Metagenome / Metatranscriptome Family F050351

Basic Information
Family ID	F050351
Family Type	Metagenome / Metatranscriptome
Number of Sequences	145
Average Sequence Length	38 residues
Representative Sequence	MSALPLAALSGADLFGLIVSALVCVYLVYALLRGENL
Number of Associated Samples	122
Number of Associated Scaffolds	145

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	37.24 %
% of genes near scaffold ends (potentially truncated)	2.76 %
% of genes from short scaffolds (< 2000 bps)	64.83 %
Associated GOLD sequencing projects	105
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.51

Most Common Taxonomy
Group	Bacteria (58.621 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.172 % of family members)
Environment Ontology (ENVO)	Unclassified (55.862 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (51.034 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 43.08% β-sheet: 0.00% Coil/Unstructured: 56.92%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 145 Family Scaffolds
PF03814	KdpA	44.14
PF09604	Potass_KdpF	13.10
PF00486	Trans_reg_C	12.41
PF00122	E1-E2_ATPase	2.07
PF02669	KdpC	2.07
PF02518	HATPase_c	2.07
PF01544	CorA	2.07
PF12840	HTH_20	1.38
PF00702	Hydrolase	1.38
PF10011	DUF2254	1.38
PF13493	DUF4118	1.38
PF00912	Transgly	1.38
PF00561	Abhydrolase_1	0.69
PF02702	KdpD	0.69
PF13473	Cupredoxin_1	0.69
PF04116	FA_hydroxylase	0.69
PF02353	CMAS	0.69
PF12849	PBP_like_2	0.69
PF01638	HxlR	0.69
PF13344	Hydrolase_6	0.69
PF01850	PIN	0.69
PF00005	ABC_tran	0.69
PF02673	BacA	0.69
PF04860	Phage_portal	0.69
PF07228	SpoIIE	0.69
PF13462	Thioredoxin_4	0.69
PF01979	Amidohydro_1	0.69
PF04299	FMN_bind_2	0.69
PF10590	PNP_phzG_C	0.69
PF02649	GCHY-1	0.69
PF12847	Methyltransf_18	0.69

COG ID	Name	Functional Category	% Frequency in 145 Family Scaffolds
COG2060	K+-transporting ATPase, KdpA subunit	Inorganic ion transport and metabolism [P]	44.14
COG0598	Mg2+ and Co2+ transporter CorA	Inorganic ion transport and metabolism [P]	2.07
COG0474	Magnesium-transporting ATPase (P-type)	Inorganic ion transport and metabolism [P]	2.07
COG2217	Cation-transporting P-type ATPase	Inorganic ion transport and metabolism [P]	2.07
COG2216	K+ transport ATPase, ATPase subunit KdpB	Inorganic ion transport and metabolism [P]	2.07
COG2156	K+-transporting ATPase, KdpC subunit	Inorganic ion transport and metabolism [P]	2.07
COG5009	Membrane carboxypeptidase/penicillin-binding protein	Cell wall/membrane/envelope biogenesis [M]	1.38
COG4953	Membrane carboxypeptidase/penicillin-binding protein PbpC	Cell wall/membrane/envelope biogenesis [M]	1.38
COG0744	Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase	Cell wall/membrane/envelope biogenesis [M]	1.38
COG2205	K+-sensing histidine kinase KdpD	Signal transduction mechanisms [T]	0.69
COG1968	Undecaprenyl pyrophosphate phosphatase	Lipid transport and metabolism [I]	0.69
COG1733	DNA-binding transcriptional regulator, HxlR family	Transcription [K]	0.69
COG2226	Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG	Coenzyme transport and metabolism [H]	0.69
COG2227	2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase	Coenzyme transport and metabolism [H]	0.69
COG2230	Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases	Lipid transport and metabolism [I]	0.69
COG3000	Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily	Lipid transport and metabolism [I]	0.69
COG1469	GTP cyclohydrolase FolE2	Coenzyme transport and metabolism [H]	0.69

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	58.62 %
Unclassified	root	N/A	41.38 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	58.62 %
Unclassified	root	N/A	41.38 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	58.62 %
Unclassified	root	N/A	41.38 %

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	55.17 %
Unclassified	root	N/A	41.38 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.07 %

Name	Rank	Taxonomy	Distribution
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	55.17 %
Unclassified	root	N/A	41.38 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1.38 %

Name	Rank	Taxonomy	Distribution
Thermoleophilia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	48.28 %
Unclassified	root	N/A	41.38 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	2.07 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1.38 %

Name	Rank	Taxonomy	Distribution
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	44.83 %
Unclassified	root	N/A	41.38 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	1.38 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	1.38 %
Streptomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.38 %
Patulibacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae	11.03 %
Conexibacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae	4.83 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1.38 %
unclassified Solirubrobacterales	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales	1.38 %
Solirubrobacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae	1.38 %
Rhizobium/Agrobacterium group	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group	1.38 %
Streptomycetaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.38 %
Patulibacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter	11.03 %
Conexibacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter	4.83 %
Rhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium	1.38 %
Solirubrobacterales bacterium URHD0059	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059	1.38 %
Solirubrobacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter	1.38 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1.38 %
Streptomyces	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.38 %
unclassified Patulibacter	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter	11.03 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	4.83 %
Rhizobium freirei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei	1.38 %
Solirubrobacterales bacterium URHD0059	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059	1.38 %
Solirubrobacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter	1.38 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1.38 %
unclassified Streptomyces	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	41.38 %
Patulibacter sp. SYSU D01012	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012	11.03 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	4.83 %
Rhizobium freirei PRF 81	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 81	1.38 %
Solirubrobacterales bacterium URHD0059	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059	1.38 %
Solirubrobacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter	1.38 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1.38 %
Streptomyces sp. Ncost-T10-10d	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. Ncost-T10-10d	0.69 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000532\|CNAas_1018466	Not Available	504	Open in IMG/M
3300001213\|JGIcombinedJ13530_101434909	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012	724	Open in IMG/M
3300001867\|JGI12627J18819_10220671	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	764	Open in IMG/M
3300003659\|JGI25404J52841_10136696	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	519	Open in IMG/M
3300005329\|Ga0070683_100031782	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	4803	Open in IMG/M
3300005335\|Ga0070666_10016717	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	4696	Open in IMG/M
3300005336\|Ga0070680_101144690	Not Available	673	Open in IMG/M
3300005367\|Ga0070667_101231557	Not Available	701	Open in IMG/M
3300005455\|Ga0070663_100002250	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	10810	Open in IMG/M
3300005530\|Ga0070679_101773316	Not Available	566	Open in IMG/M
3300005548\|Ga0070665_100066184	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	3625	Open in IMG/M
3300005548\|Ga0070665_100194627	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059	2028	Open in IMG/M
3300005548\|Ga0070665_100213473	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1931	Open in IMG/M
3300005563\|Ga0068855_100652675	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1130	Open in IMG/M
3300005614\|Ga0068856_100046728	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter	4263	Open in IMG/M
3300005617\|Ga0068859_100245568	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1880	Open in IMG/M
3300005617\|Ga0068859_102408992	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	580	Open in IMG/M
3300005841\|Ga0068863_100000004	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	272478	Open in IMG/M
3300005842\|Ga0068858_100000033	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	142748	Open in IMG/M
3300005843\|Ga0068860_100007463	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	10936	Open in IMG/M
3300005886\|Ga0075286_1032710	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	691	Open in IMG/M
3300005887\|Ga0075292_1041933	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	649	Open in IMG/M
3300005937\|Ga0081455_10007601	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	11393	Open in IMG/M
3300005937\|Ga0081455_10101240	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059	2312	Open in IMG/M
3300005983\|Ga0081540_1229085	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	657	Open in IMG/M
3300006578\|Ga0074059_11460953	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1336	Open in IMG/M
3300006580\|Ga0074049_12485839	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	652	Open in IMG/M
3300006604\|Ga0074060_11417386	Not Available	889	Open in IMG/M
3300006642\|Ga0075521_10693303	Not Available	503	Open in IMG/M
3300006881\|Ga0068865_101050671	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter	715	Open in IMG/M
3300007822\|Ga0104325_110622	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012	1204	Open in IMG/M
3300009093\|Ga0105240_10596815	Not Available	1216	Open in IMG/M
3300009098\|Ga0105245_10015680	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	6606	Open in IMG/M
3300009101\|Ga0105247_10001113	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	20027	Open in IMG/M
3300009101\|Ga0105247_10490186	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012	893	Open in IMG/M
3300009148\|Ga0105243_12061355	Not Available	606	Open in IMG/M
3300009148\|Ga0105243_13102855	Not Available	503	Open in IMG/M
3300009174\|Ga0105241_10569126	Not Available	1020	Open in IMG/M
3300009176\|Ga0105242_10000430	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	33469	Open in IMG/M
3300009551\|Ga0105238_10000023	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	196844	Open in IMG/M
3300009551\|Ga0105238_12764217	Not Available	527	Open in IMG/M
3300009553\|Ga0105249_10128588	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2415	Open in IMG/M
3300009553\|Ga0105249_11364861	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012	781	Open in IMG/M
3300010037\|Ga0126304_10043799	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	2693	Open in IMG/M
3300010159\|Ga0099796_10289026	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	692	Open in IMG/M
3300010371\|Ga0134125_10001548	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	28084	Open in IMG/M
3300010371\|Ga0134125_11474194	Not Available	741	Open in IMG/M
3300012070\|Ga0153963_1005393	Not Available	2628	Open in IMG/M
3300012090\|Ga0153956_1004957	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	7457	Open in IMG/M
3300012915\|Ga0157302_10044150	Not Available	1234	Open in IMG/M
3300012929\|Ga0137404_10701920	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012	915	Open in IMG/M
3300012942\|Ga0164242_10002654	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	20683	Open in IMG/M
3300012943\|Ga0164241_10109518	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012	1982	Open in IMG/M
3300012955\|Ga0164298_10003714	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	5221	Open in IMG/M
3300012955\|Ga0164298_10725917	Not Available	701	Open in IMG/M
3300012960\|Ga0164301_10000365	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	13029	Open in IMG/M
3300012960\|Ga0164301_10108745	Not Available	1610	Open in IMG/M
3300012984\|Ga0164309_10794831	Not Available	761	Open in IMG/M
3300012984\|Ga0164309_11223216	Not Available	631	Open in IMG/M
3300012988\|Ga0164306_10196851	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 81	1411	Open in IMG/M
3300013104\|Ga0157370_10014625	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	8019	Open in IMG/M
3300013306\|Ga0163162_10868293	Not Available	1017	Open in IMG/M
3300013308\|Ga0157375_10000109	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	80349	Open in IMG/M
3300013308\|Ga0157375_10782177	Not Available	1104	Open in IMG/M
3300013308\|Ga0157375_13359067	Not Available	533	Open in IMG/M
3300013503\|Ga0120127_10001129	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	4478	Open in IMG/M
3300014263\|Ga0075324_1031314	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012	979	Open in IMG/M
3300014301\|Ga0075323_1058713	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012	765	Open in IMG/M
3300014311\|Ga0075322_1211230	Not Available	501	Open in IMG/M
3300014314\|Ga0075316_1121240	Not Available	639	Open in IMG/M
3300014323\|Ga0075356_1005108	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	2094	Open in IMG/M
3300014502\|Ga0182021_10231848	Not Available	2161	Open in IMG/M
3300014745\|Ga0157377_10690591	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012	740	Open in IMG/M
3300015168\|Ga0167631_1055808	All Organisms → cellular organisms → Bacteria → Proteobacteria	648	Open in IMG/M
3300015371\|Ga0132258_10998093	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2115	Open in IMG/M
3300017792\|Ga0163161_10000013	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	258747	Open in IMG/M
3300017792\|Ga0163161_10104649	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	2110	Open in IMG/M
3300017792\|Ga0163161_10182473	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	1610	Open in IMG/M
3300017792\|Ga0163161_10419969	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012	1076	Open in IMG/M
3300017966\|Ga0187776_10046200	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2466	Open in IMG/M
3300018476\|Ga0190274_10000661	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	20196	Open in IMG/M
3300019871\|Ga0193702_1028413	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012	716	Open in IMG/M
3300020021\|Ga0193726_1251391	Not Available	716	Open in IMG/M
3300020021\|Ga0193726_1257779	Not Available	702	Open in IMG/M
3300020027\|Ga0193752_1206146	Not Available	743	Open in IMG/M
3300020034\|Ga0193753_10094769	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1499	Open in IMG/M
3300020060\|Ga0193717_1132289	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012	754	Open in IMG/M
3300021363\|Ga0193699_10004904	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	4838	Open in IMG/M
3300021377\|Ga0213874_10044732	Not Available	1338	Open in IMG/M
3300021404\|Ga0210389_10613017	Not Available	855	Open in IMG/M
3300021418\|Ga0193695_1000023	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	38800	Open in IMG/M
3300021560\|Ga0126371_13703167	All Organisms → cellular organisms → Bacteria	515	Open in IMG/M
3300022898\|Ga0247745_1027006	Not Available	843	Open in IMG/M
3300023070\|Ga0247755_1113956	Not Available	578	Open in IMG/M
3300025505\|Ga0207929_1006264	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 81	2335	Open in IMG/M
3300025792\|Ga0210143_1092017	All Organisms → cellular organisms → Bacteria	556	Open in IMG/M
3300025900\|Ga0207710_10000154	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	73881	Open in IMG/M
3300025900\|Ga0207710_10641014	Not Available	556	Open in IMG/M
3300025900\|Ga0207710_10644274	Not Available	555	Open in IMG/M
3300025903\|Ga0207680_10004244	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	6785	Open in IMG/M
3300025909\|Ga0207705_10204379	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1497	Open in IMG/M
3300025911\|Ga0207654_10944635	Not Available	626	Open in IMG/M
3300025912\|Ga0207707_10141603	Not Available	2103	Open in IMG/M
3300025913\|Ga0207695_10428558	Not Available	1206	Open in IMG/M
3300025915\|Ga0207693_10940438	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	662	Open in IMG/M
3300025917\|Ga0207660_10541292	Not Available	947	Open in IMG/M
3300025920\|Ga0207649_10555767	Not Available	879	Open in IMG/M
3300025924\|Ga0207694_10000004	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	967075	Open in IMG/M
3300025927\|Ga0207687_10004229	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	9596	Open in IMG/M
3300025928\|Ga0207700_11628449	Not Available	571	Open in IMG/M
3300025938\|Ga0207704_10753392	Not Available	810	Open in IMG/M
3300025938\|Ga0207704_11485634	Not Available	581	Open in IMG/M
3300025944\|Ga0207661_10001795	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	14672	Open in IMG/M
3300025949\|Ga0207667_10689145	Not Available	1025	Open in IMG/M
3300025961\|Ga0207712_10291139	Not Available	1336	Open in IMG/M
3300025961\|Ga0207712_10308193	Not Available	1302	Open in IMG/M
3300026035\|Ga0207703_10000577	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	37419	Open in IMG/M
3300026041\|Ga0207639_10010610	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	6381	Open in IMG/M
3300026088\|Ga0207641_10000170	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	91128	Open in IMG/M
3300026911\|Ga0209620_1022615	Not Available	564	Open in IMG/M
3300027002\|Ga0209110_1003718	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012	1572	Open in IMG/M
3300027504\|Ga0209114_1057074	Not Available	691	Open in IMG/M
3300027517\|Ga0209113_1016431	Not Available	963	Open in IMG/M
3300027524\|Ga0208998_1023562	Not Available	972	Open in IMG/M
3300027574\|Ga0208982_1098909	Not Available	593	Open in IMG/M
3300027815\|Ga0209726_10304948	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012	776	Open in IMG/M
3300027817\|Ga0209112_10203639	Not Available	681	Open in IMG/M
3300027895\|Ga0209624_10020575	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	4177	Open in IMG/M
3300028379\|Ga0268266_10143654	Not Available	2143	Open in IMG/M
3300028381\|Ga0268264_11930872	Not Available	600	Open in IMG/M
3300028556\|Ga0265337_1000074	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	46897	Open in IMG/M
3300028790\|Ga0307283_10159138	Not Available	627	Open in IMG/M
3300028802\|Ga0307503_10000027	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	137045	Open in IMG/M
3300030336\|Ga0247826_11072722	Not Available	642	Open in IMG/M
3300031003\|Ga0074003_13505997	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012	1083	Open in IMG/M
3300031170\|Ga0307498_10443603	Not Available	519	Open in IMG/M
3300031525\|Ga0302326_11917724	Not Available	770	Open in IMG/M
3300031715\|Ga0307476_10002146	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	11798	Open in IMG/M
3300031740\|Ga0307468_101365090	Not Available	649	Open in IMG/M
3300032261\|Ga0306920_103233096	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. Ncost-T10-10d	609	Open in IMG/M
3300032770\|Ga0335085_10367805	Not Available	1680	Open in IMG/M
3300032829\|Ga0335070_10000184	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	71249	Open in IMG/M
3300032829\|Ga0335070_10497871	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012	1155	Open in IMG/M
3300032954\|Ga0335083_10671995	Not Available	844	Open in IMG/M
3300034268\|Ga0372943_0277517	Not Available	1059	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	54.48%
Host-Associated	Host-Associated	45.52%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	52.41%
Plants	Host-Associated → Plants	44.14%
Aquatic	Environmental → Aquatic	2.07%
Fungi	Host-Associated → Fungi	1.38%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	51.03%
Rhizosphere	Host-Associated → Plants → Rhizosphere	25.52%
Rhizoplane	Host-Associated → Plants → Rhizoplane	17.93%
Marine	Environmental → Aquatic → Marine	1.38%
Mycelium	Host-Associated → Fungi → Mycelium	1.38%
Freshwater	Environmental → Aquatic → Freshwater	0.69%
Peat	Environmental → Terrestrial → Peat	0.69%
Plant Litter	Environmental → Terrestrial → Plant Litter	0.69%
Roots	Host-Associated → Plants → Roots	0.69%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	30.34%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	17.93%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	16.55%
Loam	Environmental → Terrestrial → Soil → Loam	11.72%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	8.97%
Soil	Host-Associated → Plants → Rhizosphere → Soil	7.59%
Wetlands	Environmental → Aquatic → Marine → Wetlands	1.38%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.38%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified	1.38%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.69%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.69%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified	0.69%
Unclassified	Host-Associated → Plants → Roots → Unclassified	0.69%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	22.76%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	17.93%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	16.55%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	8.28%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	7.59%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	6.21%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.52%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	4.14%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	2.07%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.38%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified	1.38%
Contaminated	Environmental → Aquatic → Freshwater → Groundwater → Contaminated	0.69%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.69%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	0.69%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.69%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.69%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.69%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.69%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified	0.69%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	0.69%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	15.17%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	6.21%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	6.21%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	5.52%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	4.83%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	4.83%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	4.14%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	3.45%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	3.45%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.45%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	2.76%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	2.76%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	2.76%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.76%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.07%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.07%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.07%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	2.07%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	1.38%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.38%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	1.38%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.38%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	1.38%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.38%
Attine Ant Fungus Gardens	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens	1.38%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater	0.69%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.69%
Wetland	Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland	0.69%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.69%
Compost	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost	0.69%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.69%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.69%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.69%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	0.69%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.69%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.69%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.69%
Fen	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen	0.69%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	0.69%
Plant Litter	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter	0.69%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.69%
Quercus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere	0.69%
Plant Roots	Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots	0.69%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.69%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.69%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000532	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled	Host-Associated	Open in IMG/M
3300001213	Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)	Environmental	Open in IMG/M
3300001867	Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)	Environmental	Open in IMG/M
3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Host-Associated	Open in IMG/M
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental	Open in IMG/M
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Host-Associated	Open in IMG/M
3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Environmental	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300005886	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205	Environmental	Open in IMG/M
3300005887	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403	Environmental	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Host-Associated	Open in IMG/M
3300006578	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006580	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006604	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006642	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D	Environmental	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300007822	Permafrost core soil microbial communities from Svalbard, Norway - sample 2-8-2 Soapdenovo	Environmental	Open in IMG/M
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300010037	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25	Environmental	Open in IMG/M
3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300012070	Attine ant fungus gardens microbial communities from Florida, USA - TSFL047 MetaG	Host-Associated	Open in IMG/M
3300012090	Attine ant fungus gardens microbial communities from Florida, USA - TSFL040 MetaG	Host-Associated	Open in IMG/M
3300012915	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012942	Miracle-Growth compost microbial communities from Emeryville, California, USA - Original compost - Miracle growth compost (MG)	Environmental	Open in IMG/M
3300012943	Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental	Open in IMG/M
3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300013503	Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M	Environmental	Open in IMG/M
3300014263	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1	Environmental	Open in IMG/M
3300014301	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1	Environmental	Open in IMG/M
3300014311	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1	Environmental	Open in IMG/M
3300014314	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2	Environmental	Open in IMG/M
3300014323	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1	Environmental	Open in IMG/M
3300014502	Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015168	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300017966	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300019871	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a1	Environmental	Open in IMG/M
3300020021	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1	Environmental	Open in IMG/M
3300020027	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c1	Environmental	Open in IMG/M
3300020034	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2	Environmental	Open in IMG/M
3300020060	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2	Environmental	Open in IMG/M
3300021363	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2	Environmental	Open in IMG/M
3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Host-Associated	Open in IMG/M
3300021404	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O	Environmental	Open in IMG/M
3300021418	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300022898	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5	Environmental	Open in IMG/M
3300023070	Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L096-311B-4	Environmental	Open in IMG/M
3300025505	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes)	Environmental	Open in IMG/M
3300025792	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes)	Environmental	Open in IMG/M
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026911	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O1 (SPAdes)	Environmental	Open in IMG/M
3300027002	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O1 (SPAdes)	Environmental	Open in IMG/M
3300027504	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O3 (SPAdes)	Environmental	Open in IMG/M
3300027517	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O1 (SPAdes)	Environmental	Open in IMG/M
3300027524	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M2 (SPAdes)	Environmental	Open in IMG/M
3300027574	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O3 (SPAdes)	Environmental	Open in IMG/M
3300027815	Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)	Environmental	Open in IMG/M
3300027817	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes)	Environmental	Open in IMG/M
3300027895	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)	Environmental	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Host-Associated	Open in IMG/M
3300028790	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122	Environmental	Open in IMG/M
3300028802	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S	Environmental	Open in IMG/M
3300030336	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1	Environmental	Open in IMG/M
3300031003	Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter GP-3A (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031170	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S	Environmental	Open in IMG/M
3300031525	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3	Environmental	Open in IMG/M
3300031715	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental	Open in IMG/M
3300032829	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3	Environmental	Open in IMG/M
3300032954	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2	Environmental	Open in IMG/M
3300034268	Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.51
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.51
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F050351

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
CNAas_10184662	3300000532	Quercus Rhizosphere	MTLTVAALTVSDVLGLVVSALVCVYLVYALLRGENL*
JGIcombinedJ13530_1014349091	3300001213	Wetland	MSVLPFAALSGADIFGLIASALVFAYLCYALLRGEKL*
JGI12627J18819_102206712	3300001867	Forest Soil	MTNALITPVASLSGADIFGIIASFIVCVYLVYALLRGENL*
JGI25404J52841_101366961	3300003659	Tabebuia Heterophylla Rhizosphere	MSAAILMPVAALSGADIFGIVASLLVCIYLVYALLRGENL*
Ga0070683_1000317824	3300005329	Corn Rhizosphere	MSDVFGAAIAPLAALSPADVFGLVAAFAVCIYLVYALLRGESL*
Ga0070666_100167172	3300005335	Switchgrass Rhizosphere	MSGAIAPFAALTGADVFGLVAALVVCVFLFYALLRGENL*
Ga0070680_1011446902	3300005336	Corn Rhizosphere	RPDMSDVLGAAIAPVAALGPADVFGLVAAFVVCAFLFYALLRGENL*
Ga0070667_1012315572	3300005367	Switchgrass Rhizosphere	MSDAILTPVAALSGADIFGIVASLLVCVYLVYALLRGENL*
Ga0070663_1000022504	3300005455	Corn Rhizosphere	MSDVFGAAIAPLAALSPADVFGLVAAFAVCIYLVYALLRGENL*
Ga0070679_1017733161	3300005530	Corn Rhizosphere	MSDVLGAAIAPVAALGPADVFGLVAAFVVCAFLFYALLRGENL*
Ga0070665_1000661844	3300005548	Switchgrass Rhizosphere	MSLPLASLTGADVFGLLVSALVAAYLLYALLRGENL*
Ga0070665_1001946272	3300005548	Switchgrass Rhizosphere	MSGAIAPFAALGAADVFGLVAALVVCVFLFYALLRGENL*
Ga0070665_1002134732	3300005548	Switchgrass Rhizosphere	MSDAILTPVAALSGADIFGIVASLLVCIYLVYALLRGEKL*
Ga0068855_1006526752	3300005563	Corn Rhizosphere	MSLLPLASLSGADLFGLVVSALVCVYLIYALLRGENL*
Ga0068856_1000467282	3300005614	Corn Rhizosphere	MSQLPLASLSAADLLGLVVSALVCAYLLYALLRGENL*
Ga0068859_1002455684	3300005617	Switchgrass Rhizosphere	MSPVLATLGAADAIGLLVAAAVGAFLLYALLRGENL*
Ga0068859_1024089922	3300005617	Switchgrass Rhizosphere	MSAAILTPVAALSGADIFGIVASLLVCIYLVYALLRGENL*
Ga0068863_100000004160	3300005841	Switchgrass Rhizosphere	MSALPFAALGGADLFGLIVSALVCVYLVYALLRGENL*
Ga0068858_10000003340	3300005842	Switchgrass Rhizosphere	MSALPLASLSAADLFGLVVSALVCVYLVYALLRGENL*
Ga0068860_1000074634	3300005843	Switchgrass Rhizosphere	MSLAAISAADVFGLIVSALIFLYLCYALLRGEKL*
Ga0075286_10327102	3300005886	Rice Paddy Soil	MSAVVLATLSGADVFGLIASALVFVYLCYALLRGEKL*
Ga0075292_10419332	3300005887	Rice Paddy Soil	MSPLPAAALGGADLFGLAVSLAVALYLLYALLRGESL*
Ga0081455_100076016	3300005937	Tabebuia Heterophylla Rhizosphere	MSGALPLAALTGADVFGLVAALAVCVYLVYALLRGENL*
Ga0081455_101012404	3300005937	Tabebuia Heterophylla Rhizosphere	MSAAILTPVAALSGADVFGIVASLLVCIYLVYALLRGENL*
Ga0081540_12290852	3300005983	Tabebuia Heterophylla Rhizosphere	VPLAALTGADVFGLLASALVCVYLVYALLRGEKL*
Ga0074059_114609532	3300006578	Soil	MSVLPLASLSGADLFGLVVSALVCVYLVYALLRGENL*
Ga0074049_124858392	3300006580	Soil	MSLPLAGLSAADAFGLVVAAAVCAFLVYALLRGENL*
Ga0074060_114173863	3300006604	Soil	MSAPFPTAAFSVADGFGLVVAALVCAFLVYALLRGENL*
Ga0075521_106933031	3300006642	Arctic Peat Soil	MSPVLATLSAADVIGLAVAAAVCAFLLFALLRGENL*
Ga0068865_1010506711	3300006881	Miscanthus Rhizosphere	MSTVPLAALSGADLFGLIVSALVCVYLVYALLRGENL*
Ga0104325_1106223	3300007822	Soil	MSAVPLATLTGADLFGLIVSALVCIYLVYALLRGENL*
Ga0105240_105968153	3300009093	Corn Rhizosphere	MSAPLATLGAADGLGLLVAACVCAFLLYALLRGENL*
Ga0105245_100156806	3300009098	Miscanthus Rhizosphere	MSVLPFASFSGADLFGLIVSALVCVYLVYALLRGENL*
Ga0105247_1000111323	3300009101	Switchgrass Rhizosphere	MTLTLATLSGADAFGLVVSALVCVYLVFALLRGENL*
Ga0105247_104901861	3300009101	Switchgrass Rhizosphere	MSDAILTPVAALSGADIFGIVASLLVCIYLVYALLRGENL*
Ga0105243_120613552	3300009148	Miscanthus Rhizosphere	AGPHMRAALPVAALTGSDVFGLFVSSLVCVYLVYLLHCGENL*
Ga0105243_131028552	3300009148	Miscanthus Rhizosphere	MSVLPLASFSGADLFGLIVSALVCIYLVYALLRGENL*
Ga0105241_105691262	3300009174	Corn Rhizosphere	MSLPLAALSAADVFGLVASAAVAAYLLYALLRGENL*
Ga0105242_1000043022	3300009176	Miscanthus Rhizosphere	MSAPLATLTAADVIGLLVAAAVCAFLVYALLRGENL*
Ga0105238_1000002386	3300009551	Corn Rhizosphere	MSVLPLASLTGADVFGLVAAALVFGYLLYALLRGENL*
Ga0105238_127642172	3300009551	Corn Rhizosphere	MSPTLPLAALTGADVLGLIVSFFVCVYLVYALLRGENL*
Ga0105249_101285882	3300009553	Switchgrass Rhizosphere	MSGLPLASLSGADLFGLIVSALVCVYLVYALLRGENL*
Ga0105249_113648613	3300009553	Switchgrass Rhizosphere	MSAAILTPVAALSGADIFGLVASFLVCVYLIYALLRGENL*
Ga0126304_100437992	3300010037	Serpentine Soil	MSELPLASLGGADLLGLAAAALVFSYLLYALLRGENL*
Ga0099796_102890261	3300010159	Vadose Zone Soil	MSAAMLVAPLAAITGADVFGLVISALVVIYLVYALLRGENL*
Ga0134125_1000154821	3300010371	Terrestrial Soil	MSTAVLTPVATLSGADIFGLVASFVVCVYLLYALLRGENL*
Ga0134125_114741942	3300010371	Terrestrial Soil	MSVAVQLAALGGADVFGLVVSFLVCLYLVYALLRGENL*
Ga0153963_10053934	3300012070	Attine Ant Fungus Gardens	MSVPLATVSVADVFGLVVSALVCAYLVYALLRGENL*
Ga0153956_10049573	3300012090	Attine Ant Fungus Gardens	MSVPLAAFGAADVFGLLVALVVCLYLLYALLRGENL*
Ga0157302_100441503	3300012915	Soil	MSDVALATLSVADVFGLAASAVVVVYLVYALLRGEKL*
Ga0137404_107019203	3300012929	Vadose Zone Soil	MSALPLAAFSVADLFGLVVSALVCVYLVYALLRGENL*
Ga0164242_100026548	3300012942	Compost	MTTALLTPVAALSGADVFGLVISFIVCVYLVYALLRGENL*
Ga0164241_101095183	3300012943	Soil	MVLALPTAAFTGADLFGLVAALLVCVYLVYALVRGENL*
Ga0164298_100037144	3300012955	Soil	MSGVVLAALNGADVFGLAASGIVVIYLLYALLRGEKL*
Ga0164298_107259172	3300012955	Soil	MSALPVAALSGADVFGLIASALVFAYLVYALLRGENL*
Ga0164301_1000036510	3300012960	Soil	MSLPLAALSGADVFGLAVSAVVALYLLYALLRGENL*
Ga0164301_101087452	3300012960	Soil	MSAIALAALSGADVFGLTASALICVYLVYALLRGEKL*
Ga0164309_107948312	3300012984	Soil	MSLPLASLTAADVFGLLVSAVVAAYLLYALLRGENL*
Ga0164309_112232162	3300012984	Soil	MSALPLASLSGADLFGLVVSALVCVYLVYALLRGENL*
Ga0164306_101968512	3300012988	Soil	MSVLPIAALGGADLFGLIVSALVCVYLVYALLRGENL*
Ga0157370_100146254	3300013104	Corn Rhizosphere	MPLAALSGTDVFGLVASAAVCVYLVYALLRGENL*
Ga0163162_108682932	3300013306	Switchgrass Rhizosphere	MSVPVAGIGAADLFGLLAAAAVCVYLVYALLRGENL*
Ga0157375_1000010943	3300013308	Miscanthus Rhizosphere	MSALPLASLSGADLFGLVVSALVCVYLVYALLRGESL*
Ga0157375_107821772	3300013308	Miscanthus Rhizosphere	MSELPLASLSGADLFGLIVSGLVCVYLVYALLRGENL*
Ga0157375_133590672	3300013308	Miscanthus Rhizosphere	MSALPLAAFTGADLFGLAVAALVCAYLVYALLRGENL*
Ga0120127_100011294	3300013503	Permafrost	MSALPLAALSGADLFGLIVSALVCVYLVYALLRGENL*
Ga0075324_10313143	3300014263	Natural And Restored Wetlands	MSAIVLATLSGADIFGLVASALVFVYLCYALLRGEKL*
Ga0075323_10587132	3300014301	Natural And Restored Wetlands	MSTLPVAALSGADVFGLVVSSLVAAYLLYALLRGEDL*
Ga0075322_12112302	3300014311	Natural And Restored Wetlands	MSALPLAALSGADVFGLVASALVFVYLCYALLRGERL*
Ga0075316_11212402	3300014314	Natural And Restored Wetlands	MSELSLAALSGADVFGLVASALVFVYLLYALLRGESL*
Ga0075356_10051084	3300014323	Natural And Restored Wetlands	MNEIALATLSGADVFGLVASGIVAAYLLYALLRGEKL*
Ga0182021_102318484	3300014502	Fen	MSVLPLASFSGADLFGLIVSALVCVYLVYALLRGENL*
Ga0157377_106905912	3300014745	Miscanthus Rhizosphere	MSAPLATLTAADGLGLLVAACVCAFLLYALLRGENL*
Ga0167631_10558083	3300015168	Glacier Forefield Soil	MSSLPLATLSGADLFGLIVSALVCVYLVYALLRGENL*
Ga0132258_109980933	3300015371	Arabidopsis Rhizosphere	MSVLPLASLTGADVFGLIASGIVVVYLLYALLRGEKL*
Ga0163161_1000001345	3300017792	Switchgrass Rhizosphere	MSEVVLATLSGADVFGLVASALVVAYLLYALLRGEKL
Ga0163161_101046494	3300017792	Switchgrass Rhizosphere	MTLTLATLSGADLFGLVVSALVCVYLIYALLRGENL
Ga0163161_101824732	3300017792	Switchgrass Rhizosphere	MSALPLAALGGADLFGLIASALICVYLVYALLRGEKL
Ga0163161_104199692	3300017792	Switchgrass Rhizosphere	MSAPLASIGGADLFGLLAAAAVCVYLVYALLRGENL
Ga0187776_100462002	3300017966	Tropical Peatland	MSELPFAALSGADVFGLIASALVFVYLCYALLRGEKL
Ga0190274_100006618	3300018476	Soil	MSALPLAAFTGADFFGLVVSALVCAYLIYALLRGENL
Ga0193702_10284132	3300019871	Soil	MSAALLTPLAALSGADIFGLVASFIVCVYLVYALLRGEKL
Ga0193726_12513912	3300020021	Soil	GLPLAMLSGADLFGLVVSALVCIYLVYALLRGENL
Ga0193726_12577792	3300020021	Soil	MSAVVLAPLAAITGADVFGLVISALVCLYLIYALLRGENL
Ga0193752_12061462	3300020027	Soil	MTPLLAAISGADLFGLVASALVCVYLVYALLRGEKL
Ga0193753_100947692	3300020034	Soil	MTSLIATPLAALSGADVFGLIISFLVCVYLVYALLRGENL
Ga0193717_11322892	3300020060	Soil	MTSLIATPLAALSGADVFGLIVSFLVCVYLVYALLRGENL
Ga0193699_100049045	3300021363	Soil	MSLALASLTGADVFGLLVSAAIAAYLLYALLRGENL
Ga0213874_100447322	3300021377	Plant Roots	MTLVVASISGADLFGLIASFLVCLYLLYALLRGEKF
Ga0210389_106130172	3300021404	Soil	MTNALITPVAALSGADVFGLIISFIVCVYLVYALLRGENL
Ga0193695_100002340	3300021418	Soil	MSGLPLAALSGADLFGLVVSALVCAYLVYALLRGENL
Ga0126371_137031672	3300021560	Tropical Forest Soil	MTLILASIGGADLFGLIASAIVCVYLLYALLRGEKS
Ga0247745_10270063	3300022898	Soil	MSLPLASLGGADVFGLLVSAAAAAYLLYALLRGENL
Ga0247755_11139562	3300023070	Plant Litter	MSLPLAALSVADALGLLVAFAVCAFLLYALLRGENL
Ga0207929_10062642	3300025505	Arctic Peat Soil	MSLALATLTVADALGLLVAALVCAFLVYALLRGENL
Ga0210143_10920172	3300025792	Natural And Restored Wetlands	MSAVVLATLSGADVFGLIASALVFVYLCYALLRGEKL
Ga0207710_1000015436	3300025900	Switchgrass Rhizosphere	MTLTLATLSGADAFGLVVSALVCVYLVFALLRGENL
Ga0207710_106410142	3300025900	Switchgrass Rhizosphere	MSAAILTPVAALSGADIFGIVASLLVCVYLVYALLRGENL
Ga0207710_106442742	3300025900	Switchgrass Rhizosphere	MSPVLATLGAADAIGLLVAAAVGAFLLYALLRGENL
Ga0207680_100042446	3300025903	Switchgrass Rhizosphere	MSGAIAPFAALTGADVFGLVAALVVCVFLFYALLRGENL
Ga0207705_102043794	3300025909	Corn Rhizosphere	MSLALASLTVADVFGLLVSGVVAAYLLYALLRGENL
Ga0207654_109446352	3300025911	Corn Rhizosphere	RADRPDMSLPLAALSAADVFGLVASAAVAAYLLYALLRGENL
Ga0207707_101416034	3300025912	Corn Rhizosphere	MSALRLASLSGADLFGLVVSALVCIYLIYALLRGENL
Ga0207695_104285582	3300025913	Corn Rhizosphere	MSAPLATLGAADGLGLLVAACVCAFLLYALLRGENL
Ga0207693_109404381	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	MSALPVAALSGADVFGLIASALVFAYLVYALLRGENL
Ga0207660_105412922	3300025917	Corn Rhizosphere	MSDVFGAAIAPLAALSPADVFGLVAAFAVCIYLVYALLRGENL
Ga0207649_105557672	3300025920	Corn Rhizosphere	MSDVFGAAIAPLAALSPADVFGLVAAFAVCIYLVYALLRGESL
Ga0207694_10000004774	3300025924	Corn Rhizosphere	MSVLPLASLTGADVFGLVAAALVFGYLLYALLRGENL
Ga0207687_100042299	3300025927	Miscanthus Rhizosphere	MSVLPFASFSGADLFGLIVSALVCVYLVYALLRGENL
Ga0207700_116284492	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	MSGLPLASLTGADLFGLIISALVCVYLVYALLRGENL
Ga0207704_107533922	3300025938	Miscanthus Rhizosphere	MSTVPLAALSGADLFGLIVSALVCVYLVYALLRGENL
Ga0207704_114856342	3300025938	Miscanthus Rhizosphere	MSPLLPLATLSGADLFGLIVSAVVCVYLVYALLRGENL
Ga0207661_100017954	3300025944	Corn Rhizosphere	MSVLPVAAFSGADLFGLIVSALVCVYLVYALLRGENL
Ga0207667_106891452	3300025949	Corn Rhizosphere	MSLLPLASLSGADLFGLVVSALVCVYLIYALLRGENL
Ga0207712_102911392	3300025961	Switchgrass Rhizosphere	MSAAILTPVAALSGADIFGLVASFLVCVYLIYALLRGENL
Ga0207712_103081934	3300025961	Switchgrass Rhizosphere	MSGLPLASLSGADLFGLIVSALVCVYLVYALLRGENL
Ga0207703_1000057726	3300026035	Switchgrass Rhizosphere	MSALPLASLSAADLFGLVVSALVCVYLVYALLRGENL
Ga0207639_100106103	3300026041	Corn Rhizosphere	MSQLPLASLSAADLLGLVVSALVCAYLLYALLRGENL
Ga0207641_1000017011	3300026088	Switchgrass Rhizosphere	MSALPFAALGGADLFGLIVSALVCVYLVYALLRGENL
Ga0209620_10226152	3300026911	Forest Soil	MTNALITPIAALSGADVFGLIASFIVCVYLVYALLRGENL
Ga0209110_10037183	3300027002	Forest Soil	MTNALITPVASLSGADIFGIIASFIVCVYLVYALLRGENL
Ga0209114_10570742	3300027504	Forest Soil	MTHALLTPIAALSGADIFGLIASFIVCVYLVYALLRGENL
Ga0209113_10164312	3300027517	Forest Soil	MTHALITPIAALSGADIFGLIASFIVCVYLVYALLRGENL
Ga0208998_10235622	3300027524	Forest Soil	MSVLPLASLSAADLFGLVVSALVCVYLVYALLRGENL
Ga0208982_10989092	3300027574	Forest Soil	MSAVVLAPLAAITGADVFGLIISALVCLYLIYALLRGENL
Ga0209726_103049481	3300027815	Groundwater	MSPVLATLTVADVVGLLVAAAVCVFLLYALLRGENL
Ga0209112_102036392	3300027817	Forest Soil	MTSALVTPLAALSGADVFGLIASFVVCVYLVYALLRGEDL
Ga0209624_100205754	3300027895	Forest Soil	MSLTLATVTGADIFGLVVSSLVCLYLIYALLRGEKL
Ga0268266_101436542	3300028379	Switchgrass Rhizosphere	MSLPLASLTGADVFGLLVSALVAAYLLYALLRGENL
Ga0268264_119308722	3300028381	Switchgrass Rhizosphere	MSDAILTPVAALSGADIFGIVASLLVCVYLVYALLRGENL
Ga0265337_100007434	3300028556	Rhizosphere	MSLPLATLSSADVFGLVVSALVCLYLVYALLRGENL
Ga0307283_101591381	3300028790	Soil	MSALPLASLSVADLFGLVVSALVCVYLVYALLRGENL
Ga0307503_1000002784	3300028802	Soil	MSGAVLATLSGVDVFGLAASVLVVAYLLYALLRGEKL
Ga0247826_110727222	3300030336	Soil	MSGLPIAALSGAGVFGLIASALVFVYLLYALLRGERL
Ga0074003_135059973	3300031003	Soil	MSAAAVVIAPLAALTGADVFGLVICFAICVYLLYALLRGENL
Ga0307498_104436032	3300031170	Soil	MSLLVPATLGGADVFGLVASALVVAYLVYALLRGEKL
Ga0302326_119177242	3300031525	Palsa	MSAVVAPLAAISGADVFGLVVSAIVCLYLLYALLRGEKL
Ga0307476_100021464	3300031715	Hardwood Forest Soil	MSALIAIPFAALSGADVFGLVAAALVCVYLIYALLRGENL
Ga0307468_1013650902	3300031740	Hardwood Forest Soil	MSVPLPLASLTAADVFGLIASAIVAVYLLYALLRGERL
Ga0306920_1032330961	3300032261	Soil	MSLPVASIGGADVFGLIVAVLICAYLLYALLRGESF
Ga0335085_103678053	3300032770	Soil	MSDIALAALSGADVFGLIASVLVFVYLCYALLRGEKL
Ga0335070_1000018433	3300032829	Soil	MSALVPFAALTVADVFGLLVAAVVCAYLLYALLRGENL
Ga0335070_104978712	3300032829	Soil	MSELPFAALSGADIFGLIASALVFVYLCYALLRGEKL
Ga0335083_106719952	3300032954	Soil	MSGALVPFAALTGADVFGLLVALVVCVYLVYALLRGENL
Ga0372943_0277517_173_286	3300034268	Soil	MSELPLASLSGADLFGLVVSALVCVYLVYALLRGENL

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign