| Basic Information | |
|---|---|
| Family ID | F050205 |
| Family Type | Metagenome |
| Number of Sequences | 145 |
| Average Sequence Length | 42 residues |
| Representative Sequence | VVADIAKLSVGREEYYTRELATDHEQYLSGHGESPGRWYGA |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 95.14 % |
| % of genes near scaffold ends (potentially truncated) | 95.86 % |
| % of genes from short scaffolds (< 2000 bps) | 85.52 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (62.069 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.931 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.483 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (34.483 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.64% β-sheet: 0.00% Coil/Unstructured: 75.36% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF00561 | Abhydrolase_1 | 3.45 |
| PF02371 | Transposase_20 | 3.45 |
| PF13191 | AAA_16 | 2.07 |
| PF00196 | GerE | 2.07 |
| PF12802 | MarR_2 | 1.38 |
| PF13610 | DDE_Tnp_IS240 | 1.38 |
| PF03861 | ANTAR | 0.69 |
| PF13495 | Phage_int_SAM_4 | 0.69 |
| PF01610 | DDE_Tnp_ISL3 | 0.69 |
| PF01839 | FG-GAP | 0.69 |
| PF00465 | Fe-ADH | 0.69 |
| PF08241 | Methyltransf_11 | 0.69 |
| PF13676 | TIR_2 | 0.69 |
| PF12697 | Abhydrolase_6 | 0.69 |
| PF02861 | Clp_N | 0.69 |
| PF07730 | HisKA_3 | 0.69 |
| PF07508 | Recombinase | 0.69 |
| PF10009 | DUF2252 | 0.69 |
| PF04073 | tRNA_edit | 0.69 |
| PF02641 | DUF190 | 0.69 |
| PF08378 | NERD | 0.69 |
| PF04545 | Sigma70_r4 | 0.69 |
| PF01425 | Amidase | 0.69 |
| PF00941 | FAD_binding_5 | 0.69 |
| PF00903 | Glyoxalase | 0.69 |
| PF01434 | Peptidase_M41 | 0.69 |
| PF05368 | NmrA | 0.69 |
| PF00293 | NUDIX | 0.69 |
| PF03551 | PadR | 0.69 |
| PF04561 | RNA_pol_Rpb2_2 | 0.69 |
| PF08281 | Sigma70_r4_2 | 0.69 |
| PF08751 | TrwC | 0.69 |
| PF02744 | GalP_UDP_tr_C | 0.69 |
| PF07731 | Cu-oxidase_2 | 0.69 |
| PF01738 | DLH | 0.69 |
| PF07992 | Pyr_redox_2 | 0.69 |
| PF13604 | AAA_30 | 0.69 |
| PF01323 | DSBA | 0.69 |
| PF00005 | ABC_tran | 0.69 |
| PF09137 | Glucodextran_N | 0.69 |
| PF04328 | Sel_put | 0.69 |
| PF01590 | GAF | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 3.45 |
| COG1979 | Alcohol dehydrogenase YqhD, Fe-dependent ADH family | Energy production and conversion [C] | 0.69 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.69 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.69 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.69 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.69 |
| COG3707 | Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding antiterminator (ANTAR) domains | Transcription [K] | 0.69 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.69 |
| COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 0.69 |
| COG2879 | Uncharacterized short protein YbdD, DUF466 family | Function unknown [S] | 0.69 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.69 |
| COG1993 | PII-like signaling protein | Signal transduction mechanisms [T] | 0.69 |
| COG0085 | DNA-directed RNA polymerase, beta subunit/140 kD subunit | Transcription [K] | 0.69 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.69 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.69 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.69 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.69 |
| COG1454 | Alcohol dehydrogenase, class IV | Energy production and conversion [C] | 0.69 |
| COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 0.69 |
| COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 0.69 |
| COG0371 | Glycerol dehydrogenase or related enzyme, iron-containing ADH family | Energy production and conversion [C] | 0.69 |
| COG0337 | 3-dehydroquinate synthetase | Amino acid transport and metabolism [E] | 0.69 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 62.07 % |
| All Organisms | root | All Organisms | 37.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000891|JGI10214J12806_10986320 | Not Available | 516 | Open in IMG/M |
| 3300003373|JGI25407J50210_10025471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1534 | Open in IMG/M |
| 3300005562|Ga0058697_10237889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Phytoactinopolyspora → Phytoactinopolyspora halotolerans | 843 | Open in IMG/M |
| 3300005562|Ga0058697_10351626 | Not Available | 718 | Open in IMG/M |
| 3300005562|Ga0058697_10720378 | Not Available | 533 | Open in IMG/M |
| 3300005981|Ga0081538_10001428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 24551 | Open in IMG/M |
| 3300006844|Ga0075428_102528690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 525 | Open in IMG/M |
| 3300006845|Ga0075421_100237612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2239 | Open in IMG/M |
| 3300006846|Ga0075430_100709765 | Not Available | 829 | Open in IMG/M |
| 3300006852|Ga0075433_11638570 | Not Available | 555 | Open in IMG/M |
| 3300006880|Ga0075429_101720176 | Not Available | 545 | Open in IMG/M |
| 3300009100|Ga0075418_12284022 | Not Available | 590 | Open in IMG/M |
| 3300009100|Ga0075418_12386176 | Not Available | 577 | Open in IMG/M |
| 3300009147|Ga0114129_10422387 | Not Available | 1753 | Open in IMG/M |
| 3300009147|Ga0114129_10510603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1568 | Open in IMG/M |
| 3300009147|Ga0114129_12505953 | Not Available | 617 | Open in IMG/M |
| 3300009147|Ga0114129_13165110 | Not Available | 536 | Open in IMG/M |
| 3300009162|Ga0075423_10007834 | All Organisms → cellular organisms → Bacteria | 10106 | Open in IMG/M |
| 3300009162|Ga0075423_13056126 | Not Available | 513 | Open in IMG/M |
| 3300009553|Ga0105249_10417175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1375 | Open in IMG/M |
| 3300009553|Ga0105249_13489208 | Not Available | 506 | Open in IMG/M |
| 3300009789|Ga0126307_10608741 | Not Available | 882 | Open in IMG/M |
| 3300009789|Ga0126307_11151337 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia | 628 | Open in IMG/M |
| 3300009811|Ga0105084_1032918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 889 | Open in IMG/M |
| 3300009821|Ga0105064_1075490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 670 | Open in IMG/M |
| 3300009822|Ga0105066_1006285 | All Organisms → cellular organisms → Bacteria | 2094 | Open in IMG/M |
| 3300009840|Ga0126313_10171387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1652 | Open in IMG/M |
| 3300009840|Ga0126313_10278563 | Not Available | 1303 | Open in IMG/M |
| 3300009840|Ga0126313_10893475 | Not Available | 725 | Open in IMG/M |
| 3300009840|Ga0126313_11176940 | Not Available | 631 | Open in IMG/M |
| 3300010036|Ga0126305_10520866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 794 | Open in IMG/M |
| 3300010036|Ga0126305_10528154 | Not Available | 789 | Open in IMG/M |
| 3300010036|Ga0126305_10897337 | Not Available | 605 | Open in IMG/M |
| 3300010038|Ga0126315_11091870 | Not Available | 538 | Open in IMG/M |
| 3300010041|Ga0126312_10192859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1423 | Open in IMG/M |
| 3300010041|Ga0126312_11201325 | Not Available | 559 | Open in IMG/M |
| 3300010041|Ga0126312_11380295 | Not Available | 522 | Open in IMG/M |
| 3300010042|Ga0126314_10065563 | All Organisms → cellular organisms → Bacteria | 2400 | Open in IMG/M |
| 3300010042|Ga0126314_10227188 | Not Available | 1320 | Open in IMG/M |
| 3300010042|Ga0126314_10867670 | Not Available | 666 | Open in IMG/M |
| 3300010044|Ga0126310_10724155 | Not Available | 757 | Open in IMG/M |
| 3300010045|Ga0126311_11143030 | Not Available | 642 | Open in IMG/M |
| 3300010045|Ga0126311_11642458 | Not Available | 541 | Open in IMG/M |
| 3300010166|Ga0126306_11040083 | Not Available | 668 | Open in IMG/M |
| 3300010166|Ga0126306_11382717 | Not Available | 582 | Open in IMG/M |
| 3300012021|Ga0120192_10005002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1805 | Open in IMG/M |
| 3300012204|Ga0137374_10408509 | Not Available | 1077 | Open in IMG/M |
| 3300012204|Ga0137374_11230988 | Not Available | 522 | Open in IMG/M |
| 3300012206|Ga0137380_10343279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1332 | Open in IMG/M |
| 3300012209|Ga0137379_11538530 | Not Available | 565 | Open in IMG/M |
| 3300012349|Ga0137387_11328149 | Not Available | 502 | Open in IMG/M |
| 3300012350|Ga0137372_10959389 | Not Available | 600 | Open in IMG/M |
| 3300012350|Ga0137372_10987825 | Not Available | 588 | Open in IMG/M |
| 3300012350|Ga0137372_10995922 | Not Available | 585 | Open in IMG/M |
| 3300012351|Ga0137386_10003876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 9816 | Open in IMG/M |
| 3300012353|Ga0137367_10013127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6583 | Open in IMG/M |
| 3300012353|Ga0137367_10225219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1353 | Open in IMG/M |
| 3300012353|Ga0137367_10298687 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300012353|Ga0137367_11072581 | Not Available | 545 | Open in IMG/M |
| 3300012353|Ga0137367_11080099 | Not Available | 543 | Open in IMG/M |
| 3300012354|Ga0137366_10476263 | Not Available | 903 | Open in IMG/M |
| 3300012354|Ga0137366_11149947 | Not Available | 531 | Open in IMG/M |
| 3300012354|Ga0137366_11153124 | Not Available | 530 | Open in IMG/M |
| 3300012356|Ga0137371_10630849 | Not Available | 822 | Open in IMG/M |
| 3300012358|Ga0137368_10717704 | Not Available | 627 | Open in IMG/M |
| 3300012358|Ga0137368_10768014 | Not Available | 599 | Open in IMG/M |
| 3300012359|Ga0137385_10557545 | Not Available | 966 | Open in IMG/M |
| 3300012360|Ga0137375_10444195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1120 | Open in IMG/M |
| 3300012360|Ga0137375_10477358 | Not Available | 1067 | Open in IMG/M |
| 3300012360|Ga0137375_11235497 | Not Available | 569 | Open in IMG/M |
| 3300012532|Ga0137373_10383813 | Not Available | 1095 | Open in IMG/M |
| 3300012532|Ga0137373_11101125 | Not Available | 568 | Open in IMG/M |
| 3300012937|Ga0162653_100083832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300014487|Ga0182000_10157666 | Not Available | 829 | Open in IMG/M |
| 3300014487|Ga0182000_10402731 | Not Available | 607 | Open in IMG/M |
| 3300014487|Ga0182000_10679965 | Not Available | 506 | Open in IMG/M |
| 3300015359|Ga0134085_10173842 | Not Available | 920 | Open in IMG/M |
| 3300017997|Ga0184610_1273464 | Not Available | 559 | Open in IMG/M |
| 3300018027|Ga0184605_10269434 | Not Available | 773 | Open in IMG/M |
| 3300018031|Ga0184634_10479569 | Not Available | 558 | Open in IMG/M |
| 3300018051|Ga0184620_10265466 | Not Available | 577 | Open in IMG/M |
| 3300018061|Ga0184619_10109368 | Not Available | 1246 | Open in IMG/M |
| 3300018073|Ga0184624_10050043 | All Organisms → cellular organisms → Bacteria | 1689 | Open in IMG/M |
| 3300018073|Ga0184624_10114835 | Not Available | 1162 | Open in IMG/M |
| 3300018078|Ga0184612_10017489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 3663 | Open in IMG/M |
| 3300018081|Ga0184625_10077001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1702 | Open in IMG/M |
| 3300018081|Ga0184625_10092042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1560 | Open in IMG/M |
| 3300018432|Ga0190275_10947835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Modestobacter → unclassified Modestobacter → Modestobacter sp. DSM 44400 | 930 | Open in IMG/M |
| 3300018466|Ga0190268_10341773 | Not Available | 926 | Open in IMG/M |
| 3300018466|Ga0190268_12343585 | Not Available | 505 | Open in IMG/M |
| 3300018476|Ga0190274_10088783 | All Organisms → cellular organisms → Bacteria | 2411 | Open in IMG/M |
| 3300018476|Ga0190274_10214311 | All Organisms → cellular organisms → Bacteria | 1708 | Open in IMG/M |
| 3300021073|Ga0210378_10034780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2006 | Open in IMG/M |
| 3300026118|Ga0207675_102098650 | Not Available | 582 | Open in IMG/M |
| 3300026707|Ga0208074_100853 | Not Available | 748 | Open in IMG/M |
| 3300027006|Ga0209896_1025554 | Not Available | 671 | Open in IMG/M |
| 3300027056|Ga0209879_1081341 | Not Available | 509 | Open in IMG/M |
| 3300027332|Ga0209861_1023065 | Not Available | 925 | Open in IMG/M |
| 3300027379|Ga0209842_1001490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4636 | Open in IMG/M |
| 3300027511|Ga0209843_1043079 | Not Available | 808 | Open in IMG/M |
| 3300027577|Ga0209874_1005212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3931 | Open in IMG/M |
| 3300027718|Ga0209795_10179463 | Not Available | 595 | Open in IMG/M |
| 3300027873|Ga0209814_10164990 | Not Available | 952 | Open in IMG/M |
| 3300028708|Ga0307295_10204572 | Not Available | 560 | Open in IMG/M |
| 3300028719|Ga0307301_10075049 | Not Available | 1057 | Open in IMG/M |
| 3300028722|Ga0307319_10127562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 821 | Open in IMG/M |
| 3300028744|Ga0307318_10000892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9909 | Open in IMG/M |
| 3300028744|Ga0307318_10254677 | Not Available | 612 | Open in IMG/M |
| 3300028755|Ga0307316_10119051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Nitriliruptorales → unclassified Nitriliruptorales → Nitriliruptorales bacterium | 930 | Open in IMG/M |
| 3300028778|Ga0307288_10228962 | Not Available | 723 | Open in IMG/M |
| 3300028787|Ga0307323_10005027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4298 | Open in IMG/M |
| 3300028791|Ga0307290_10021071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2274 | Open in IMG/M |
| 3300028791|Ga0307290_10029162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1953 | Open in IMG/M |
| 3300028878|Ga0307278_10052657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1843 | Open in IMG/M |
| 3300028880|Ga0307300_10009820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2430 | Open in IMG/M |
| 3300028881|Ga0307277_10588045 | Not Available | 500 | Open in IMG/M |
| 3300028884|Ga0307308_10240286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 868 | Open in IMG/M |
| 3300030510|Ga0268243_1006149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 2121 | Open in IMG/M |
| 3300030510|Ga0268243_1036989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1025 | Open in IMG/M |
| 3300030516|Ga0268255_10059600 | Not Available | 1206 | Open in IMG/M |
| 3300031548|Ga0307408_100855090 | Not Available | 830 | Open in IMG/M |
| 3300031731|Ga0307405_10292821 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
| 3300031731|Ga0307405_11115594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium canum | 679 | Open in IMG/M |
| 3300031731|Ga0307405_11501140 | Not Available | 592 | Open in IMG/M |
| 3300031852|Ga0307410_10792024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 805 | Open in IMG/M |
| 3300031852|Ga0307410_11407615 | Not Available | 612 | Open in IMG/M |
| 3300031901|Ga0307406_10621677 | Not Available | 893 | Open in IMG/M |
| 3300031901|Ga0307406_11922909 | Not Available | 528 | Open in IMG/M |
| 3300031903|Ga0307407_10069260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2093 | Open in IMG/M |
| 3300031911|Ga0307412_11584374 | Not Available | 598 | Open in IMG/M |
| 3300031995|Ga0307409_101922954 | Not Available | 621 | Open in IMG/M |
| 3300032002|Ga0307416_100280091 | Not Available | 1643 | Open in IMG/M |
| 3300032002|Ga0307416_100293102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae | 1612 | Open in IMG/M |
| 3300032002|Ga0307416_101671758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 741 | Open in IMG/M |
| 3300032004|Ga0307414_10824536 | Not Available | 847 | Open in IMG/M |
| 3300032005|Ga0307411_12341042 | Not Available | 502 | Open in IMG/M |
| 3300032126|Ga0307415_100196436 | Not Available | 1596 | Open in IMG/M |
| 3300032126|Ga0307415_100568906 | Not Available | 1003 | Open in IMG/M |
| 3300032126|Ga0307415_100744953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 889 | Open in IMG/M |
| 3300032126|Ga0307415_102320899 | Not Available | 526 | Open in IMG/M |
| 3300032159|Ga0268251_10103390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 1019 | Open in IMG/M |
| 3300034172|Ga0334913_008648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2521 | Open in IMG/M |
| 3300034174|Ga0334932_003231 | Not Available | 2597 | Open in IMG/M |
| 3300034174|Ga0334932_052821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 695 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.93% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 14.48% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 13.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.10% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.66% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 6.90% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 6.21% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 4.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.45% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 2.07% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.38% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.69% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.69% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.69% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
| 3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300012021 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026707 | Grasslands soil microbial communities from Gorham, Kansas, USA that are Nitrogen fertilized -NN626 (SPAdes) | Environmental | Open in IMG/M |
| 3300027006 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027332 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027718 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030510 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2) | Environmental | Open in IMG/M |
| 3300030516 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (v2) | Host-Associated | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| 3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
| 3300034174 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 28HNS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10214J12806_109863201 | 3300000891 | Soil | VVADIAKLSVGREAYYTRELATDHEAYLSGHGESPGRWYGASATSLGLQGEA |
| JGI25407J50210_100254713 | 3300003373 | Tabebuia Heterophylla Rhizosphere | VAKLSVGREDCYLRELADNHEQYLSGHGESPGRWYGAGAA |
| Ga0058697_102378891 | 3300005562 | Agave | VVADIAKLSMGREAYYTRELATDHEQYLSGHGESP |
| Ga0058697_103516262 | 3300005562 | Agave | VVADIAKLSVGREEYYTRELATDHEAYMSGHGESPGRWYGAGASSLG |
| Ga0058697_107203781 | 3300005562 | Agave | VVADIAKLSVGREAYYTRELATDHQAYLSGHGESPGRWY |
| Ga0081538_100014281 | 3300005981 | Tabebuia Heterophylla Rhizosphere | VVADIAKLTIGREAYYTRELATDHEQYLSGHGESPGRWYGAGADS |
| Ga0075428_1025286901 | 3300006844 | Populus Rhizosphere | VVADIAKLSVGREGYYTRELATDHEQYLSGHGESPGRWYGAGATSLGLQG |
| Ga0075421_1002376123 | 3300006845 | Populus Rhizosphere | VVADIAKLSVGREAYYTRELATDHEQYLSGHGESP |
| Ga0075430_1007097654 | 3300006846 | Populus Rhizosphere | VVADIAKLSVGREEYYTRELAADHEAYLSGHGESPGRWYSAGATSLGLQGEASV |
| Ga0075433_116385701 | 3300006852 | Populus Rhizosphere | VVADIAKLSVGREAYYTRELATDHEAYLSGHGESP |
| Ga0075429_1017201762 | 3300006880 | Populus Rhizosphere | MQAGGERRVVADIAKLSVGREEYYTRELATDHEQYLSGHGESPG |
| Ga0075418_122840221 | 3300009100 | Populus Rhizosphere | VVADIAKLSVGREEYYTREQATDHEAYLSGHGESP |
| Ga0075418_123861761 | 3300009100 | Populus Rhizosphere | VVADIAKLSVGREDYYTRELATDHEQYLSGHGESPGR |
| Ga0114129_104223873 | 3300009147 | Populus Rhizosphere | VVVDIAKLSVGREEYYTRELATDHEQYLSGHGESPGRWYGGGA |
| Ga0114129_105106034 | 3300009147 | Populus Rhizosphere | VVADIAKLSGGREEYYTRELATDHEAYLSGHGESPG |
| Ga0114129_125059531 | 3300009147 | Populus Rhizosphere | VVADIAKLSVGREEYYTRELATDHEQYLSGHGESPG |
| Ga0114129_131651102 | 3300009147 | Populus Rhizosphere | VVADIAKLSVGREEYYTRELATDHEQYLSGHGESPGRWYGGGA |
| Ga0075423_1000783412 | 3300009162 | Populus Rhizosphere | VVADIAKLTIGREAYYTRELATDHEQYLSGHGESP |
| Ga0075423_130561261 | 3300009162 | Populus Rhizosphere | VVADIAKLSVGREEYYTRELATDHEQYLSGHGESPGRWYG |
| Ga0105249_104171754 | 3300009553 | Switchgrass Rhizosphere | MVADIAKLSVGREEYYTRELATDHEQYLSGHGESPGRWYGAAAT |
| Ga0105249_134892081 | 3300009553 | Switchgrass Rhizosphere | VVADIAKLTIGREAYYTRELAENHEEYLSGHGESPGRWYGAGADSL |
| Ga0126307_106087411 | 3300009789 | Serpentine Soil | VVADIAKLSVGREEYYTRELASGDEACLSGHGESPRRWYGAGARGLGLHGEASVAGF |
| Ga0126307_111513372 | 3300009789 | Serpentine Soil | VVADVAKLSMGREEYYTRELATDHEEYLSGHGESPGRWYGAGA |
| Ga0105084_10329181 | 3300009811 | Groundwater Sand | VAKLAVGREDYYTRELADSHEAYLSGHDTSRGRWCGHHATALGLQGEASV* |
| Ga0105064_10754902 | 3300009821 | Groundwater Sand | MKAGGSGVVADIAKLSVGREEYYTRELATDHEAYLSGHG |
| Ga0105066_10062851 | 3300009822 | Groundwater Sand | VVADIAKLSVGREEYYTRELATDHEAYLSGHGESPGRWYGAGATSLGLN |
| Ga0126313_101713874 | 3300009840 | Serpentine Soil | VVADIAKLSMGREGYYTRELATDHETYLSGHGESPGRWYGAGA |
| Ga0126313_102785631 | 3300009840 | Serpentine Soil | VVADIAKLSVGREEYYTRELATDHEQYLSGHGESPGRWYGAGAT |
| Ga0126313_108934752 | 3300009840 | Serpentine Soil | VVADIAKLSVGQEAYYARERATDHEQYLSGHGESPWSCPGS |
| Ga0126313_111769402 | 3300009840 | Serpentine Soil | MVADIAKLSVGREEYYTRELATDHEQYLSGHGESPDRWYGAGANGLGLEGEA |
| Ga0126305_105208661 | 3300010036 | Serpentine Soil | VVADIAKLSVGREAYYTRELATDHEQYLSGHGESPGRWYGAGASSLGL |
| Ga0126305_105281541 | 3300010036 | Serpentine Soil | VRRVVADIAKLSVGREEYYTRELATDHEQYLSGHGES |
| Ga0126305_108973371 | 3300010036 | Serpentine Soil | VVADIAKLSVGREAYYTRELATDHQAYLSGHGESAGRWYGAGAA |
| Ga0126315_110918701 | 3300010038 | Serpentine Soil | MAVERGDRVVADLAKLSVGREDYYVREVAENREEYLSGHG |
| Ga0126312_101928591 | 3300010041 | Serpentine Soil | VVADIAKLSVGREEYYTRELATDHEQYLSGQGESPGRWYGAGASSLGL |
| Ga0126312_112013251 | 3300010041 | Serpentine Soil | MVADIAKLSVGREAYYTRELATDHEAYLSGHGESPGRWYGAGAT |
| Ga0126312_113802951 | 3300010041 | Serpentine Soil | VVADIAKLSVGREECYTRELATDHEQYLSGHGESPGRWYGAGAASLGLQGEASVCRGSSACSGAA |
| Ga0126314_100655631 | 3300010042 | Serpentine Soil | VVADIAKLTIGREEYYTRELATDHEQYLSGHGESPGRWYGAGASS |
| Ga0126314_102271882 | 3300010042 | Serpentine Soil | VVADIAKLSVGREEYYTRELATDHEQYLSGHGESPGRWYGAG |
| Ga0126314_108676701 | 3300010042 | Serpentine Soil | MVADIAKLSVGREAYDTRELATDHEAYLSGHGESPGRWYGAGATTLGLQ |
| Ga0126310_107241552 | 3300010044 | Serpentine Soil | VVADIAKLSVGREAYYTRELATDHEQYLSGHGESPGR |
| Ga0126311_111430301 | 3300010045 | Serpentine Soil | VVADIAKLSIGREEYYTRELATDHEQYLSGHGESP |
| Ga0126311_116424581 | 3300010045 | Serpentine Soil | VVADIAKLSVGREEYYTRELASDHEAYLSGHGESPGRWYGAAANGLGLEGEAS |
| Ga0126306_110400832 | 3300010166 | Serpentine Soil | VVADIAKLSVGREEYYTRELATDHEAYLCGHGESPG |
| Ga0126306_113827171 | 3300010166 | Serpentine Soil | VVADIAKLSVGREEYYTRELATDHEAYLSGHGESPGRWYGAGATSLGL |
| Ga0120192_100050024 | 3300012021 | Terrestrial | VVADVAKLSVGREEYDTRELATDHQAYLSGHGESP |
| Ga0137374_104085092 | 3300012204 | Vadose Zone Soil | VVADVAKLAMGREDYYTRELAADHEAYLSGHGESPGHW |
| Ga0137374_112309882 | 3300012204 | Vadose Zone Soil | VVADLHKLAVGREDYYTREIARNREEYLSGHGESPG |
| Ga0137380_103432791 | 3300012206 | Vadose Zone Soil | VVADVAKLAVGREEYYTRDLASDHQEYLSGHGESPGRWYGAGSAALGQEGE |
| Ga0137379_115385301 | 3300012209 | Vadose Zone Soil | VVADLHKLAVGREDYYTREIAKNREEYLSGHGESPGVFHG |
| Ga0137387_113281492 | 3300012349 | Vadose Zone Soil | MTADLRKLSAGRCDYYTREVARNREEYLSGHGESPGVFHG |
| Ga0137372_109593891 | 3300012350 | Vadose Zone Soil | VVADVHKLAVGREGYYTREIARNREEYLSGHGESPGV |
| Ga0137372_109878251 | 3300012350 | Vadose Zone Soil | MVADIAKLSVGREDYYVREVAGNREEYLSGHGESPG |
| Ga0137372_109959221 | 3300012350 | Vadose Zone Soil | MVADIAKLSVGREDYYIREVAGNREEYLSGHGESPGRWLGRG |
| Ga0137386_100038761 | 3300012351 | Vadose Zone Soil | VVADLHKLAVGREDYYTREIARNREEYLSGHGESPGVFHGGTGRHGAEHV |
| Ga0137367_100131271 | 3300012353 | Vadose Zone Soil | VVLDVAKLTAGREDYYLEKLADNREEYLSGHGESPGRWYGHGAR |
| Ga0137367_102252191 | 3300012353 | Vadose Zone Soil | VVLDVAKLTPGREDYYLERLADNREEYLSGHGESPGRWYGQ |
| Ga0137367_102986872 | 3300012353 | Vadose Zone Soil | VVADLARLSVGREDYYVREVAENREEYLSGHGESPGR |
| Ga0137367_110725811 | 3300012353 | Vadose Zone Soil | MVADIAKLSVGREDYYVREVAGNREEYLSGHGESPGRWLGRG |
| Ga0137367_110800992 | 3300012353 | Vadose Zone Soil | MVADIAKLSVGREDYYVREVANNREEYLSGHGESPG |
| Ga0137366_104762631 | 3300012354 | Vadose Zone Soil | VVVDVAKLSVGREDYYVREVAHNREEYLTGHGESP |
| Ga0137366_111499472 | 3300012354 | Vadose Zone Soil | VAADLHKLAVGREGYYTREIARNREEYLSGHGESPG |
| Ga0137366_111531241 | 3300012354 | Vadose Zone Soil | MVADIAKLSVGREDYYVREVAQNREEYLSGHGESPG |
| Ga0137371_106308491 | 3300012356 | Vadose Zone Soil | VVADLHKLAAGREHYYTREIARNREEYLSGHGESP |
| Ga0137368_107177041 | 3300012358 | Vadose Zone Soil | VVADLAKLSAGREDYYVREVAENREEYLSGHGESPGRWYGA |
| Ga0137368_107680141 | 3300012358 | Vadose Zone Soil | MVADIAKLSVGREDYYVREVANNREEYLSGHGESPGRWL |
| Ga0137385_105575452 | 3300012359 | Vadose Zone Soil | VVADVAKLAVGREEYYTRDLASDHQEYLSGHGESPGRW |
| Ga0137375_104441952 | 3300012360 | Vadose Zone Soil | VVADIAKLSVGREEYYTRELATDHEAYLSGHGESAGRWYGAGATTLAVRTVGSW* |
| Ga0137375_104773583 | 3300012360 | Vadose Zone Soil | VVADLAKLSVGREDYYVREIAHNREEYLSGHGESPGRWYGA |
| Ga0137375_112354971 | 3300012360 | Vadose Zone Soil | VVADLAKLSVGREDYYLREIAENREEYLSGHGESPGRWYGAG |
| Ga0137373_103838131 | 3300012532 | Vadose Zone Soil | VLDIAKLVAGRERYYVREIAHDRADYYTGHGEASGRWYGAKACSM |
| Ga0137373_111011252 | 3300012532 | Vadose Zone Soil | VAADLHKLAVGREGYYTREIARNREEYLSGHGESPGCSAVAAPAP |
| Ga0162653_1000838321 | 3300012937 | Soil | VVADIAKLSIGREAYYTRELATDHEAYLSGHGESPGRWYGAGA |
| Ga0182000_101576663 | 3300014487 | Soil | VVADIAKLSVGREEYYTRELATDHEQYLSGHGESPGRWCGAGASTSTLGLQGEASVAGF |
| Ga0182000_104027311 | 3300014487 | Soil | VVADIAKLSVGREEYYTRELATDHEAYLSGHGESPGRWYG |
| Ga0182000_106799651 | 3300014487 | Soil | MVADIAKLSVGREDYYTRELATDHEQYLSGHGESPGRWYGA |
| Ga0134085_101738421 | 3300015359 | Grasslands Soil | VGREEYYTRELATDHQQYLSGHGESPGRWYGAGASSL |
| Ga0184610_12734641 | 3300017997 | Groundwater Sediment | VVADIAKLSVGREEYYTRELATDHEAYLSGHGESPGRWYGAGAGSLR |
| Ga0184605_102694342 | 3300018027 | Groundwater Sediment | VVADIAKLSVGREAYYTRELATDHEQYLSGHGESPGRWYGAGATTLTLQGEASVA |
| Ga0184634_104795691 | 3300018031 | Groundwater Sediment | VVADVGKLSVGREEYYTRELATDHEAYLSGHGESPGR |
| Ga0184620_102654661 | 3300018051 | Groundwater Sediment | VADIAKLSIGREEYYTRELATDHEQYLSGHGESPGRWY |
| Ga0184619_101093682 | 3300018061 | Groundwater Sediment | VVADIAKLTVGREDYYLRELATDHEQYLSGHGESPGRWYGAGARSLG |
| Ga0184624_100500432 | 3300018073 | Groundwater Sediment | MVADIAKLSIGREAYYTRELATDHEAYLSGHGESPGRWYG |
| Ga0184624_101148352 | 3300018073 | Groundwater Sediment | VVADIAKLSVGREAYYTRELATDHEAYLSGHGESPGRWYGAGATSLGL |
| Ga0184612_100174891 | 3300018078 | Groundwater Sediment | VVADIAKLSVGREEYYTRELAENHEEYLSGHGESPGR |
| Ga0184625_100770014 | 3300018081 | Groundwater Sediment | VVADVAKLSVGREEYYTRELATDHEQYLSGHGVSPGRWYGAGATSLGLQGE |
| Ga0184625_100920421 | 3300018081 | Groundwater Sediment | VVADIAKLSVGREEYYTRELATDHEAYLSGHGESPGRWY |
| Ga0190275_109478351 | 3300018432 | Soil | VADIAKLSVGREAYYTRELATDHEQYLSGHGESPGRWYGAAATTLGLE |
| Ga0190268_103417731 | 3300018466 | Soil | VVADIAKLSVGREAYYTRELATDHEQYLSGHGESPGRW |
| Ga0190268_123435851 | 3300018466 | Soil | VVADIAKLSVGREDYYTRELANDHEQYLSGHGESSSLWYGAGAT |
| Ga0190274_100887834 | 3300018476 | Soil | VVADIAKLSVGREEYYTRELATDHEAYLSGHGESPGRWYGAGAT |
| Ga0190274_102143111 | 3300018476 | Soil | DIAKLSVGREAYYTRELAKNHEEYLSGHGESPGRWYGTGATA |
| Ga0210378_100347803 | 3300021073 | Groundwater Sediment | VVADVAKLAVGREDYYTRELATDHEAYLSGHDTSRGRW |
| Ga0207675_1020986501 | 3300026118 | Switchgrass Rhizosphere | VVADIAKLSVGREEYYTRELATDHEQYLSGHGESPGRW |
| Ga0208074_1008531 | 3300026707 | Soil | VVADIAKLSVGREEYYTRELATDHEQYLSGHGESPGRWYGQGAASL |
| Ga0209896_10255541 | 3300027006 | Groundwater Sand | VVADVAKLAVGRQDYYTRELADSHEQYLSGHGESPGR |
| Ga0209879_10813411 | 3300027056 | Groundwater Sand | VVADIAKLSVGREEYYTRELATDHEAYLSGHGESPGRWYGASASSLGL |
| Ga0209861_10230652 | 3300027332 | Groundwater Sand | AVGREDYYTRELADSHEAYLSGHDTSRGRWCGHHATALGLQGEASV |
| Ga0209842_10014905 | 3300027379 | Groundwater Sand | VVADVAKLAVGREDYYTRELADSHEAYLSGHDTSRGRWCGHHATALGLQGEASV |
| Ga0209843_10430792 | 3300027511 | Groundwater Sand | VVADIAKLSVGREAYYTRELATDHEAYLSGHGESPGRWYGAGANSLG |
| Ga0209874_10052121 | 3300027577 | Groundwater Sand | VVADIAKLSVGREEYYTRELATDHEAYLSGHGESPGRWYGASASSLGLQGEASVA |
| Ga0209795_101794632 | 3300027718 | Agave | VVADLAKLSVGREDYYVREVAHNREEYLSGHGESPGRWYGA |
| Ga0209814_101649901 | 3300027873 | Populus Rhizosphere | VVADVAKLSVGREEYYTRELATDHEAYLSGHGESPGQWYGAGADSLG |
| Ga0307295_102045721 | 3300028708 | Soil | VVADIAKLSAGRGEYYTRELANDHEQYLSGHGESPGRWY |
| Ga0307301_100750492 | 3300028719 | Soil | VVADIAKLSVGREEYYTRELATDHQQYLSGHGESPG |
| Ga0307319_101275622 | 3300028722 | Soil | MVVDVAKLPAGREAYYTREIAENREEYLSGHGESPGRWY |
| Ga0307318_100008921 | 3300028744 | Soil | VVADIAKLSVGREEYYTRELATDHEAYLSGHGESPGRWYGA |
| Ga0307318_102546771 | 3300028744 | Soil | VVADIAKLSVGREEYYTRELATDHEQYLSGHGESPGRWYGA |
| Ga0307316_101190511 | 3300028755 | Soil | VADIAKLSIGREEYYTRELATDHEQYLSGHGESPG |
| Ga0307288_102289622 | 3300028778 | Soil | VVADIAKLSVGREAYYTRELATDHEQYLSGHGESPGRWYGAG |
| Ga0307323_100050273 | 3300028787 | Soil | VADIAKLSVGREEYYTRELATDHQQYLSGHGESPWPQRRARL |
| Ga0307290_100210715 | 3300028791 | Soil | AKLSVGREEYYTRELATDHEAYLSGHGESPGRWYGASARALGCVSKVIAIR |
| Ga0307290_100291621 | 3300028791 | Soil | VVADIAKLSVGREAYYTRELATDHEQYLSGHGESPGRWYGAGADTLGL |
| Ga0307278_100526572 | 3300028878 | Soil | VVADIAKLSVGREEYYTRELATDHEAYLSGHGESPGRWYGAGASS |
| Ga0307300_100098202 | 3300028880 | Soil | MVADIAKLSVGREEYYTRELATDHEQYLSGHGESPGRWYGAGASTLGLQG |
| Ga0307277_105880452 | 3300028881 | Soil | VVADIAKLAVGREAYYTRELATDHEQYLSGHGESPGRWYGAGASSLG |
| Ga0307308_102402861 | 3300028884 | Soil | VVVDVAKLAVGREEYYLREIAGSHEEYLSGHGESPGRWYGA |
| Ga0268243_10061494 | 3300030510 | Soil | VVADITKLSLSREAYYARELATDHEQYLSGHGESP |
| Ga0268243_10369891 | 3300030510 | Soil | VADIAKLSVGREEYYTRELAENHEQYLSGHGESPGRWYGAGPST |
| Ga0268255_100596002 | 3300030516 | Agave | VVADIAKLSVGREEYYTRELATDHEAYLSGHGESPGRWYGAGAR |
| Ga0307408_1008550902 | 3300031548 | Rhizosphere | VVADIAKLSVGREEYYTRELATDHEAYLSGHGESPGRWYGAGATALG |
| Ga0307405_102928212 | 3300031731 | Rhizosphere | VVADIAKLSVGREAYYTRALATDHEQYLSGHGESPGRWYGAGLLG |
| Ga0307405_111155942 | 3300031731 | Rhizosphere | VVADIAKLSIGREEYYTRELATDHEQYLSGHGESPGRWYGAAASSLGL |
| Ga0307405_115011401 | 3300031731 | Rhizosphere | VVADIAKLSVGREEYYTRELATDHEQYLSGHGESP |
| Ga0307410_107920241 | 3300031852 | Rhizosphere | VVADIAKLSVGREEYYTRELATDHEAYLSGHGESPG |
| Ga0307410_114076151 | 3300031852 | Rhizosphere | VVADIAKLSVGREAYYTRELATDHEAYLSGHGESPGRWYGAGATS |
| Ga0307406_106216773 | 3300031901 | Rhizosphere | VVADIAKLSVGREAYYTRELATDHEQYLSGHGESPGRWYGAGASS |
| Ga0307406_119229091 | 3300031901 | Rhizosphere | VVADIAKLSVGREEYYTRELATDHQQYLSGHGESPGRW |
| Ga0307407_100692601 | 3300031903 | Rhizosphere | VVADLAKLSVGREDYYVREVAHNREEYLSGHGESPG |
| Ga0307412_115843741 | 3300031911 | Rhizosphere | VVADIAKLSIGREAYYTRELATDHEQYLSGHGESPGRWYG |
| Ga0307409_1019229542 | 3300031995 | Rhizosphere | VVADIAKLSVGREGYYTRELATDHEQYLSGHGESPGRWY |
| Ga0307416_1002800911 | 3300032002 | Rhizosphere | VVADIAKLSMGREAYYTRELATDHEQYLSGHGESPGRWYGAGATTLGMQ |
| Ga0307416_1002931023 | 3300032002 | Rhizosphere | VADIAKLSVGREEYYTRELATDHQAYLSGHGESPGRWYGA |
| Ga0307416_1016717582 | 3300032002 | Rhizosphere | VVADIAKLSVGREEYYTRELATDHEAYLSGHGERPGRWYGAGA |
| Ga0307414_108245361 | 3300032004 | Rhizosphere | VVADIAKLLVGREEYYTRELATDHEAYLSGHGESPGRWYGAGA |
| Ga0307411_123410421 | 3300032005 | Rhizosphere | MVADVAKLAVGREDYYTRELATDHEQYLSGHGESPGRWYGA |
| Ga0307415_1001964361 | 3300032126 | Rhizosphere | VVADIAKLSVGREEYYTRELATDHQAYLSGHGESPGRWYGAGASSLGL |
| Ga0307415_1005689061 | 3300032126 | Rhizosphere | VVADIAKLSVGREEYYTRELATDHEAYLSGHGESPGRWYGAGARALGL |
| Ga0307415_1007449532 | 3300032126 | Rhizosphere | VVADIAKLSVGREEYYTRELATDHEQYLSGHGESPGRWYGAGATSLGL |
| Ga0307415_1023208991 | 3300032126 | Rhizosphere | VVADLAKLSVGREDYYVREVAHNREEYLSGHGESSGRWYGAGAA |
| Ga0268251_101033902 | 3300032159 | Agave | VAKLSVGREEYYTRELATDHEQYLSGHGESPGRWYGADAASLGLQGE |
| Ga0268251_104507712 | 3300032159 | Agave | VAADLHKLAVGREGYYTREIAKNREEYLSGHGESPGVFHGGSAAAL |
| Ga0334913_008648_1_105 | 3300034172 | Sub-Biocrust Soil | MVADIAKLSVGREAYYTRELATDHEAYLSGHGESP |
| Ga0334932_003231_2454_2597 | 3300034174 | Sub-Biocrust Soil | VVADIAKLSVGREAYYTRELATDHQQYLSGHGESPGRWYGAGASTLGL |
| Ga0334932_052821_3_110 | 3300034174 | Sub-Biocrust Soil | MVADIAKLSVGREEYYTRELATDHEQYLSGHGESPG |
| ⦗Top⦘ |