYCGRPPAASSGDRFPYIEPRYARETIAAICSLGVALATAIITQTGS*
Ga0068855_1020396921	3300005563	Corn Rhizosphere	MLAYCGRPSAASFGDRSSYIVPRYARVTIAETCSLRVAL
Ga0070761_105983202	3300005591	Soil	MITYCGRPSSASFCDRFPYICVGYARETIAETCSIWVALATAIMSQPGS*
Ga0070761_106508942	3300005591	Soil	MLAYCGRPRSASFCDPFPYIGPRYARETLAESCSTGAALATAIMSQAGS*
Ga0070761_107060411	3300005591	Soil	MLAYCGRPSSAAFCDPFPYIVPRYARETIAETCSIWVALATAIMSQPGS
Ga0070761_107906022	3300005591	Soil	MLAYCGRPPSASFCDPFPYIDPRYARKTIAESCSIWVALATAITGQTGPCASYNS*
Ga0070762_100364313	3300005602	Soil	MLAYCGRPGSASFCDRFPYICVGYARETIAESCSIRVALATAIISQTGSESAPP*
Ga0070762_100433181	3300005602	Soil	MLAYCGRPRSASFCDRFPYICVGYAREAIAESCSIWVALATAIISQTGSWR*
Ga0070762_101540252	3300005602	Soil	MLAYCGRPSSASFCDRFPYIDPRYAREAIAEICSSGVALATAIIGQSGS*
Ga0070762_101950962	3300005602	Soil	MLAYCGRPSSASFCDPFPYIDPRYARETITESCSIWVALATAIISQA
Ga0070762_111775142	3300005602	Soil	MLAYCGRPRSAVFCDPFPYICVGYARETIAETCSTWVALATAIINQTGSYL*
Ga0070763_101683353	3300005610	Soil	MLTYCGRPISAAFCDPFPYIGPRYAREAIAESCSSWVALATAIIDQSGS*
Ga0068856_1008950642	3300005614	Corn Rhizosphere	MLAYCGRPSAASSGDPSSYIVPRYARVTIAGSCSLRVA
Ga0068856_1024329041	3300005614	Corn Rhizosphere	MLAYCGRLPASSFGDRFPYIVRASRETIAPFSIRLGSSIWVALDTAIISQLG
Ga0068852_1012810871	3300005616	Corn Rhizosphere	MIAYCGRPTAASFGDRFPHSPRYARETIAEICSLGVAL
Ga0070764_100006162	3300005712	Soil	MLAYCGRPGSASFRDRFPYICVGYAREAIAESCSIWVALATAIISQTGSWR*
Ga0070764_102279621	3300005712	Soil	MLAYCGRPRSASFCDPFPYIGPRYARETIAESCSI
Ga0068863_1017193511	3300005841	Switchgrass Rhizosphere	MIAYCGRPTAASFCDRFPYIEPSYARETIAEICSLRVALATAII
Ga0068863_1020359901	3300005841	Switchgrass Rhizosphere	MITYCGRLPAASSGDRFPYIDPRYARETIAAICSLGGALATAIIRQTGSQQEYR
Ga0068858_1007340551	3300005842	Switchgrass Rhizosphere	MIAYCGRPTAASFCDRFPYIRPSYARETIAEICSLRVAL
Ga0068858_1009894812	3300005842	Switchgrass Rhizosphere	MLAYCGRPPAASFVDRFSYIEPRYARATIDETCSLGVALATAI
Ga0068858_1012904341	3300005842	Switchgrass Rhizosphere	MIAYCGRPPAASFGDRYSYIVPRYARVTIAETCSLGVALATAII
Ga0068860_1006662763	3300005843	Switchgrass Rhizosphere	MLAYCGRPSAASSGDPSSYIVPRYARVTIAGSCSLRVALATAIISQAGS*
Ga0070712_1013496842	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MLACCGRPPAASFGDRFPYIVPRYARETIAEICSLGVALATAIISQTGSQGWTKAGRHL*
Ga0070765_1006567711	3300006176	Soil	MLAYCGRLPSADFCNPSPYKSHYARETIAELGSMGVALATAIISQTG
Ga0070765_1009739361	3300006176	Soil	MLAYCGRPRSVGFCDPFPYIVPRYARETIAETYSIWVALATAIIGQTGS
Ga0070765_1017158181	3300006176	Soil	MLAYCGRPSAASFCDPFPYRCIGYARETIAESCSTRVALATAI
Ga0073928_102837122	3300006893	Iron-Sulfur Acid Spring	MLAYCGRPRSAAFCDRFPYICVGYARETIAESCSIW
Ga0073928_106122662	3300006893	Iron-Sulfur Acid Spring	MLAYCGRPISSIFCDRFPYIEPRYARETIAETCSIWVALATAIIS
Ga0105247_100508644	3300009101	Switchgrass Rhizosphere	MIAYCGRPTAASFCDRFPYIEPSYARETIAEICSLRVALATAI
Ga0105237_103338161	3300009545	Corn Rhizosphere	MIAYCGRPPAASFGDRFPYIVPAMPRETIAESCSL
Ga0105237_118077491	3300009545	Corn Rhizosphere	MIAYCGRPLAAYSGDPSSYIVTRYARVTIAGICSLGVALATALIGHPGSR
Ga0105238_120522171	3300009551	Corn Rhizosphere	AASFRDPFAYIAGSMRRETIAEICSLRAVLVTALINQTGS*
Ga0126373_122631442	3300010048	Tropical Forest Soil	MLAYCGRPAAAAFCDPFPYIVPRYARETIAEIRSLGVALA
Ga0126378_102840893	3300010361	Tropical Forest Soil	CGRPAAAAFCDRFPYIVPRYARETIAETRSLGVALATAIINQTGS*
Ga0126378_131428011	3300010361	Tropical Forest Soil	MLAYCGRPAAPASCDRFPYIVPRYARETIAGICSLGVALATAIMSQT
Ga0134125_111546522	3300010371	Terrestrial Soil	MNAYCGRPPAASFGDRFPSIVPAMPRETIAEICSLGVALATA
Ga0136449_1003285412	3300010379	Peatlands Soil	MLAYCGRPRSASFCDRFPNIDPRYARETIAESCSIWVALATAIMGQAGS*
Ga0136449_1025868102	3300010379	Peatlands Soil	MLAYCGRPRSASFCDRFPYICVGYARETIAESCSIWVALA
Ga0136449_1034786441	3300010379	Peatlands Soil	MLAYCGRPRSASFCDRFPYICVGYARETIAESCSIWVALAT
Ga0150983_101317421	3300011120	Forest Soil	MLAYCGRPAAAAFCDPFPYIVPRYARETIAGIRSLGVALATAIMSQTGSTAK
Ga0137385_104436003	3300012359	Vadose Zone Soil	MLAYCGRPSSASFCDRFPYIVLSYARETIAETCSSWVALATAII
Ga0137416_1000005433	3300012927	Vadose Zone Soil	MIAYCGRPTAASFRDRCAYIVGAMPRGTIAEICSPRVGLVTALIGQTGS*
Ga0137416_100102555	3300012927	Vadose Zone Soil	MIAYCGRPTAASFCDPFAYIVVTMRAKPIAKICSLWVALATALLGQTGS*
Ga0137416_101766035	3300012927	Vadose Zone Soil	MFACCGRPAAASFCDPFAYIVFNYARETIAKICSLGAALAT
Ga0137416_113245081	3300012927	Vadose Zone Soil	MLAYCGRPRSASFCDRFPYICVGYARETIAESCSIWVALATAII
Ga0157374_110301532	3300013296	Miscanthus Rhizosphere	MLAYCGRPAAAPFGDRSSYIVPRYARVTISEICSLQGALATAIIS
Ga0157374_127225023	3300013296	Miscanthus Rhizosphere	MIAYCGRPPAASFGYRFPYIEPRYARETIAEICSLGGRPRDGDHY
Ga0163163_100978122	3300014325	Switchgrass Rhizosphere	MIAYCGRPSAAYFCDRFPYIEPSYARETIAESCSLRVALATAIMSQTGS*
Ga0163163_107347962	3300014325	Switchgrass Rhizosphere	MIAYCGRPTAAYFCDRFPYIEPSYARETIAEICSLRVALATAIMSQSGSYGIPPTGE*
Ga0163163_119186972	3300014325	Switchgrass Rhizosphere	MIAYCGRPSAASFCDRFPYIEPSYARETIAESCSLRVALAT
Ga0157379_100570922	3300014968	Switchgrass Rhizosphere	MLAYCGRPPAASFVDRFSYIEPRYARATIDETCSLGVALATAIMAHTGS*
Ga0157379_100752691	3300014968	Switchgrass Rhizosphere	MIAYCGRPAAASFCDRFPYIGPSYARETIAEICSL
Ga0157379_100756322	3300014968	Switchgrass Rhizosphere	MIAYCGRPSTASFCDRFPYIEPSYARETIAEICSLRVALATAIMSQTGS*
Ga0157379_102213743	3300014968	Switchgrass Rhizosphere	AASFGDRYSYIVPRYARVTIAETCSLGVALATAIISQAGS*
Ga0157379_103458551	3300014968	Switchgrass Rhizosphere	MLAYCGRPSAAASGDPSSYIVPRYARVTIAGICSLRVALATAIISQTGS
Ga0157379_104650251	3300014968	Switchgrass Rhizosphere	MITYCGRPTAASFCDRFPYIEPSYARETIAEICSLRVGLATAIMAQTGSR
Ga0157379_111576842	3300014968	Switchgrass Rhizosphere	MLAYCGRPPAASFGDRYSYIVPRYARVTIAETCSLGVALAT
Ga0137412_100517974	3300015242	Vadose Zone Soil	MIAYCGRPAAASFCDPFAYICAHYARETIAKICSLRVALVTAIISHPGSSR*
Ga0210403_108121341	3300020580	Soil	MIACCGRPAAAAFGDRFPYIVPRYARETIAEIRSLGVALATALMSQ
Ga0210395_113633992	3300020582	Soil	MLAYCGRPGSAGFCDPFPYICIGYARETIAETGSTRVALATTIISQTGSRSRHAAVVSVILSPC
Ga0179596_106027851	3300021086	Vadose Zone Soil	MLAYCGRPRSASFCDRFPYICVGYAREPIAESCSIWVALATAIISQTGSYV
Ga0210400_108356971	3300021170	Soil	MLAYCGRPSSASFCDRFPYICVGYARETIAESCSIWVALAPAIITHTG
Ga0210396_104975432	3300021180	Soil	MLAYCGRPSSASFCDRFPYICVRYARETIAESCSMR
Ga0210385_106166632	3300021402	Soil	MLAYCGRPSSASFCDRCPYICIGYARETIAETCSMRVALGTAIISQTG
Ga0210385_107245231	3300021402	Soil	MITYCGRPSSASFCDRFPYICVGYARETIAETCSIWVALATAIMSQ
Ga0210387_103810593	3300021405	Soil	MLAYCGRPRSASFCDRFPYIDPRYARETIAETCSIWVALATAIIS
Ga0210387_107699461	3300021405	Soil	MLAYCGRPSSASFCDRFPYIDPRYAREAIAEICSSGVALATAI
Ga0210387_115638562	3300021405	Soil	MITYCGRPSSASFCDRFPYIGLGYARETIAESCSIWVALATVIIDQPGSTAAAGTGDAN
Ga0210386_116338021	3300021406	Soil	MLAYCGRLSSASFCDRFPYIGPRYARVTIAESCSMR
Ga0210383_114534082	3300021407	Soil	MLAYCGRPSSASFCDRFPYICVGYARETIAESCSMR
Ga0210383_115687102	3300021407	Soil	MLAYYGRPAAAASCDPFPYIVPRYARETIAGICSLGVALATAIMSQTGPLG
Ga0210391_103817753	3300021433	Soil	MLAYCGRPPSAAFRDPFPYIVHAMRGETIAKIGSMRDALATAIIRQTDSKAAAF
Ga0210392_105744942	3300021475	Soil	PVWLMLAYCGRPGSASFCDRFPYICIGYARKTIAETCSIRVVLATAIISQTGS
Ga0210398_100671163	3300021477	Soil	MLAYCGRPRSAVFCDPFPYICVGYARETIAETCSTWVALATAIINQTGSYL
Ga0210410_101286661	3300021479	Soil	MLAYCGRPSSASFCDRFPYICVGYARETIAESCSMRGGLATAIIGQTGYEVSSVATARAA
Ga0179589_100309613	3300024288	Vadose Zone Soil	MLAYCGRPRSSSFCDRLPYIEPRYARQTIAESCSIWVALATAIISQTGSLASYPGDF
Ga0207671_103702902	3300025914	Corn Rhizosphere	SMIAYCGRLSAASFRDPFAYIAGSMRRETIAEICSLRAVLVTALINQTGS
Ga0207700_109585672	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	PPAASSGDRFPYIEPRYARETIAGICSLGVALATAIITQTGS
Ga0207664_113572911	3300025929	Agricultural Soil	MIAYCGRLPAAAFDDPFPYIVPRYARETIVEICSLGVALATALIGQTC
Ga0207665_101277731	3300025939	Corn, Switchgrass And Miscanthus Rhizosphere	MIAYCGRPSAASFGDRFPYIVPAMPRETIAEICSLRVALATAIISQAGSSDI
Ga0207661_108118822	3300025944	Corn Rhizosphere	MITCCGRPPAASSGDRFPYIEPRYARETIAAICSLRVALATVIIRQAGS
Ga0207703_111717651	3300026035	Switchgrass Rhizosphere	MLAYCGRPPAASFGDRYSYIVPCYARVTIAETCSLGVALATAIISQTGSWPPVEVLSDSAGIS
Ga0207703_115104072	3300026035	Switchgrass Rhizosphere	MIAYCGRPAAASFCDRFPYIGPSYARETIAEICSLGDG
Ga0207703_116123442	3300026035	Switchgrass Rhizosphere	MIAYCGRPTAASFCDRFPYIGPSYARETIAEICSLRVALATAIM
Ga0207702_114032143	3300026078	Corn Rhizosphere	MLAYCGRPSAASSGDPSSYIVPRYARVTIAGSCSLRVALAT
Ga0207641_118811882	3300026088	Switchgrass Rhizosphere	MITYCGRLPAASSGDRFPYIDPRYARETIAAICSLGGALATAIIRQTGSQQEYRPAS
Ga0179587_111283611	3300026557	Vadose Zone Soil	MLAYCGRPSSASFCDRFPYICVGYARETIAESWRPARPR
Ga0209274_104829232	3300027853	Soil	MLAYCGRPSSAAFCDPFPYIVPRYARETIAETCSIWVALATAIMSQPGSSGR
Ga0209169_1000182910	3300027879	Soil	MLAYCGRPSSASFCDRFPYIDPRYAREAIAEICSSGVALATAIIGQSGS
Ga0209169_100062633	3300027879	Soil	MITYCGRPSSASFCDRFPYICVGYARETIAETCSIWVALATAIMSQPGS
Ga0209169_100378941	3300027879	Soil	MLAYCGRPRSVGFCDPFPYIVPCYARETIAETYSIWVALATAIIGQTGSRPHRPLEL
Ga0209169_100998872	3300027879	Soil	MLAYCGRPASASFCDRFPYIGPRYARETIAETCSMRVALATAIISQTGSWLSTLGYSVL
Ga0209275_100453833	3300027884	Soil	MLAYCGRPGSASFRDRFPYICVGYAREAIAESCSIWVALATAIISQTGSWR
Ga0209006_104506202	3300027908	Forest Soil	MLAYCGRPSSASFCDRFPYIDPRYAREAIAEICSSGV
Ga0209006_114675961	3300027908	Forest Soil	MLAYCGRPSSAAFCDPFPYIDPRYARETIAETCSIWVALATAI
Ga0268266_1000022844	3300028379	Switchgrass Rhizosphere	MLAYCGRPPAASFGDRYPYIEPRYARVTIAETCSLGVALATAIITHTGS
Ga0268266_100006328	3300028379	Switchgrass Rhizosphere	MLAYCGRPPAASFGDRSSYIVPRYARVTIAETCSLGVALATAIINQTGS
Ga0268266_100252331	3300028379	Switchgrass Rhizosphere	MLAYCGRPPAASFGDRSSYIVPRYARVTIAETCSLEVALATAI
Ga0268266_100317891	3300028379	Switchgrass Rhizosphere	MLAYCGRPPAASFGDRSSYIVPRYARVTIAETCSLGVALATA
Ga0137415_1000003659	3300028536	Vadose Zone Soil	MIAYCGRPTAASFRDRSAYIVGAMPRGTIAEICSPRVGLVTALIGQTGS
Ga0137415_105751331	3300028536	Vadose Zone Soil	WLMLAYCGRPSSASFCDRFPYICVGYAREPIAESCSIWVALATAIITHTGS
Ga0308309_112907792	3300028906	Soil	MLAYCGRPGSAGFCDPFPYICIGYARETIAETCSTRVA
Ga0311339_109902502	3300029999	Palsa	MIAYCGRPRSAAFCDPFPYIDPRYARETIAEICSIWVALATAIINHTGS
Ga0311372_102246193	3300030520	Palsa	MLAYCGRPSSANFCDRFSYIGPRYAREAITEICSMSAALATAIIGHTGSAIHHAR
Ga0311372_105063741	3300030520	Palsa	MLAYCGRPRSASFCDRFPYICVGYARETIAETCSIWVALATAIISHT
Ga0307511_104453521	3300030521	Ectomycorrhiza	MLAYCGRPSSASFCDRFPYICVGYARETIAESCSIWVALA
Ga0311355_107449922	3300030580	Palsa	MLAYCGRPPSAAFRDPFPYIVHAMRGETIAKIGSMGDALATAIIGQTGSSA
Ga0311355_118111271	3300030580	Palsa	MLAYCGRPSSASFCDRFPYICVGYARETIAETCSIWVALVT
Ga0311356_111427462	3300030617	Palsa	MLAYCGRPRSASFCDRFPSIEPSYARETIAETCSTWVALAT
Ga0311354_109059412	3300030618	Palsa	MLAYCGRPSSAAFCDPFPYIDPRYARETIAETRSTWVALATAIISQTGSLPPCAPPPTCA
Ga0302313_101430811	3300030693	Palsa	MLAYCGRPSSAAFCDPFPYIDPRYARETIAETRSTWVALATAI
Ga0302314_101478974	3300030906	Palsa	MLAYCGRPRSASFCDRFPYICVGYARETIAETCSIWVALATAIISHTGSRS
Ga0170824_1125255712	3300031231	Forest Soil	MLAYCGRPAAAAFCDPFPYIEPRYARETIAEICSLA
Ga0310686_1019185922	3300031708	Soil	MLAYCGRPRSAFFCDRFPSIEPSYARETIAETCSTWVALATAIIS
Ga0307476_108244831	3300031715	Hardwood Forest Soil	MLAYCGRPAAAAQVFEDMGDPFPYIVPRRRRETIAEIRSLGVALVTAIMSQTSSY
Ga0307479_114228822	3300031962	Hardwood Forest Soil	VMIAYCGRPPAASFRDPLTYISIDYARSTIAEICSLAVALAT
Ga0311301_106279124	3300032160	Peatlands Soil	MLAYCGRPRSASFCDRFPYICVGYARETIAESCSIWGALAT
Ga0348332_132043252	3300032515	Plant Litter	MLTYCGRPAAASCGDPFPYIEPRYARETIAASCSLPGGLATAIISQ

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign