| Basic Information | |
|---|---|
| Family ID | F050351 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 145 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MSALPLAALSGADLFGLIVSALVCVYLVYALLRGENL |
| Number of Associated Samples | 122 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 37.24 % |
| % of genes near scaffold ends (potentially truncated) | 2.76 % |
| % of genes from short scaffolds (< 2000 bps) | 64.83 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (58.621 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.172 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.862 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (51.034 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.08% β-sheet: 0.00% Coil/Unstructured: 56.92% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF03814 | KdpA | 44.14 |
| PF09604 | Potass_KdpF | 13.10 |
| PF00486 | Trans_reg_C | 12.41 |
| PF00122 | E1-E2_ATPase | 2.07 |
| PF02669 | KdpC | 2.07 |
| PF02518 | HATPase_c | 2.07 |
| PF01544 | CorA | 2.07 |
| PF12840 | HTH_20 | 1.38 |
| PF00702 | Hydrolase | 1.38 |
| PF10011 | DUF2254 | 1.38 |
| PF13493 | DUF4118 | 1.38 |
| PF00912 | Transgly | 1.38 |
| PF00561 | Abhydrolase_1 | 0.69 |
| PF02702 | KdpD | 0.69 |
| PF13473 | Cupredoxin_1 | 0.69 |
| PF04116 | FA_hydroxylase | 0.69 |
| PF02353 | CMAS | 0.69 |
| PF12849 | PBP_like_2 | 0.69 |
| PF01638 | HxlR | 0.69 |
| PF13344 | Hydrolase_6 | 0.69 |
| PF01850 | PIN | 0.69 |
| PF00005 | ABC_tran | 0.69 |
| PF02673 | BacA | 0.69 |
| PF04860 | Phage_portal | 0.69 |
| PF07228 | SpoIIE | 0.69 |
| PF13462 | Thioredoxin_4 | 0.69 |
| PF01979 | Amidohydro_1 | 0.69 |
| PF04299 | FMN_bind_2 | 0.69 |
| PF10590 | PNP_phzG_C | 0.69 |
| PF02649 | GCHY-1 | 0.69 |
| PF12847 | Methyltransf_18 | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG2060 | K+-transporting ATPase, KdpA subunit | Inorganic ion transport and metabolism [P] | 44.14 |
| COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 2.07 |
| COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 2.07 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 2.07 |
| COG2216 | K+ transport ATPase, ATPase subunit KdpB | Inorganic ion transport and metabolism [P] | 2.07 |
| COG2156 | K+-transporting ATPase, KdpC subunit | Inorganic ion transport and metabolism [P] | 2.07 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 1.38 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 1.38 |
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.38 |
| COG2205 | K+-sensing histidine kinase KdpD | Signal transduction mechanisms [T] | 0.69 |
| COG1968 | Undecaprenyl pyrophosphate phosphatase | Lipid transport and metabolism [I] | 0.69 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.69 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.69 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.69 |
| COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 0.69 |
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 0.69 |
| COG1469 | GTP cyclohydrolase FolE2 | Coenzyme transport and metabolism [H] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 58.62 % |
| Unclassified | root | N/A | 41.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000532|CNAas_1018466 | Not Available | 504 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_101434909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 724 | Open in IMG/M |
| 3300001867|JGI12627J18819_10220671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 764 | Open in IMG/M |
| 3300003659|JGI25404J52841_10136696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 519 | Open in IMG/M |
| 3300005329|Ga0070683_100031782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4803 | Open in IMG/M |
| 3300005335|Ga0070666_10016717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4696 | Open in IMG/M |
| 3300005336|Ga0070680_101144690 | Not Available | 673 | Open in IMG/M |
| 3300005367|Ga0070667_101231557 | Not Available | 701 | Open in IMG/M |
| 3300005455|Ga0070663_100002250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 10810 | Open in IMG/M |
| 3300005530|Ga0070679_101773316 | Not Available | 566 | Open in IMG/M |
| 3300005548|Ga0070665_100066184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3625 | Open in IMG/M |
| 3300005548|Ga0070665_100194627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 2028 | Open in IMG/M |
| 3300005548|Ga0070665_100213473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1931 | Open in IMG/M |
| 3300005563|Ga0068855_100652675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1130 | Open in IMG/M |
| 3300005614|Ga0068856_100046728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 4263 | Open in IMG/M |
| 3300005617|Ga0068859_100245568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1880 | Open in IMG/M |
| 3300005617|Ga0068859_102408992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 580 | Open in IMG/M |
| 3300005841|Ga0068863_100000004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 272478 | Open in IMG/M |
| 3300005842|Ga0068858_100000033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 142748 | Open in IMG/M |
| 3300005843|Ga0068860_100007463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 10936 | Open in IMG/M |
| 3300005886|Ga0075286_1032710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 691 | Open in IMG/M |
| 3300005887|Ga0075292_1041933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 649 | Open in IMG/M |
| 3300005937|Ga0081455_10007601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 11393 | Open in IMG/M |
| 3300005937|Ga0081455_10101240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 2312 | Open in IMG/M |
| 3300005983|Ga0081540_1229085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 657 | Open in IMG/M |
| 3300006578|Ga0074059_11460953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1336 | Open in IMG/M |
| 3300006580|Ga0074049_12485839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 652 | Open in IMG/M |
| 3300006604|Ga0074060_11417386 | Not Available | 889 | Open in IMG/M |
| 3300006642|Ga0075521_10693303 | Not Available | 503 | Open in IMG/M |
| 3300006881|Ga0068865_101050671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 715 | Open in IMG/M |
| 3300007822|Ga0104325_110622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 1204 | Open in IMG/M |
| 3300009093|Ga0105240_10596815 | Not Available | 1216 | Open in IMG/M |
| 3300009098|Ga0105245_10015680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 6606 | Open in IMG/M |
| 3300009101|Ga0105247_10001113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 20027 | Open in IMG/M |
| 3300009101|Ga0105247_10490186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 893 | Open in IMG/M |
| 3300009148|Ga0105243_12061355 | Not Available | 606 | Open in IMG/M |
| 3300009148|Ga0105243_13102855 | Not Available | 503 | Open in IMG/M |
| 3300009174|Ga0105241_10569126 | Not Available | 1020 | Open in IMG/M |
| 3300009176|Ga0105242_10000430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 33469 | Open in IMG/M |
| 3300009551|Ga0105238_10000023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 196844 | Open in IMG/M |
| 3300009551|Ga0105238_12764217 | Not Available | 527 | Open in IMG/M |
| 3300009553|Ga0105249_10128588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2415 | Open in IMG/M |
| 3300009553|Ga0105249_11364861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 781 | Open in IMG/M |
| 3300010037|Ga0126304_10043799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2693 | Open in IMG/M |
| 3300010159|Ga0099796_10289026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 692 | Open in IMG/M |
| 3300010371|Ga0134125_10001548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 28084 | Open in IMG/M |
| 3300010371|Ga0134125_11474194 | Not Available | 741 | Open in IMG/M |
| 3300012070|Ga0153963_1005393 | Not Available | 2628 | Open in IMG/M |
| 3300012090|Ga0153956_1004957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 7457 | Open in IMG/M |
| 3300012915|Ga0157302_10044150 | Not Available | 1234 | Open in IMG/M |
| 3300012929|Ga0137404_10701920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 915 | Open in IMG/M |
| 3300012942|Ga0164242_10002654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 20683 | Open in IMG/M |
| 3300012943|Ga0164241_10109518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 1982 | Open in IMG/M |
| 3300012955|Ga0164298_10003714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 5221 | Open in IMG/M |
| 3300012955|Ga0164298_10725917 | Not Available | 701 | Open in IMG/M |
| 3300012960|Ga0164301_10000365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 13029 | Open in IMG/M |
| 3300012960|Ga0164301_10108745 | Not Available | 1610 | Open in IMG/M |
| 3300012984|Ga0164309_10794831 | Not Available | 761 | Open in IMG/M |
| 3300012984|Ga0164309_11223216 | Not Available | 631 | Open in IMG/M |
| 3300012988|Ga0164306_10196851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 81 | 1411 | Open in IMG/M |
| 3300013104|Ga0157370_10014625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 8019 | Open in IMG/M |
| 3300013306|Ga0163162_10868293 | Not Available | 1017 | Open in IMG/M |
| 3300013308|Ga0157375_10000109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 80349 | Open in IMG/M |
| 3300013308|Ga0157375_10782177 | Not Available | 1104 | Open in IMG/M |
| 3300013308|Ga0157375_13359067 | Not Available | 533 | Open in IMG/M |
| 3300013503|Ga0120127_10001129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4478 | Open in IMG/M |
| 3300014263|Ga0075324_1031314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 979 | Open in IMG/M |
| 3300014301|Ga0075323_1058713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 765 | Open in IMG/M |
| 3300014311|Ga0075322_1211230 | Not Available | 501 | Open in IMG/M |
| 3300014314|Ga0075316_1121240 | Not Available | 639 | Open in IMG/M |
| 3300014323|Ga0075356_1005108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2094 | Open in IMG/M |
| 3300014502|Ga0182021_10231848 | Not Available | 2161 | Open in IMG/M |
| 3300014745|Ga0157377_10690591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 740 | Open in IMG/M |
| 3300015168|Ga0167631_1055808 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 648 | Open in IMG/M |
| 3300015371|Ga0132258_10998093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2115 | Open in IMG/M |
| 3300017792|Ga0163161_10000013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 258747 | Open in IMG/M |
| 3300017792|Ga0163161_10104649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2110 | Open in IMG/M |
| 3300017792|Ga0163161_10182473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1610 | Open in IMG/M |
| 3300017792|Ga0163161_10419969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 1076 | Open in IMG/M |
| 3300017966|Ga0187776_10046200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2466 | Open in IMG/M |
| 3300018476|Ga0190274_10000661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 20196 | Open in IMG/M |
| 3300019871|Ga0193702_1028413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 716 | Open in IMG/M |
| 3300020021|Ga0193726_1251391 | Not Available | 716 | Open in IMG/M |
| 3300020021|Ga0193726_1257779 | Not Available | 702 | Open in IMG/M |
| 3300020027|Ga0193752_1206146 | Not Available | 743 | Open in IMG/M |
| 3300020034|Ga0193753_10094769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1499 | Open in IMG/M |
| 3300020060|Ga0193717_1132289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 754 | Open in IMG/M |
| 3300021363|Ga0193699_10004904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4838 | Open in IMG/M |
| 3300021377|Ga0213874_10044732 | Not Available | 1338 | Open in IMG/M |
| 3300021404|Ga0210389_10613017 | Not Available | 855 | Open in IMG/M |
| 3300021418|Ga0193695_1000023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 38800 | Open in IMG/M |
| 3300021560|Ga0126371_13703167 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300022898|Ga0247745_1027006 | Not Available | 843 | Open in IMG/M |
| 3300023070|Ga0247755_1113956 | Not Available | 578 | Open in IMG/M |
| 3300025505|Ga0207929_1006264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 81 | 2335 | Open in IMG/M |
| 3300025792|Ga0210143_1092017 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300025900|Ga0207710_10000154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 73881 | Open in IMG/M |
| 3300025900|Ga0207710_10641014 | Not Available | 556 | Open in IMG/M |
| 3300025900|Ga0207710_10644274 | Not Available | 555 | Open in IMG/M |
| 3300025903|Ga0207680_10004244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 6785 | Open in IMG/M |
| 3300025909|Ga0207705_10204379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1497 | Open in IMG/M |
| 3300025911|Ga0207654_10944635 | Not Available | 626 | Open in IMG/M |
| 3300025912|Ga0207707_10141603 | Not Available | 2103 | Open in IMG/M |
| 3300025913|Ga0207695_10428558 | Not Available | 1206 | Open in IMG/M |
| 3300025915|Ga0207693_10940438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 662 | Open in IMG/M |
| 3300025917|Ga0207660_10541292 | Not Available | 947 | Open in IMG/M |
| 3300025920|Ga0207649_10555767 | Not Available | 879 | Open in IMG/M |
| 3300025924|Ga0207694_10000004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 967075 | Open in IMG/M |
| 3300025927|Ga0207687_10004229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 9596 | Open in IMG/M |
| 3300025928|Ga0207700_11628449 | Not Available | 571 | Open in IMG/M |
| 3300025938|Ga0207704_10753392 | Not Available | 810 | Open in IMG/M |
| 3300025938|Ga0207704_11485634 | Not Available | 581 | Open in IMG/M |
| 3300025944|Ga0207661_10001795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 14672 | Open in IMG/M |
| 3300025949|Ga0207667_10689145 | Not Available | 1025 | Open in IMG/M |
| 3300025961|Ga0207712_10291139 | Not Available | 1336 | Open in IMG/M |
| 3300025961|Ga0207712_10308193 | Not Available | 1302 | Open in IMG/M |
| 3300026035|Ga0207703_10000577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 37419 | Open in IMG/M |
| 3300026041|Ga0207639_10010610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 6381 | Open in IMG/M |
| 3300026088|Ga0207641_10000170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 91128 | Open in IMG/M |
| 3300026911|Ga0209620_1022615 | Not Available | 564 | Open in IMG/M |
| 3300027002|Ga0209110_1003718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 1572 | Open in IMG/M |
| 3300027504|Ga0209114_1057074 | Not Available | 691 | Open in IMG/M |
| 3300027517|Ga0209113_1016431 | Not Available | 963 | Open in IMG/M |
| 3300027524|Ga0208998_1023562 | Not Available | 972 | Open in IMG/M |
| 3300027574|Ga0208982_1098909 | Not Available | 593 | Open in IMG/M |
| 3300027815|Ga0209726_10304948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 776 | Open in IMG/M |
| 3300027817|Ga0209112_10203639 | Not Available | 681 | Open in IMG/M |
| 3300027895|Ga0209624_10020575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 4177 | Open in IMG/M |
| 3300028379|Ga0268266_10143654 | Not Available | 2143 | Open in IMG/M |
| 3300028381|Ga0268264_11930872 | Not Available | 600 | Open in IMG/M |
| 3300028556|Ga0265337_1000074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 46897 | Open in IMG/M |
| 3300028790|Ga0307283_10159138 | Not Available | 627 | Open in IMG/M |
| 3300028802|Ga0307503_10000027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 137045 | Open in IMG/M |
| 3300030336|Ga0247826_11072722 | Not Available | 642 | Open in IMG/M |
| 3300031003|Ga0074003_13505997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 1083 | Open in IMG/M |
| 3300031170|Ga0307498_10443603 | Not Available | 519 | Open in IMG/M |
| 3300031525|Ga0302326_11917724 | Not Available | 770 | Open in IMG/M |
| 3300031715|Ga0307476_10002146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 11798 | Open in IMG/M |
| 3300031740|Ga0307468_101365090 | Not Available | 649 | Open in IMG/M |
| 3300032261|Ga0306920_103233096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. Ncost-T10-10d | 609 | Open in IMG/M |
| 3300032770|Ga0335085_10367805 | Not Available | 1680 | Open in IMG/M |
| 3300032829|Ga0335070_10000184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 71249 | Open in IMG/M |
| 3300032829|Ga0335070_10497871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012 | 1155 | Open in IMG/M |
| 3300032954|Ga0335083_10671995 | Not Available | 844 | Open in IMG/M |
| 3300034268|Ga0372943_0277517 | Not Available | 1059 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.17% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.21% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 6.21% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.83% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.83% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.14% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 3.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.76% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.07% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.07% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.07% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.38% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.38% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.38% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.38% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.38% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.38% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 1.38% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.69% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.69% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.69% |
| Compost | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost | 0.69% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.69% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.69% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.69% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.69% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.69% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.69% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.69% |
| Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.69% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.69% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Host-Associated | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005886 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 | Environmental | Open in IMG/M |
| 3300005887 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007822 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-8-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300012070 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL047 MetaG | Host-Associated | Open in IMG/M |
| 3300012090 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL040 MetaG | Host-Associated | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012942 | Miracle-Growth compost microbial communities from Emeryville, California, USA - Original compost - Miracle growth compost (MG) | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300014263 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014301 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014311 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014314 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2 | Environmental | Open in IMG/M |
| 3300014323 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015168 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019871 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a1 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020027 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c1 | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5 | Environmental | Open in IMG/M |
| 3300023070 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L096-311B-4 | Environmental | Open in IMG/M |
| 3300025505 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025792 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026911 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027002 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027504 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027517 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027524 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027574 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Host-Associated | Open in IMG/M |
| 3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031003 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter GP-3A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| CNAas_10184662 | 3300000532 | Quercus Rhizosphere | MTLTVAALTVSDVLGLVVSALVCVYLVYALLRGENL* |
| JGIcombinedJ13530_1014349091 | 3300001213 | Wetland | MSVLPFAALSGADIFGLIASALVFAYLCYALLRGEKL* |
| JGI12627J18819_102206712 | 3300001867 | Forest Soil | MTNALITPVASLSGADIFGIIASFIVCVYLVYALLRGENL* |
| JGI25404J52841_101366961 | 3300003659 | Tabebuia Heterophylla Rhizosphere | MSAAILMPVAALSGADIFGIVASLLVCIYLVYALLRGENL* |
| Ga0070683_1000317824 | 3300005329 | Corn Rhizosphere | MSDVFGAAIAPLAALSPADVFGLVAAFAVCIYLVYALLRGESL* |
| Ga0070666_100167172 | 3300005335 | Switchgrass Rhizosphere | MSGAIAPFAALTGADVFGLVAALVVCVFLFYALLRGENL* |
| Ga0070680_1011446902 | 3300005336 | Corn Rhizosphere | RPDMSDVLGAAIAPVAALGPADVFGLVAAFVVCAFLFYALLRGENL* |
| Ga0070667_1012315572 | 3300005367 | Switchgrass Rhizosphere | MSDAILTPVAALSGADIFGIVASLLVCVYLVYALLRGENL* |
| Ga0070663_1000022504 | 3300005455 | Corn Rhizosphere | MSDVFGAAIAPLAALSPADVFGLVAAFAVCIYLVYALLRGENL* |
| Ga0070679_1017733161 | 3300005530 | Corn Rhizosphere | MSDVLGAAIAPVAALGPADVFGLVAAFVVCAFLFYALLRGENL* |
| Ga0070665_1000661844 | 3300005548 | Switchgrass Rhizosphere | MSLPLASLTGADVFGLLVSALVAAYLLYALLRGENL* |
| Ga0070665_1001946272 | 3300005548 | Switchgrass Rhizosphere | MSGAIAPFAALGAADVFGLVAALVVCVFLFYALLRGENL* |
| Ga0070665_1002134732 | 3300005548 | Switchgrass Rhizosphere | MSDAILTPVAALSGADIFGIVASLLVCIYLVYALLRGEKL* |
| Ga0068855_1006526752 | 3300005563 | Corn Rhizosphere | MSLLPLASLSGADLFGLVVSALVCVYLIYALLRGENL* |
| Ga0068856_1000467282 | 3300005614 | Corn Rhizosphere | MSQLPLASLSAADLLGLVVSALVCAYLLYALLRGENL* |
| Ga0068859_1002455684 | 3300005617 | Switchgrass Rhizosphere | MSPVLATLGAADAIGLLVAAAVGAFLLYALLRGENL* |
| Ga0068859_1024089922 | 3300005617 | Switchgrass Rhizosphere | MSAAILTPVAALSGADIFGIVASLLVCIYLVYALLRGENL* |
| Ga0068863_100000004160 | 3300005841 | Switchgrass Rhizosphere | MSALPFAALGGADLFGLIVSALVCVYLVYALLRGENL* |
| Ga0068858_10000003340 | 3300005842 | Switchgrass Rhizosphere | MSALPLASLSAADLFGLVVSALVCVYLVYALLRGENL* |
| Ga0068860_1000074634 | 3300005843 | Switchgrass Rhizosphere | MSLAAISAADVFGLIVSALIFLYLCYALLRGEKL* |
| Ga0075286_10327102 | 3300005886 | Rice Paddy Soil | MSAVVLATLSGADVFGLIASALVFVYLCYALLRGEKL* |
| Ga0075292_10419332 | 3300005887 | Rice Paddy Soil | MSPLPAAALGGADLFGLAVSLAVALYLLYALLRGESL* |
| Ga0081455_100076016 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSGALPLAALTGADVFGLVAALAVCVYLVYALLRGENL* |
| Ga0081455_101012404 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSAAILTPVAALSGADVFGIVASLLVCIYLVYALLRGENL* |
| Ga0081540_12290852 | 3300005983 | Tabebuia Heterophylla Rhizosphere | VPLAALTGADVFGLLASALVCVYLVYALLRGEKL* |
| Ga0074059_114609532 | 3300006578 | Soil | MSVLPLASLSGADLFGLVVSALVCVYLVYALLRGENL* |
| Ga0074049_124858392 | 3300006580 | Soil | MSLPLAGLSAADAFGLVVAAAVCAFLVYALLRGENL* |
| Ga0074060_114173863 | 3300006604 | Soil | MSAPFPTAAFSVADGFGLVVAALVCAFLVYALLRGENL* |
| Ga0075521_106933031 | 3300006642 | Arctic Peat Soil | MSPVLATLSAADVIGLAVAAAVCAFLLFALLRGENL* |
| Ga0068865_1010506711 | 3300006881 | Miscanthus Rhizosphere | MSTVPLAALSGADLFGLIVSALVCVYLVYALLRGENL* |
| Ga0104325_1106223 | 3300007822 | Soil | MSAVPLATLTGADLFGLIVSALVCIYLVYALLRGENL* |
| Ga0105240_105968153 | 3300009093 | Corn Rhizosphere | MSAPLATLGAADGLGLLVAACVCAFLLYALLRGENL* |
| Ga0105245_100156806 | 3300009098 | Miscanthus Rhizosphere | MSVLPFASFSGADLFGLIVSALVCVYLVYALLRGENL* |
| Ga0105247_1000111323 | 3300009101 | Switchgrass Rhizosphere | MTLTLATLSGADAFGLVVSALVCVYLVFALLRGENL* |
| Ga0105247_104901861 | 3300009101 | Switchgrass Rhizosphere | MSDAILTPVAALSGADIFGIVASLLVCIYLVYALLRGENL* |
| Ga0105243_120613552 | 3300009148 | Miscanthus Rhizosphere | AGPHMRAALPVAALTGSDVFGLFVSSLVCVYLVYLLHCGENL* |
| Ga0105243_131028552 | 3300009148 | Miscanthus Rhizosphere | MSVLPLASFSGADLFGLIVSALVCIYLVYALLRGENL* |
| Ga0105241_105691262 | 3300009174 | Corn Rhizosphere | MSLPLAALSAADVFGLVASAAVAAYLLYALLRGENL* |
| Ga0105242_1000043022 | 3300009176 | Miscanthus Rhizosphere | MSAPLATLTAADVIGLLVAAAVCAFLVYALLRGENL* |
| Ga0105238_1000002386 | 3300009551 | Corn Rhizosphere | MSVLPLASLTGADVFGLVAAALVFGYLLYALLRGENL* |
| Ga0105238_127642172 | 3300009551 | Corn Rhizosphere | MSPTLPLAALTGADVLGLIVSFFVCVYLVYALLRGENL* |
| Ga0105249_101285882 | 3300009553 | Switchgrass Rhizosphere | MSGLPLASLSGADLFGLIVSALVCVYLVYALLRGENL* |
| Ga0105249_113648613 | 3300009553 | Switchgrass Rhizosphere | MSAAILTPVAALSGADIFGLVASFLVCVYLIYALLRGENL* |
| Ga0126304_100437992 | 3300010037 | Serpentine Soil | MSELPLASLGGADLLGLAAAALVFSYLLYALLRGENL* |
| Ga0099796_102890261 | 3300010159 | Vadose Zone Soil | MSAAMLVAPLAAITGADVFGLVISALVVIYLVYALLRGENL* |
| Ga0134125_1000154821 | 3300010371 | Terrestrial Soil | MSTAVLTPVATLSGADIFGLVASFVVCVYLLYALLRGENL* |
| Ga0134125_114741942 | 3300010371 | Terrestrial Soil | MSVAVQLAALGGADVFGLVVSFLVCLYLVYALLRGENL* |
| Ga0153963_10053934 | 3300012070 | Attine Ant Fungus Gardens | MSVPLATVSVADVFGLVVSALVCAYLVYALLRGENL* |
| Ga0153956_10049573 | 3300012090 | Attine Ant Fungus Gardens | MSVPLAAFGAADVFGLLVALVVCLYLLYALLRGENL* |
| Ga0157302_100441503 | 3300012915 | Soil | MSDVALATLSVADVFGLAASAVVVVYLVYALLRGEKL* |
| Ga0137404_107019203 | 3300012929 | Vadose Zone Soil | MSALPLAAFSVADLFGLVVSALVCVYLVYALLRGENL* |
| Ga0164242_100026548 | 3300012942 | Compost | MTTALLTPVAALSGADVFGLVISFIVCVYLVYALLRGENL* |
| Ga0164241_101095183 | 3300012943 | Soil | MVLALPTAAFTGADLFGLVAALLVCVYLVYALVRGENL* |
| Ga0164298_100037144 | 3300012955 | Soil | MSGVVLAALNGADVFGLAASGIVVIYLLYALLRGEKL* |
| Ga0164298_107259172 | 3300012955 | Soil | MSALPVAALSGADVFGLIASALVFAYLVYALLRGENL* |
| Ga0164301_1000036510 | 3300012960 | Soil | MSLPLAALSGADVFGLAVSAVVALYLLYALLRGENL* |
| Ga0164301_101087452 | 3300012960 | Soil | MSAIALAALSGADVFGLTASALICVYLVYALLRGEKL* |
| Ga0164309_107948312 | 3300012984 | Soil | MSLPLASLTAADVFGLLVSAVVAAYLLYALLRGENL* |
| Ga0164309_112232162 | 3300012984 | Soil | MSALPLASLSGADLFGLVVSALVCVYLVYALLRGENL* |
| Ga0164306_101968512 | 3300012988 | Soil | MSVLPIAALGGADLFGLIVSALVCVYLVYALLRGENL* |
| Ga0157370_100146254 | 3300013104 | Corn Rhizosphere | MPLAALSGTDVFGLVASAAVCVYLVYALLRGENL* |
| Ga0163162_108682932 | 3300013306 | Switchgrass Rhizosphere | MSVPVAGIGAADLFGLLAAAAVCVYLVYALLRGENL* |
| Ga0157375_1000010943 | 3300013308 | Miscanthus Rhizosphere | MSALPLASLSGADLFGLVVSALVCVYLVYALLRGESL* |
| Ga0157375_107821772 | 3300013308 | Miscanthus Rhizosphere | MSELPLASLSGADLFGLIVSGLVCVYLVYALLRGENL* |
| Ga0157375_133590672 | 3300013308 | Miscanthus Rhizosphere | MSALPLAAFTGADLFGLAVAALVCAYLVYALLRGENL* |
| Ga0120127_100011294 | 3300013503 | Permafrost | MSALPLAALSGADLFGLIVSALVCVYLVYALLRGENL* |
| Ga0075324_10313143 | 3300014263 | Natural And Restored Wetlands | MSAIVLATLSGADIFGLVASALVFVYLCYALLRGEKL* |
| Ga0075323_10587132 | 3300014301 | Natural And Restored Wetlands | MSTLPVAALSGADVFGLVVSSLVAAYLLYALLRGEDL* |
| Ga0075322_12112302 | 3300014311 | Natural And Restored Wetlands | MSALPLAALSGADVFGLVASALVFVYLCYALLRGERL* |
| Ga0075316_11212402 | 3300014314 | Natural And Restored Wetlands | MSELSLAALSGADVFGLVASALVFVYLLYALLRGESL* |
| Ga0075356_10051084 | 3300014323 | Natural And Restored Wetlands | MNEIALATLSGADVFGLVASGIVAAYLLYALLRGEKL* |
| Ga0182021_102318484 | 3300014502 | Fen | MSVLPLASFSGADLFGLIVSALVCVYLVYALLRGENL* |
| Ga0157377_106905912 | 3300014745 | Miscanthus Rhizosphere | MSAPLATLTAADGLGLLVAACVCAFLLYALLRGENL* |
| Ga0167631_10558083 | 3300015168 | Glacier Forefield Soil | MSSLPLATLSGADLFGLIVSALVCVYLVYALLRGENL* |
| Ga0132258_109980933 | 3300015371 | Arabidopsis Rhizosphere | MSVLPLASLTGADVFGLIASGIVVVYLLYALLRGEKL* |
| Ga0163161_1000001345 | 3300017792 | Switchgrass Rhizosphere | MSEVVLATLSGADVFGLVASALVVAYLLYALLRGEKL |
| Ga0163161_101046494 | 3300017792 | Switchgrass Rhizosphere | MTLTLATLSGADLFGLVVSALVCVYLIYALLRGENL |
| Ga0163161_101824732 | 3300017792 | Switchgrass Rhizosphere | MSALPLAALGGADLFGLIASALICVYLVYALLRGEKL |
| Ga0163161_104199692 | 3300017792 | Switchgrass Rhizosphere | MSAPLASIGGADLFGLLAAAAVCVYLVYALLRGENL |
| Ga0187776_100462002 | 3300017966 | Tropical Peatland | MSELPFAALSGADVFGLIASALVFVYLCYALLRGEKL |
| Ga0190274_100006618 | 3300018476 | Soil | MSALPLAAFTGADFFGLVVSALVCAYLIYALLRGENL |
| Ga0193702_10284132 | 3300019871 | Soil | MSAALLTPLAALSGADIFGLVASFIVCVYLVYALLRGEKL |
| Ga0193726_12513912 | 3300020021 | Soil | GLPLAMLSGADLFGLVVSALVCIYLVYALLRGENL |
| Ga0193726_12577792 | 3300020021 | Soil | MSAVVLAPLAAITGADVFGLVISALVCLYLIYALLRGENL |
| Ga0193752_12061462 | 3300020027 | Soil | MTPLLAAISGADLFGLVASALVCVYLVYALLRGEKL |
| Ga0193753_100947692 | 3300020034 | Soil | MTSLIATPLAALSGADVFGLIISFLVCVYLVYALLRGENL |
| Ga0193717_11322892 | 3300020060 | Soil | MTSLIATPLAALSGADVFGLIVSFLVCVYLVYALLRGENL |
| Ga0193699_100049045 | 3300021363 | Soil | MSLALASLTGADVFGLLVSAAIAAYLLYALLRGENL |
| Ga0213874_100447322 | 3300021377 | Plant Roots | MTLVVASISGADLFGLIASFLVCLYLLYALLRGEKF |
| Ga0210389_106130172 | 3300021404 | Soil | MTNALITPVAALSGADVFGLIISFIVCVYLVYALLRGENL |
| Ga0193695_100002340 | 3300021418 | Soil | MSGLPLAALSGADLFGLVVSALVCAYLVYALLRGENL |
| Ga0126371_137031672 | 3300021560 | Tropical Forest Soil | MTLILASIGGADLFGLIASAIVCVYLLYALLRGEKS |
| Ga0247745_10270063 | 3300022898 | Soil | MSLPLASLGGADVFGLLVSAAAAAYLLYALLRGENL |
| Ga0247755_11139562 | 3300023070 | Plant Litter | MSLPLAALSVADALGLLVAFAVCAFLLYALLRGENL |
| Ga0207929_10062642 | 3300025505 | Arctic Peat Soil | MSLALATLTVADALGLLVAALVCAFLVYALLRGENL |
| Ga0210143_10920172 | 3300025792 | Natural And Restored Wetlands | MSAVVLATLSGADVFGLIASALVFVYLCYALLRGEKL |
| Ga0207710_1000015436 | 3300025900 | Switchgrass Rhizosphere | MTLTLATLSGADAFGLVVSALVCVYLVFALLRGENL |
| Ga0207710_106410142 | 3300025900 | Switchgrass Rhizosphere | MSAAILTPVAALSGADIFGIVASLLVCVYLVYALLRGENL |
| Ga0207710_106442742 | 3300025900 | Switchgrass Rhizosphere | MSPVLATLGAADAIGLLVAAAVGAFLLYALLRGENL |
| Ga0207680_100042446 | 3300025903 | Switchgrass Rhizosphere | MSGAIAPFAALTGADVFGLVAALVVCVFLFYALLRGENL |
| Ga0207705_102043794 | 3300025909 | Corn Rhizosphere | MSLALASLTVADVFGLLVSGVVAAYLLYALLRGENL |
| Ga0207654_109446352 | 3300025911 | Corn Rhizosphere | RADRPDMSLPLAALSAADVFGLVASAAVAAYLLYALLRGENL |
| Ga0207707_101416034 | 3300025912 | Corn Rhizosphere | MSALRLASLSGADLFGLVVSALVCIYLIYALLRGENL |
| Ga0207695_104285582 | 3300025913 | Corn Rhizosphere | MSAPLATLGAADGLGLLVAACVCAFLLYALLRGENL |
| Ga0207693_109404381 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSALPVAALSGADVFGLIASALVFAYLVYALLRGENL |
| Ga0207660_105412922 | 3300025917 | Corn Rhizosphere | MSDVFGAAIAPLAALSPADVFGLVAAFAVCIYLVYALLRGENL |
| Ga0207649_105557672 | 3300025920 | Corn Rhizosphere | MSDVFGAAIAPLAALSPADVFGLVAAFAVCIYLVYALLRGESL |
| Ga0207694_10000004774 | 3300025924 | Corn Rhizosphere | MSVLPLASLTGADVFGLVAAALVFGYLLYALLRGENL |
| Ga0207687_100042299 | 3300025927 | Miscanthus Rhizosphere | MSVLPFASFSGADLFGLIVSALVCVYLVYALLRGENL |
| Ga0207700_116284492 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGLPLASLTGADLFGLIISALVCVYLVYALLRGENL |
| Ga0207704_107533922 | 3300025938 | Miscanthus Rhizosphere | MSTVPLAALSGADLFGLIVSALVCVYLVYALLRGENL |
| Ga0207704_114856342 | 3300025938 | Miscanthus Rhizosphere | MSPLLPLATLSGADLFGLIVSAVVCVYLVYALLRGENL |
| Ga0207661_100017954 | 3300025944 | Corn Rhizosphere | MSVLPVAAFSGADLFGLIVSALVCVYLVYALLRGENL |
| Ga0207667_106891452 | 3300025949 | Corn Rhizosphere | MSLLPLASLSGADLFGLVVSALVCVYLIYALLRGENL |
| Ga0207712_102911392 | 3300025961 | Switchgrass Rhizosphere | MSAAILTPVAALSGADIFGLVASFLVCVYLIYALLRGENL |
| Ga0207712_103081934 | 3300025961 | Switchgrass Rhizosphere | MSGLPLASLSGADLFGLIVSALVCVYLVYALLRGENL |
| Ga0207703_1000057726 | 3300026035 | Switchgrass Rhizosphere | MSALPLASLSAADLFGLVVSALVCVYLVYALLRGENL |
| Ga0207639_100106103 | 3300026041 | Corn Rhizosphere | MSQLPLASLSAADLLGLVVSALVCAYLLYALLRGENL |
| Ga0207641_1000017011 | 3300026088 | Switchgrass Rhizosphere | MSALPFAALGGADLFGLIVSALVCVYLVYALLRGENL |
| Ga0209620_10226152 | 3300026911 | Forest Soil | MTNALITPIAALSGADVFGLIASFIVCVYLVYALLRGENL |
| Ga0209110_10037183 | 3300027002 | Forest Soil | MTNALITPVASLSGADIFGIIASFIVCVYLVYALLRGENL |
| Ga0209114_10570742 | 3300027504 | Forest Soil | MTHALLTPIAALSGADIFGLIASFIVCVYLVYALLRGENL |
| Ga0209113_10164312 | 3300027517 | Forest Soil | MTHALITPIAALSGADIFGLIASFIVCVYLVYALLRGENL |
| Ga0208998_10235622 | 3300027524 | Forest Soil | MSVLPLASLSAADLFGLVVSALVCVYLVYALLRGENL |
| Ga0208982_10989092 | 3300027574 | Forest Soil | MSAVVLAPLAAITGADVFGLIISALVCLYLIYALLRGENL |
| Ga0209726_103049481 | 3300027815 | Groundwater | MSPVLATLTVADVVGLLVAAAVCVFLLYALLRGENL |
| Ga0209112_102036392 | 3300027817 | Forest Soil | MTSALVTPLAALSGADVFGLIASFVVCVYLVYALLRGEDL |
| Ga0209624_100205754 | 3300027895 | Forest Soil | MSLTLATVTGADIFGLVVSSLVCLYLIYALLRGEKL |
| Ga0268266_101436542 | 3300028379 | Switchgrass Rhizosphere | MSLPLASLTGADVFGLLVSALVAAYLLYALLRGENL |
| Ga0268264_119308722 | 3300028381 | Switchgrass Rhizosphere | MSDAILTPVAALSGADIFGIVASLLVCVYLVYALLRGENL |
| Ga0265337_100007434 | 3300028556 | Rhizosphere | MSLPLATLSSADVFGLVVSALVCLYLVYALLRGENL |
| Ga0307283_101591381 | 3300028790 | Soil | MSALPLASLSVADLFGLVVSALVCVYLVYALLRGENL |
| Ga0307503_1000002784 | 3300028802 | Soil | MSGAVLATLSGVDVFGLAASVLVVAYLLYALLRGEKL |
| Ga0247826_110727222 | 3300030336 | Soil | MSGLPIAALSGAGVFGLIASALVFVYLLYALLRGERL |
| Ga0074003_135059973 | 3300031003 | Soil | MSAAAVVIAPLAALTGADVFGLVICFAICVYLLYALLRGENL |
| Ga0307498_104436032 | 3300031170 | Soil | MSLLVPATLGGADVFGLVASALVVAYLVYALLRGEKL |
| Ga0302326_119177242 | 3300031525 | Palsa | MSAVVAPLAAISGADVFGLVVSAIVCLYLLYALLRGEKL |
| Ga0307476_100021464 | 3300031715 | Hardwood Forest Soil | MSALIAIPFAALSGADVFGLVAAALVCVYLIYALLRGENL |
| Ga0307468_1013650902 | 3300031740 | Hardwood Forest Soil | MSVPLPLASLTAADVFGLIASAIVAVYLLYALLRGERL |
| Ga0306920_1032330961 | 3300032261 | Soil | MSLPVASIGGADVFGLIVAVLICAYLLYALLRGESF |
| Ga0335085_103678053 | 3300032770 | Soil | MSDIALAALSGADVFGLIASVLVFVYLCYALLRGEKL |
| Ga0335070_1000018433 | 3300032829 | Soil | MSALVPFAALTVADVFGLLVAAVVCAYLLYALLRGENL |
| Ga0335070_104978712 | 3300032829 | Soil | MSELPFAALSGADIFGLIASALVFVYLCYALLRGEKL |
| Ga0335083_106719952 | 3300032954 | Soil | MSGALVPFAALTGADVFGLLVALVVCVYLVYALLRGENL |
| Ga0372943_0277517_173_286 | 3300034268 | Soil | MSELPLASLSGADLFGLVVSALVCVYLVYALLRGENL |
| ⦗Top⦘ |