| Basic Information | |
|---|---|
| Family ID | F050433 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 145 |
| Average Sequence Length | 45 residues |
| Representative Sequence | VAEGVVIRPERDADHPVIAEVVRAAFVGHPDEVASFVERIRASE |
| Number of Associated Samples | 122 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 27.59 % |
| % of genes near scaffold ends (potentially truncated) | 99.31 % |
| % of genes from short scaffolds (< 2000 bps) | 88.28 % |
| Associated GOLD sequencing projects | 118 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.966 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (16.552 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.379 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.517 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.06% β-sheet: 0.00% Coil/Unstructured: 56.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF03575 | Peptidase_S51 | 6.90 |
| PF01872 | RibD_C | 2.76 |
| PF13669 | Glyoxalase_4 | 2.76 |
| PF06224 | HTH_42 | 2.07 |
| PF13302 | Acetyltransf_3 | 2.07 |
| PF13649 | Methyltransf_25 | 2.07 |
| PF02597 | ThiS | 2.07 |
| PF13238 | AAA_18 | 1.38 |
| PF07690 | MFS_1 | 1.38 |
| PF13442 | Cytochrome_CBB3 | 1.38 |
| PF07883 | Cupin_2 | 1.38 |
| PF08241 | Methyltransf_11 | 1.38 |
| PF12681 | Glyoxalase_2 | 1.38 |
| PF07676 | PD40 | 1.38 |
| PF07876 | Dabb | 1.38 |
| PF00248 | Aldo_ket_red | 1.38 |
| PF00583 | Acetyltransf_1 | 1.38 |
| PF09348 | DUF1990 | 0.69 |
| PF02152 | FolB | 0.69 |
| PF13450 | NAD_binding_8 | 0.69 |
| PF00069 | Pkinase | 0.69 |
| PF02518 | HATPase_c | 0.69 |
| PF12840 | HTH_20 | 0.69 |
| PF12697 | Abhydrolase_6 | 0.69 |
| PF01725 | Ham1p_like | 0.69 |
| PF06351 | Allene_ox_cyc | 0.69 |
| PF00361 | Proton_antipo_M | 0.69 |
| PF07508 | Recombinase | 0.69 |
| PF01098 | FTSW_RODA_SPOVE | 0.69 |
| PF13539 | Peptidase_M15_4 | 0.69 |
| PF00814 | TsaD | 0.69 |
| PF12389 | Peptidase_M73 | 0.69 |
| PF14378 | PAP2_3 | 0.69 |
| PF00278 | Orn_DAP_Arg_deC | 0.69 |
| PF08245 | Mur_ligase_M | 0.69 |
| PF08818 | DUF1801 | 0.69 |
| PF01177 | Asp_Glu_race | 0.69 |
| PF03364 | Polyketide_cyc | 0.69 |
| PF01641 | SelR | 0.69 |
| PF00903 | Glyoxalase | 0.69 |
| PF03167 | UDG | 0.69 |
| PF13476 | AAA_23 | 0.69 |
| PF14362 | DUF4407 | 0.69 |
| PF09900 | DUF2127 | 0.69 |
| PF01022 | HTH_5 | 0.69 |
| PF02607 | B12-binding_2 | 0.69 |
| PF02371 | Transposase_20 | 0.69 |
| PF00392 | GntR | 0.69 |
| PF08327 | AHSA1 | 0.69 |
| PF00211 | Guanylate_cyc | 0.69 |
| PF03144 | GTP_EFTU_D2 | 0.69 |
| PF06745 | ATPase | 0.69 |
| PF04828 | GFA | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 2.76 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.76 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 2.76 |
| COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 2.07 |
| COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 2.07 |
| COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 2.07 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.69 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.69 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.69 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.69 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.69 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.69 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.69 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.69 |
| COG0019 | Diaminopimelate decarboxylase | Amino acid transport and metabolism [E] | 0.69 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.69 |
| COG1539 | Dihydroneopterin aldolase | Coenzyme transport and metabolism [H] | 0.69 |
| COG1214 | tRNA A37 threonylcarbamoyladenosine modification protein TsaB | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG1166 | Arginine decarboxylase (spermidine biosynthesis) | Amino acid transport and metabolism [E] | 0.69 |
| COG0772 | Peptodoglycan polymerase FtsW/RodA/SpoVE | Cell cycle control, cell division, chromosome partitioning [D] | 0.69 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.69 |
| COG0533 | tRNA A37 threonylcarbamoyltransferase TsaD | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 0.69 |
| COG0127 | Inosine/xanthosine triphosphate pyrophosphatase, all-alpha NTP-PPase family | Nucleotide transport and metabolism [F] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.97 % |
| Unclassified | root | N/A | 11.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559006|FI_contig15081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 830 | Open in IMG/M |
| 2170459009|GA8DASG01AIV6K | Not Available | 504 | Open in IMG/M |
| 3300000891|JGI10214J12806_12429720 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300000955|JGI1027J12803_108073518 | All Organisms → cellular organisms → Bacteria | 2021 | Open in IMG/M |
| 3300000956|JGI10216J12902_105809236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 1004 | Open in IMG/M |
| 3300000956|JGI10216J12902_108787167 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300000956|JGI10216J12902_109150951 | Not Available | 635 | Open in IMG/M |
| 3300001535|A3PFW1_10089681 | Not Available | 1590 | Open in IMG/M |
| 3300001535|A3PFW1_10146198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5004 | Open in IMG/M |
| 3300004114|Ga0062593_101049570 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300004157|Ga0062590_101121857 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300005093|Ga0062594_101502715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 691 | Open in IMG/M |
| 3300005181|Ga0066678_10981445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 549 | Open in IMG/M |
| 3300005327|Ga0070658_11358378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 617 | Open in IMG/M |
| 3300005338|Ga0068868_100785942 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300005340|Ga0070689_100475307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 1067 | Open in IMG/M |
| 3300005347|Ga0070668_100652636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 925 | Open in IMG/M |
| 3300005354|Ga0070675_102122004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 518 | Open in IMG/M |
| 3300005366|Ga0070659_101530535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → Paenibacillus dendritiformis | 595 | Open in IMG/M |
| 3300005366|Ga0070659_101562872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 588 | Open in IMG/M |
| 3300005437|Ga0070710_10010869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4482 | Open in IMG/M |
| 3300005439|Ga0070711_100797347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 801 | Open in IMG/M |
| 3300005444|Ga0070694_101852405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 515 | Open in IMG/M |
| 3300005468|Ga0070707_100565988 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300005618|Ga0068864_101794230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 619 | Open in IMG/M |
| 3300005718|Ga0068866_10424051 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300005764|Ga0066903_100338978 | All Organisms → cellular organisms → Bacteria | 2419 | Open in IMG/M |
| 3300005764|Ga0066903_100724860 | All Organisms → cellular organisms → Bacteria | 1759 | Open in IMG/M |
| 3300005764|Ga0066903_108453731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 525 | Open in IMG/M |
| 3300006237|Ga0097621_102132397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 536 | Open in IMG/M |
| 3300006358|Ga0068871_101997206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 552 | Open in IMG/M |
| 3300006575|Ga0074053_12016026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 510 | Open in IMG/M |
| 3300006578|Ga0074059_11905875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 782 | Open in IMG/M |
| 3300006579|Ga0074054_10014164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 658 | Open in IMG/M |
| 3300006881|Ga0068865_102180165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 504 | Open in IMG/M |
| 3300006954|Ga0079219_12002815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 551 | Open in IMG/M |
| 3300007076|Ga0075435_100033590 | All Organisms → cellular organisms → Bacteria | 4058 | Open in IMG/M |
| 3300007255|Ga0099791_10270336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 808 | Open in IMG/M |
| 3300009093|Ga0105240_10988496 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300009093|Ga0105240_12703471 | Not Available | 512 | Open in IMG/M |
| 3300009098|Ga0105245_10375154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1415 | Open in IMG/M |
| 3300009098|Ga0105245_11942797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 642 | Open in IMG/M |
| 3300009101|Ga0105247_10035427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3042 | Open in IMG/M |
| 3300009101|Ga0105247_11522942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 546 | Open in IMG/M |
| 3300009137|Ga0066709_101111377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. | 1162 | Open in IMG/M |
| 3300009148|Ga0105243_10988886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 843 | Open in IMG/M |
| 3300009148|Ga0105243_11683665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 663 | Open in IMG/M |
| 3300009162|Ga0075423_10906512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 935 | Open in IMG/M |
| 3300009176|Ga0105242_10218582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium | 1702 | Open in IMG/M |
| 3300009176|Ga0105242_11968855 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300009545|Ga0105237_11446989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 694 | Open in IMG/M |
| 3300009551|Ga0105238_11389725 | Not Available | 729 | Open in IMG/M |
| 3300009840|Ga0126313_11191277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 628 | Open in IMG/M |
| 3300010036|Ga0126305_10810274 | Not Available | 637 | Open in IMG/M |
| 3300010037|Ga0126304_10003019 | All Organisms → cellular organisms → Bacteria | 8414 | Open in IMG/M |
| 3300010040|Ga0126308_11290230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 519 | Open in IMG/M |
| 3300010042|Ga0126314_10111074 | Not Available | 1874 | Open in IMG/M |
| 3300010166|Ga0126306_10045832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 3012 | Open in IMG/M |
| 3300010323|Ga0134086_10175612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 791 | Open in IMG/M |
| 3300010326|Ga0134065_10318241 | Not Available | 601 | Open in IMG/M |
| 3300010335|Ga0134063_10407922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 667 | Open in IMG/M |
| 3300010360|Ga0126372_12963292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 526 | Open in IMG/M |
| 3300010366|Ga0126379_10519829 | Not Available | 1265 | Open in IMG/M |
| 3300010371|Ga0134125_12668189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 543 | Open in IMG/M |
| 3300010375|Ga0105239_10412037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1530 | Open in IMG/M |
| 3300010375|Ga0105239_13012886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 549 | Open in IMG/M |
| 3300010375|Ga0105239_13222068 | Not Available | 531 | Open in IMG/M |
| 3300010399|Ga0134127_11166449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 836 | Open in IMG/M |
| 3300010399|Ga0134127_12495857 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300011003|Ga0138514_100007933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1656 | Open in IMG/M |
| 3300011003|Ga0138514_100061296 | Not Available | 775 | Open in IMG/M |
| 3300011119|Ga0105246_10371893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1178 | Open in IMG/M |
| 3300011119|Ga0105246_12330918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 524 | Open in IMG/M |
| 3300012011|Ga0120152_1038919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1612 | Open in IMG/M |
| 3300012198|Ga0137364_10573841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 849 | Open in IMG/M |
| 3300012353|Ga0137367_10819631 | Not Available | 645 | Open in IMG/M |
| 3300012357|Ga0137384_10324528 | Not Available | 1278 | Open in IMG/M |
| 3300012359|Ga0137385_11594532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 517 | Open in IMG/M |
| 3300012493|Ga0157355_1015127 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300012507|Ga0157342_1078114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 516 | Open in IMG/M |
| 3300012892|Ga0157294_10203554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 584 | Open in IMG/M |
| 3300012955|Ga0164298_10417321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 872 | Open in IMG/M |
| 3300012958|Ga0164299_11060669 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300012960|Ga0164301_10625856 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300012960|Ga0164301_11453136 | Not Available | 563 | Open in IMG/M |
| 3300012961|Ga0164302_10503591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 855 | Open in IMG/M |
| 3300012971|Ga0126369_11455124 | Not Available | 775 | Open in IMG/M |
| 3300012984|Ga0164309_11823208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 522 | Open in IMG/M |
| 3300012987|Ga0164307_10053001 | All Organisms → cellular organisms → Bacteria | 2339 | Open in IMG/M |
| 3300012987|Ga0164307_10982941 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300012988|Ga0164306_11594296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 563 | Open in IMG/M |
| 3300012989|Ga0164305_11026588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 703 | Open in IMG/M |
| 3300013102|Ga0157371_10050188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2964 | Open in IMG/M |
| 3300013104|Ga0157370_10419180 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 3300013105|Ga0157369_11010988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 851 | Open in IMG/M |
| 3300013297|Ga0157378_11610159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 695 | Open in IMG/M |
| 3300013306|Ga0163162_12375746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 609 | Open in IMG/M |
| 3300014326|Ga0157380_13320961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 514 | Open in IMG/M |
| 3300015077|Ga0173483_10009972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3232 | Open in IMG/M |
| 3300015371|Ga0132258_11173829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 1941 | Open in IMG/M |
| 3300015371|Ga0132258_12678314 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300015372|Ga0132256_100112517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2671 | Open in IMG/M |
| 3300015373|Ga0132257_100906375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1105 | Open in IMG/M |
| 3300015373|Ga0132257_102337139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 693 | Open in IMG/M |
| 3300015374|Ga0132255_100277181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2405 | Open in IMG/M |
| 3300015374|Ga0132255_101327111 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300015374|Ga0132255_105940996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 516 | Open in IMG/M |
| 3300017792|Ga0163161_10224055 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
| 3300018072|Ga0184635_10048309 | All Organisms → cellular organisms → Bacteria | 1639 | Open in IMG/M |
| 3300019361|Ga0173482_10284608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 720 | Open in IMG/M |
| 3300019867|Ga0193704_1039845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 937 | Open in IMG/M |
| 3300020082|Ga0206353_10774360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2742 | Open in IMG/M |
| 3300022901|Ga0247788_1125239 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300023266|Ga0247789_1085395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 615 | Open in IMG/M |
| 3300025908|Ga0207643_10072012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1990 | Open in IMG/M |
| 3300025918|Ga0207662_10200102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1293 | Open in IMG/M |
| 3300025921|Ga0207652_10992832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 738 | Open in IMG/M |
| 3300025924|Ga0207694_10843024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 775 | Open in IMG/M |
| 3300025933|Ga0207706_11100893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 664 | Open in IMG/M |
| 3300025934|Ga0207686_11739460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 516 | Open in IMG/M |
| 3300025944|Ga0207661_11808814 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300026078|Ga0207702_11303703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 720 | Open in IMG/M |
| 3300026995|Ga0208761_1034740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 517 | Open in IMG/M |
| 3300027478|Ga0207448_101552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 667 | Open in IMG/M |
| 3300028597|Ga0247820_11404048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 509 | Open in IMG/M |
| 3300028708|Ga0307295_10000571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 7860 | Open in IMG/M |
| 3300028714|Ga0307309_10204550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 521 | Open in IMG/M |
| 3300028715|Ga0307313_10019625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1825 | Open in IMG/M |
| 3300028744|Ga0307318_10067648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1192 | Open in IMG/M |
| 3300028771|Ga0307320_10035985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1810 | Open in IMG/M |
| 3300028784|Ga0307282_10051326 | All Organisms → cellular organisms → Bacteria | 1842 | Open in IMG/M |
| 3300028812|Ga0247825_11011763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 604 | Open in IMG/M |
| 3300028875|Ga0307289_10000855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13254 | Open in IMG/M |
| 3300028885|Ga0307304_10403666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium | 617 | Open in IMG/M |
| 3300031226|Ga0307497_10019371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2075 | Open in IMG/M |
| 3300031226|Ga0307497_10196594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 871 | Open in IMG/M |
| 3300031573|Ga0310915_11160227 | Not Available | 535 | Open in IMG/M |
| 3300031671|Ga0307372_10440050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 648 | Open in IMG/M |
| 3300031713|Ga0318496_10567896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 627 | Open in IMG/M |
| 3300031731|Ga0307405_11554297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 583 | Open in IMG/M |
| 3300031736|Ga0318501_10123344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 1313 | Open in IMG/M |
| 3300031908|Ga0310900_10508459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 937 | Open in IMG/M |
| 3300031996|Ga0308176_10689360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1059 | Open in IMG/M |
| 3300032013|Ga0310906_10236073 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
| 3300032126|Ga0307415_101183984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 719 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 16.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 6.21% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.52% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.83% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.14% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.76% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.07% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.07% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.07% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.07% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.07% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.38% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.38% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.38% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.38% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 1.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.38% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.38% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.38% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.69% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.69% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.69% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559006 | Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembled | Environmental | Open in IMG/M |
| 2170459009 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012493 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610 | Environmental | Open in IMG/M |
| 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4 | Environmental | Open in IMG/M |
| 3300023266 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4 | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026995 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB (SPAdes) | Environmental | Open in IMG/M |
| 3300027478 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK03-E (SPAdes) | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031671 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-1 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FI_00091120 | 2166559006 | Grass Soil | LPAVAEGVVIRPEREADHPAIADVVRAAFVRHPDEVASFVEAIRAS |
| F47_07460690 | 2170459009 | Grass Soil | VAEGVVIRPERDADHPVIAEVVRAAFVGHPDEVVSFLERIRASEQFITELALV |
| JGI10214J12806_124297201 | 3300000891 | Soil | VADAVLIRPERETDHPAIAEVVRAAFVEHPDEVASFVERIRASEQF |
| JGI1027J12803_1080735181 | 3300000955 | Soil | VVEGVVIRPERDADCPVIAEVVRAAFVGHPDEVASFVER |
| JGI10216J12902_1058092364 | 3300000956 | Soil | VPELASPLVAEGVVIRAECDADHPVIAEVVRAAFVGHADEVASFVERIRASEQF |
| JGI10216J12902_1087871672 | 3300000956 | Soil | VAEGVVIRSERDGDHSVIAEVVRAAFVGQPDEVGLFVQRIRASEQFIPELALVAE |
| JGI10216J12902_1091509511 | 3300000956 | Soil | VAEGVVIRPECDTDHPAIAEVVRAAFVRHPDEVASFVERIRASEQ |
| A3PFW1_100896813 | 3300001535 | Permafrost | VPQLPSPPVAEGVVIRPERDADHPVIAEVVRAAFVGHPDEVASFVE |
| A3PFW1_101461981 | 3300001535 | Permafrost | MAEGVVVRPERDADHPVIAEVIRAAFVGHPDEVASFVE |
| Ga0062593_1010495702 | 3300004114 | Soil | VERPESEDVVIRAERDADQPVIAEVVRAAFAGHPDEVASFVERIRGSEQFI |
| Ga0062590_1011218572 | 3300004157 | Soil | VADCVVIRPERDADYPRIAEVIRAAFVGHPDEVASFVERIRASEQFIPELAL |
| Ga0062594_1015027151 | 3300005093 | Soil | VIEGLVIRPERDADHAVIAEVVGAAFVNHPDDEVASFVERIRASE |
| Ga0066678_109814451 | 3300005181 | Soil | VAEGVVIRPERDADHPVIAELVRAAFVGHPDEVASFVERIRASEQ |
| Ga0070658_113583782 | 3300005327 | Corn Rhizosphere | VTDEIVIRPERDADHAVIADVVRGAFIRHPDEVALFVERIRASEHYIP |
| Ga0068868_1007859421 | 3300005338 | Miscanthus Rhizosphere | VPRLPSPPVAEGVVIRPERDADHPVIAEVVRAAFVGHPDEVASF |
| Ga0070689_1004753071 | 3300005340 | Switchgrass Rhizosphere | VIEGLVIRPERDADHAVIAEVVGAAFVNHPDDEVASFVER |
| Ga0070668_1006526362 | 3300005347 | Switchgrass Rhizosphere | VAEGVVIRPEREADHPVIAEVVRAAFVGHPREVASFVERIRESDQSIPELALV |
| Ga0070675_1021220041 | 3300005354 | Miscanthus Rhizosphere | VAEGVVIRPEREADHPVIAEVVRAAFDGHPDEVASFVERIRASEQFV |
| Ga0070659_1015305351 | 3300005366 | Corn Rhizosphere | LAGVRDNYHRVAEGIVIRPECDADHPAIAEVVGAAFVGHPDEVVSFVERIRASEQFIPELALVAED |
| Ga0070659_1015628722 | 3300005366 | Corn Rhizosphere | VADGVVIRPECDADRSVIAEVVRAAFVRHPDEVASFVERLRASEHFIPEF |
| Ga0070710_100108697 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VAEGVVIRPERDADQSVIAEVVRAAFVRHPDEVASFVERIRASEHF |
| Ga0070711_1007973473 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VIEGLVIRPERDADHAVIAEVVRAAFVRHPDEVAEFVERIRASEH |
| Ga0070694_1018524051 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VPRLPSPPVAEGVVIRPERDADHPVIAEVVRAAFVGHPDEVASFVERIRASEQF |
| Ga0070707_1005659883 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VAEGVVIRPERDADHPVIAEVVRAAFVGHPDEVASFVERIRASEQFIP |
| Ga0068864_1017942302 | 3300005618 | Switchgrass Rhizosphere | VADDLLIRPERAADHPAIADVVRAAFARQPHEVAAFVER |
| Ga0068866_104240511 | 3300005718 | Miscanthus Rhizosphere | VAGGANGVPRLPSPPVAEGVVIRPERDADHPVIAEVVRAAFVGHPDEVASFVE |
| Ga0066903_1003389781 | 3300005764 | Tropical Forest Soil | MAEGVVIRPEREADHPVIAEVVRAAFVGHPDEVASFVERIR |
| Ga0066903_1007248601 | 3300005764 | Tropical Forest Soil | VVEGVVIRTECDADHPVIAEVVRAAFVGHPDEVASFVER |
| Ga0066903_1084537312 | 3300005764 | Tropical Forest Soil | VAEGVVIRPEREADHAVIGEVVRAAFVSHPDEVASFVERIRASEQF |
| Ga0097621_1021323971 | 3300006237 | Miscanthus Rhizosphere | VAEGVVIRPERDADHPVIAEVVSAAFVRQPDEVPAFVERIRASEQF |
| Ga0068871_1019972063 | 3300006358 | Miscanthus Rhizosphere | VADGVVIRPERDADHPVIADVVRAAFDQHPDDVAAFVERIR |
| Ga0074053_120160262 | 3300006575 | Soil | VIRPERDADHSVIAEVVRAAFVGHPDEVASFVERIRASEQ |
| Ga0074059_119058751 | 3300006578 | Soil | MGECVVIRPERATDHPVIAEVVRAAFAGQDPDDVASFVERIRASEQFIPELA |
| Ga0074054_100141641 | 3300006579 | Soil | VPQLPSPPVAEGVVIRPERDADHPVIAEVVRAAFVGHPDEVA |
| Ga0068865_1021801651 | 3300006881 | Miscanthus Rhizosphere | VAEDLVIRPERAADHDAIAEVVRAAFVEHPDEVAT |
| Ga0079219_120028152 | 3300006954 | Agricultural Soil | VISHLPVAESVVIRPEREADHRVIADVVRAAFVRHPD |
| Ga0075435_1000335905 | 3300007076 | Populus Rhizosphere | MPRLPSPAVAEGVVIRPERVADHPVIAEVVRAAFVGHPDEVASF |
| Ga0099791_102703362 | 3300007255 | Vadose Zone Soil | VAEGVVIRPERDADHSSIAEVVRAAFVGHPDEVASFVERIRASEQSPVVLARK* |
| Ga0105240_109884961 | 3300009093 | Corn Rhizosphere | VAEGVVIRPERDADHPVIAEVVRAAFVGHPDEVASFVERIRASEQF |
| Ga0105240_127034712 | 3300009093 | Corn Rhizosphere | VADRLLIRPEREADHSAIAEVVRAAFIRQPDEVAAFFERI |
| Ga0105245_103751541 | 3300009098 | Miscanthus Rhizosphere | VAEGVVIRPEREADHPVIAEVVRAAFVGHPHEVASFVERIRESDQSIPELAF |
| Ga0105245_119427971 | 3300009098 | Miscanthus Rhizosphere | VAEDVVIRPERDADHPLIADVVRAAFDQHPDDVAAFVERI |
| Ga0105247_100354271 | 3300009101 | Switchgrass Rhizosphere | VAEGVVIRPEREADHPAIAEVVRAAFVGHPEEVAS |
| Ga0105247_115229421 | 3300009101 | Switchgrass Rhizosphere | VADGVVIRPECDADRSVIAEVVRAAFVGQPDEVALFV |
| Ga0066709_1011113771 | 3300009137 | Grasslands Soil | VSFSVDRRVLDESLVIRPEREADGPAIAEVVRAAFVTHPDEVASFVERIRASEQFVPQLALVAEDA |
| Ga0105243_109888861 | 3300009148 | Miscanthus Rhizosphere | VAEDLVIRPERAADHDAIAEVVRAAFVEHPDEVATFVERIRAS |
| Ga0105243_116836651 | 3300009148 | Miscanthus Rhizosphere | LAGVRDNYHRVAEGIVIRPECDADHPAIAEVVGAAFVGHPDEVVSFVERIRASEQFIPEL |
| Ga0075423_109065122 | 3300009162 | Populus Rhizosphere | VAEGVVIRPERVADHPVIAEVVRAAFVGHPDEVASFVERIRASERFIPE |
| Ga0105242_102185821 | 3300009176 | Miscanthus Rhizosphere | VAEGVVIRPERDADHPVIAEVVSAAFVRQPDVPAF |
| Ga0105242_119688551 | 3300009176 | Miscanthus Rhizosphere | VAEGVVIRSERDGDHSVIAEVVRAAFVGQPDEVALFVQR |
| Ga0105237_114469892 | 3300009545 | Corn Rhizosphere | VAEAVVIRPERDADQLVIAEVVRAAFVGHPDKVASFVERIRSSEEFIPELALVAE |
| Ga0105238_113897251 | 3300009551 | Corn Rhizosphere | VAEGVVIRPERDADHPAIAKVVRAAFVEHPDEVASFVERIRASEQF |
| Ga0126313_111912772 | 3300009840 | Serpentine Soil | VAEVVVSRPERDADRLVIADVVRAAFIGHPDEVASFVERIRAS |
| Ga0126305_108102741 | 3300010036 | Serpentine Soil | VSEDVVIRPERHKDHRVIADVVRAAFVEHPDEVASF |
| Ga0126304_100030191 | 3300010037 | Serpentine Soil | VAEGVVIRPERDADHPVIAEVVRAAFVGHPDEVVSFVER |
| Ga0126308_112902302 | 3300010040 | Serpentine Soil | VAESVVVRPERDADHPVIAEVVRAAFVGHPDEVVSFVER |
| Ga0126314_101110742 | 3300010042 | Serpentine Soil | VTADGLVVRPERDADHAAIAEVVRAAFVGHPDEVASFVERIRVSEQFIPE |
| Ga0126306_100458321 | 3300010166 | Serpentine Soil | MSPEARTACPNYHRTVAEGIVIRPERDADHPVIAEVVHAAFVGHPDEVVSFVERIRA |
| Ga0134086_101756121 | 3300010323 | Grasslands Soil | IRPERDADHPAIAEVVRAAFVEHPDEVASFVERIRASDRPV* |
| Ga0134065_103182412 | 3300010326 | Grasslands Soil | VAEGVVIRPERDADHPVIAEVVRAAFVGHPDEVASFVERI |
| Ga0134063_104079221 | 3300010335 | Grasslands Soil | VAEGVVIRPERDADHPVIAEVVRAAFVGHPDEVASFVERIRVSEQFI |
| Ga0126372_129632921 | 3300010360 | Tropical Forest Soil | VVEGVVIRTECDADHPVIAEVVGAAFVGHPDEVVSFVEGIRASEQFI |
| Ga0126379_105198294 | 3300010366 | Tropical Forest Soil | MANGVVIRPERKADYPRITEVVRAAFVRHPDEVASFV |
| Ga0134125_126681892 | 3300010371 | Terrestrial Soil | VAESVVIRPERDADHPVIAEVVRAAFAGHPAEVASFVER |
| Ga0105239_104120371 | 3300010375 | Corn Rhizosphere | VAERLVIRPQRDADRDAIAEVVRAAFVGDGDEVAAFAERIQASE |
| Ga0105239_130128861 | 3300010375 | Corn Rhizosphere | VADGVVIRPECDADRSVIAEVVRAAFVRHPDEVASFVERLRASEHFIPEFALVAED |
| Ga0105239_132220681 | 3300010375 | Corn Rhizosphere | MSSVVIRPERGADHPVIAEVVRAAFVRHPDEVASFV |
| Ga0134127_111664492 | 3300010399 | Terrestrial Soil | VADGVVIRLECDADHPAIAEVVGAAFVGHPDAVVSFVERIRASEQFIPELAFVAEDPSGL |
| Ga0134127_124958571 | 3300010399 | Terrestrial Soil | VADGVVIRPERHADHPGIAELVRAAFVGHPDEVASFVERI |
| Ga0138514_1000079331 | 3300011003 | Soil | VAEGVVIRPERDADHPVIAEVVRAAFVGHPDEVASFVERIRASEQFIPE |
| Ga0138514_1000612962 | 3300011003 | Soil | VAEGVVIRPERDADHPGIAEVVRAAFVGHPDEVASFVERIRASEQFIPE |
| Ga0105246_103718931 | 3300011119 | Miscanthus Rhizosphere | VAEGVVIRPEREVDHPVIAEVVRAAFVGHPREVASFVERIRESHQFIPELA |
| Ga0105246_123309182 | 3300011119 | Miscanthus Rhizosphere | VAEGVVIRPERDADHPAIAEVVRAAFVGHPDEVASF |
| Ga0120152_10389191 | 3300012011 | Permafrost | VAEGVVIRPERDADHPAIAEVVRAAFVRHPDEVATFVDRIRASEQFIP |
| Ga0137364_105738412 | 3300012198 | Vadose Zone Soil | VAEGLVIRPECDADHPVIAEVVRSAFVKHPDEVASFVERIRASEQFV |
| Ga0137367_108196312 | 3300012353 | Vadose Zone Soil | MTPDYHRHPPVAEGVVIRPERDADHPVIAEVVRAAFVGHPDEVASFVERIRA |
| Ga0137384_103245282 | 3300012357 | Vadose Zone Soil | VAEGVVIRPERDADHPVIAEVVRAAFVGHPDEVASFVERIRASE |
| Ga0137385_115945321 | 3300012359 | Vadose Zone Soil | VAEGVVTRPERDAAHPVIAEVVRAAFVGHPDEVASFVE |
| Ga0157355_10151272 | 3300012493 | Unplanted Soil | VAEGVVIRPERDADHPVIAEVVRAAFVGHPDEVASFVERIRASGQFIPE |
| Ga0157342_10781142 | 3300012507 | Arabidopsis Rhizosphere | VAEGVVIRPEREADHPVIAEVVRAAFDGHPDEVASFVERIR |
| Ga0157294_102035541 | 3300012892 | Soil | VKAVDRSVAEGVVIRRERDADHPVIAEVVRAAFVGHPREVAS |
| Ga0164298_104173211 | 3300012955 | Soil | VAEGVLIRPDRDADRPVIAEVVRAAFVGHPDEVASFVERIRASEQF |
| Ga0164299_110606692 | 3300012958 | Soil | VVDGVVIRPEREPDHAVIAEVVRAAFVGHPDEVASFVERIRAS |
| Ga0164301_106258561 | 3300012960 | Soil | VVEGVVIRPECDADHPVIAEVVRAAFVGHPDEVASFVERIRASEQFIPE |
| Ga0164301_114531361 | 3300012960 | Soil | VAEGIVIRPERDADHLAIAEVVRAAFVEHPDEVAAFVERI |
| Ga0164302_105035913 | 3300012961 | Soil | VAEGVVIRPERDADHSAIAEVVRAAFVGHPDEVASFV |
| Ga0126369_114551243 | 3300012971 | Tropical Forest Soil | VAEDIHLRPECDADHPAIAKVVRAAFAGHPEEVAAFVERI |
| Ga0164309_118232081 | 3300012984 | Soil | VAEGVVIRPERDADHPVITEVVRAAFVGHPDDVASFVE |
| Ga0164307_100530014 | 3300012987 | Soil | VVEGVVIRPECDADHPVIAEVVRAAFVGHPDEVASFVE |
| Ga0164307_109829412 | 3300012987 | Soil | VAEGVVIRPEREPDHPVIAEVVRAAFVGHPDEVASFVERIRAS |
| Ga0164306_115942961 | 3300012988 | Soil | VADGVVIRPERDADHPAIAEVVRAAFVGHPDEVAAFVERIRASEQF |
| Ga0164305_110265881 | 3300012989 | Soil | VAKGVVIRPERDADHPVIAEVVRAAFVEHPDEVASF |
| Ga0157371_100501885 | 3300013102 | Corn Rhizosphere | VAEGVVIRPERHADHPGIAELVRAAFVGHPDEVASFVERIR |
| Ga0157370_104191803 | 3300013104 | Corn Rhizosphere | VAEDVVIRPECEEDRLAVGEVVRAAFVRHPDQVASLVERILASDGSTP |
| Ga0157369_110109881 | 3300013105 | Corn Rhizosphere | VAEGVVIRPERDADHSVIAEVVRAAFVGHPDEVAS |
| Ga0157378_116101592 | 3300013297 | Miscanthus Rhizosphere | VAEGVVIRPEREADHPVIAEVVRAAFVGHPHEVASFVERIRESDQSIP |
| Ga0163162_123757461 | 3300013306 | Switchgrass Rhizosphere | VAQSVVIRPERDSDHPVIAEVVRAAFVGHPDEVASFVERIRASEQF |
| Ga0157380_133209611 | 3300014326 | Switchgrass Rhizosphere | VAEGVVIRPERDADHPVIAEVVSAAFVRQPDEVPAFVERIRASEQFVPELALVAED |
| Ga0173483_100099726 | 3300015077 | Soil | VAEGVVIRPERDADHPVIAEVVRAAFVRHPDEVALFVERIRASD |
| Ga0132258_111738294 | 3300015371 | Arabidopsis Rhizosphere | VAEGVIIRPERDEDHPVIAEVVRAAFVEHPDEVASFVERIRA |
| Ga0132258_126783144 | 3300015371 | Arabidopsis Rhizosphere | VAEGVVIRPERHADHPGIAELVRAAFVGHPDEVASFVERIRA |
| Ga0132256_1001125171 | 3300015372 | Arabidopsis Rhizosphere | VAEGVVIRPERDADHAVIAEGVRAAFVRHPDEVASFVERIRESEQFIP |
| Ga0132257_1009063751 | 3300015373 | Arabidopsis Rhizosphere | VADGVVIRPERDADHPAIAEVVGAAFVGQPDAVVSFVERIRASEQFI |
| Ga0132257_1023371391 | 3300015373 | Arabidopsis Rhizosphere | VAVGVVIRPERDADHPVIAEVVRAAFVGHPDRVASFV |
| Ga0132255_1002771811 | 3300015374 | Arabidopsis Rhizosphere | VAVRVVVRPERDADYSAIAQVVRAAFVGHPDEVASFVERIRASEQFIPE |
| Ga0132255_1013271111 | 3300015374 | Arabidopsis Rhizosphere | VAERVVIRPERDEDHPVIAEVIRAAFVGHPDEVASFVERIRA |
| Ga0132255_1059409961 | 3300015374 | Arabidopsis Rhizosphere | VAEGVIIRPERDEDHPVIAEVVRAAFVEPPDEVASFVERI |
| Ga0163161_102240551 | 3300017792 | Switchgrass Rhizosphere | VAEGVVIRPERHADHPRIAELVRAAFVGHPDEVASFVERIRASEQFI |
| Ga0184635_100483091 | 3300018072 | Groundwater Sediment | VPQLPSPPVAEGVVIRPERDADHPVIAEVVRAAFVGHPDEVAS |
| Ga0173482_102846082 | 3300019361 | Soil | VKAVDRSVAEGVVIRRERDADHPVIAEVVRAAFVGHPDEVASFVER |
| Ga0193704_10398452 | 3300019867 | Soil | VPQLPSPPVAEGVVIRPERDADHPLIAEVVRAAFVGHPDEVAS |
| Ga0206353_107743601 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | VAEDVVIRPECEEDRLAVGEVVRAAFVRHPDQVASLVERIRASDGFIPELAL |
| Ga0247788_11252391 | 3300022901 | Soil | VSQLPSPPVAEGVVIRPERDADHPVIAEVVRAAFVGHPDEVASFVER |
| Ga0247789_10853951 | 3300023266 | Soil | VAEGVVIRPEREADHPVIAEVVRAAFDGHPDEVASFVERIRASEQFVP |
| Ga0207643_100720124 | 3300025908 | Miscanthus Rhizosphere | VVEGIVIRPERGADQSVIAEVVNAAFSGRPEVASFVER |
| Ga0207662_102001021 | 3300025918 | Switchgrass Rhizosphere | VAEGVVIRPEREADHPVIAEVVRAAFVGHPHEVASFVERIRESDQSIPELAFVAEDSS |
| Ga0207652_109928322 | 3300025921 | Corn Rhizosphere | VADGVVIRPERDADHPAIAEVVRAAFVGHPDEVAAFVE |
| Ga0207694_108430241 | 3300025924 | Corn Rhizosphere | MSDVVIRLERDSDHSTIAEVVRAAFVRHPDEVATFVERIRASEEFIPELA |
| Ga0207706_111008932 | 3300025933 | Corn Rhizosphere | MSDVVIRLERDSDHSTIAEVVRAAFVRHPDEVATFV |
| Ga0207686_117394601 | 3300025934 | Miscanthus Rhizosphere | VADGIVIRPERDADQPVIAEVVRAAFVGHPDEVASFVERIRASEQFI |
| Ga0207661_118088141 | 3300025944 | Corn Rhizosphere | MAERIVIRPERDEDHPAVADVVRAAFVGHPDEVASF |
| Ga0207702_113037032 | 3300026078 | Corn Rhizosphere | VADGVVIRPERDADHPAIAEVVRAAFVGHPDEVAAFVERIRAS |
| Ga0208761_10347402 | 3300026995 | Soil | VAEGVVIRPERDADHPLIAEVVRAAFVEHPDEVASFVERIRAS |
| Ga0207448_1015522 | 3300027478 | Soil | VPQLPSPPVAEGVVIRPERDADRRVIGDVVRAAFVGHPDEVASFVERIRASEHFI |
| Ga0247820_114040482 | 3300028597 | Soil | VAEGVVIRPERDADHPVIAEVVRAAFVGHPDEVASFV |
| Ga0307295_100005719 | 3300028708 | Soil | MPQLPSPPVAEGVVIRPERDADRPLIAEVVRATFVGHPDEVASFVERIRASEQFI |
| Ga0307309_102045501 | 3300028714 | Soil | VAGGANGVPQLPSPPVAEGVVIRPERDADHPLIAEVVRAAFVGHPDEVA |
| Ga0307313_100196254 | 3300028715 | Soil | MPQLPSPPVAEGVVIRPERDADRPVIAEVVRAAFVGHPDEVASFVERIRASEQFIPELAL |
| Ga0307318_100676483 | 3300028744 | Soil | MPQLPSPPVAEGVVIRPERDADRPVIAEVVRAAFVGHPDDVASF |
| Ga0307320_100359851 | 3300028771 | Soil | MPQLPSPPVAEGVVIRPERDAYRPVIAEVVRAAFVRHPDEVASFV |
| Ga0307282_100513261 | 3300028784 | Soil | VPQLPSPPVAEGVVIRPERDADHPLIAEVVRAAFVGHPDEVASFVE |
| Ga0247825_110117632 | 3300028812 | Soil | MAGGSNRLPQLPSPQVAEGVVIRPEREADYPVIAEVVRAAFVGHPDEVAS |
| Ga0307289_100008551 | 3300028875 | Soil | MPQLPSPPVAEGVVIRPERDADRPVIAEVVRAAFVGHPDEVASFVERIRASEQ |
| Ga0307304_104036661 | 3300028885 | Soil | MPQLPSPPVAEGVVIRPERDADRPVIAEVVRAAFVGHPDEVASFVERI |
| Ga0307497_100193711 | 3300031226 | Soil | LPPITIATLAEGVVIRPERDADHPVIAEIVRAAFVGYPDEVAAFVERIRA |
| Ga0307497_101965941 | 3300031226 | Soil | MSPEAGTACPNYHRPVAEGIVIRPERDADHPVIAEVVRAAFVGHPDEVASFVERIRAS |
| Ga0310915_111602271 | 3300031573 | Soil | VAESVVIRPERSADHPVIAEVVRGAFGGHPDEVVAFVERIRASEQF |
| Ga0307372_104400501 | 3300031671 | Soil | VAEGVVIRPEREADHSVIAEVVCAAFVGHADEVASFVERIRASEQFIPELALV |
| Ga0318496_105678962 | 3300031713 | Soil | VADGVVIRPENDADHPVIAEVVRAAFVGHPDEVASFVERIRASKQF |
| Ga0307405_115542971 | 3300031731 | Rhizosphere | VSQLPSPPVAEGVVIRPERDADHPVIAEVVRAAFIKHADEVASFVGRIR |
| Ga0318501_101233442 | 3300031736 | Soil | VAESVVIRPERSADHPVIAEVVRGAFGGHPDEVVAFVERIRASEQFIPELALVAEDASG |
| Ga0310900_105084591 | 3300031908 | Soil | VAEGVVIRPEREADYPVIAEVVRAAFVGHPDEVASFVERI |
| Ga0308176_106893601 | 3300031996 | Soil | MTRSTGMPSPPVAEGVAIRPEREADHPVIAEVVRAAFVGHPDEVALFVERIRASEHFVPELAWVAE |
| Ga0310906_102360733 | 3300032013 | Soil | MAEGVVIRPEREADHPVIAEVVRAAFVGHPDEVASFVERI |
| Ga0307415_1011839842 | 3300032126 | Rhizosphere | MPQLRSSPVAEGVVIRPERDADHPVIAEVVRAAFVGHPDEVASFV |
| ⦗Top⦘ |