| Basic Information | |
|---|---|
| Family ID | F050095 |
| Family Type | Metagenome |
| Number of Sequences | 145 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MDWIDIVVGGIVAIFIVGGCLALYADAVNHPWGEDDE |
| Number of Associated Samples | 82 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 95.17 % |
| % of genes near scaffold ends (potentially truncated) | 8.97 % |
| % of genes from short scaffolds (< 2000 bps) | 67.59 % |
| Associated GOLD sequencing projects | 68 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (45.517 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater (53.793 % of family members) |
| Environment Ontology (ENVO) | Unclassified (91.034 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (93.103 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 67.57% β-sheet: 0.00% Coil/Unstructured: 32.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF13392 | HNH_3 | 6.21 |
| PF04404 | ERF | 4.83 |
| PF00182 | Glyco_hydro_19 | 3.45 |
| PF01653 | DNA_ligase_aden | 3.45 |
| PF05772 | NinB | 2.76 |
| PF09588 | YqaJ | 2.07 |
| PF03118 | RNA_pol_A_CTD | 1.38 |
| PF01844 | HNH | 1.38 |
| PF03245 | Phage_lysis | 1.38 |
| PF03237 | Terminase_6N | 1.38 |
| PF04851 | ResIII | 1.38 |
| PF13362 | Toprim_3 | 1.38 |
| PF07120 | DUF1376 | 0.69 |
| PF00535 | Glycos_transf_2 | 0.69 |
| PF00145 | DNA_methylase | 0.69 |
| PF12224 | Amidoligase_2 | 0.69 |
| PF13872 | AAA_34 | 0.69 |
| PF01139 | RtcB | 0.69 |
| PF01464 | SLT | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG0272 | NAD-dependent DNA ligase | Replication, recombination and repair [L] | 3.45 |
| COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 3.45 |
| COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 3.45 |
| COG0202 | DNA-directed RNA polymerase, alpha subunit/40 kD subunit | Transcription [K] | 1.38 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.69 |
| COG1690 | RNA-splicing ligase RtcB, repairs tRNA damage | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG3756 | Uncharacterized conserved protein YdaU, DUF1376 family | Function unknown [S] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 54.48 % |
| Unclassified | root | N/A | 45.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000176|TB03JUN2009E_c001542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5798 | Open in IMG/M |
| 3300000203|TB18AUG2009E_c002055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3319 | Open in IMG/M |
| 3300000203|TB18AUG2009E_c002295 | All Organisms → Viruses → Predicted Viral | 3123 | Open in IMG/M |
| 3300000203|TB18AUG2009E_c002722 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2824 | Open in IMG/M |
| 3300000439|TBL_comb48_EPIDRAFT_1012795 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4374 | Open in IMG/M |
| 3300000439|TBL_comb48_EPIDRAFT_1047625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1560 | Open in IMG/M |
| 3300000553|TBL_comb47_HYPODRAFT_10000429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 55613 | Open in IMG/M |
| 3300000553|TBL_comb47_HYPODRAFT_10066887 | Not Available | 2016 | Open in IMG/M |
| 3300002091|JGI24028J26656_1001229 | Not Available | 6004 | Open in IMG/M |
| 3300002091|JGI24028J26656_1001842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4325 | Open in IMG/M |
| 3300002091|JGI24028J26656_1024577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
| 3300002092|JGI24218J26658_1009436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1677 | Open in IMG/M |
| 3300002092|JGI24218J26658_1010288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1561 | Open in IMG/M |
| 3300002098|JGI24219J26650_1014195 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1205 | Open in IMG/M |
| 3300003375|JGI26470J50227_1003409 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4827 | Open in IMG/M |
| 3300003375|JGI26470J50227_1059152 | Not Available | 642 | Open in IMG/M |
| 3300003375|JGI26470J50227_1061989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
| 3300003787|Ga0007811_1000137 | Not Available | 10915 | Open in IMG/M |
| 3300003789|Ga0007835_1004842 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1382 | Open in IMG/M |
| 3300004684|Ga0065168_1004765 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2168 | Open in IMG/M |
| 3300004685|Ga0065177_1092009 | Not Available | 562 | Open in IMG/M |
| 3300004686|Ga0065173_1007448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2032 | Open in IMG/M |
| 3300004687|Ga0065174_1032984 | Not Available | 980 | Open in IMG/M |
| 3300004770|Ga0007804_1014855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2228 | Open in IMG/M |
| 3300004807|Ga0007809_10085141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 978 | Open in IMG/M |
| 3300006071|Ga0007876_1010971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2605 | Open in IMG/M |
| 3300006071|Ga0007876_1029501 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1519 | Open in IMG/M |
| 3300006071|Ga0007876_1043640 | Not Available | 1222 | Open in IMG/M |
| 3300006071|Ga0007876_1072610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 909 | Open in IMG/M |
| 3300006071|Ga0007876_1085654 | Not Available | 823 | Open in IMG/M |
| 3300006071|Ga0007876_1131832 | Not Available | 633 | Open in IMG/M |
| 3300006071|Ga0007876_1150416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
| 3300006072|Ga0007881_1036757 | Not Available | 1306 | Open in IMG/M |
| 3300006072|Ga0007881_1148957 | Not Available | 571 | Open in IMG/M |
| 3300006100|Ga0007806_1045941 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 845 | Open in IMG/M |
| 3300006101|Ga0007810_1000958 | Not Available | 8433 | Open in IMG/M |
| 3300006101|Ga0007810_1094808 | Not Available | 576 | Open in IMG/M |
| 3300006103|Ga0007813_1111431 | Not Available | 521 | Open in IMG/M |
| 3300006105|Ga0007819_1018386 | Not Available | 1693 | Open in IMG/M |
| 3300006105|Ga0007819_1029501 | Not Available | 1261 | Open in IMG/M |
| 3300006108|Ga0007862_1017180 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1632 | Open in IMG/M |
| 3300006108|Ga0007862_1027859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1225 | Open in IMG/M |
| 3300006112|Ga0007857_1001900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5586 | Open in IMG/M |
| 3300006113|Ga0007858_1020560 | Not Available | 1515 | Open in IMG/M |
| 3300006113|Ga0007858_1053153 | Not Available | 866 | Open in IMG/M |
| 3300006115|Ga0007816_1025459 | Not Available | 1372 | Open in IMG/M |
| 3300006116|Ga0007807_1049044 | Not Available | 834 | Open in IMG/M |
| 3300006118|Ga0007859_1021443 | All Organisms → Viruses → Predicted Viral | 1420 | Open in IMG/M |
| 3300006118|Ga0007859_1100867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
| 3300006119|Ga0007866_1033441 | All Organisms → Viruses → Predicted Viral | 1014 | Open in IMG/M |
| 3300006119|Ga0007866_1042885 | Not Available | 870 | Open in IMG/M |
| 3300006121|Ga0007824_1113463 | Not Available | 508 | Open in IMG/M |
| 3300006124|Ga0007873_1043913 | Not Available | 744 | Open in IMG/M |
| 3300006128|Ga0007828_1012038 | Not Available | 1837 | Open in IMG/M |
| 3300006128|Ga0007828_1013525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1729 | Open in IMG/M |
| 3300006128|Ga0007828_1022157 | Not Available | 1334 | Open in IMG/M |
| 3300006128|Ga0007828_1060579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 785 | Open in IMG/M |
| 3300006129|Ga0007834_1103779 | Not Available | 600 | Open in IMG/M |
| 3300009502|Ga0114951_10036661 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3073 | Open in IMG/M |
| 3300009502|Ga0114951_10089765 | Not Available | 1766 | Open in IMG/M |
| 3300009502|Ga0114951_10233211 | Not Available | 971 | Open in IMG/M |
| 3300009502|Ga0114951_10379976 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 708 | Open in IMG/M |
| 3300013093|Ga0164296_1020226 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4190 | Open in IMG/M |
| 3300013093|Ga0164296_1024198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3633 | Open in IMG/M |
| 3300013093|Ga0164296_1233801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
| 3300013093|Ga0164296_1255751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
| 3300020689|Ga0214210_1010901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 824 | Open in IMG/M |
| 3300020689|Ga0214210_1016565 | Not Available | 626 | Open in IMG/M |
| 3300020692|Ga0214224_1004844 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1333 | Open in IMG/M |
| 3300020714|Ga0214182_1000499 | All Organisms → cellular organisms → Bacteria | 14974 | Open in IMG/M |
| 3300020716|Ga0214207_1000028 | Not Available | 46121 | Open in IMG/M |
| 3300020716|Ga0214207_1000996 | Not Available | 7302 | Open in IMG/M |
| 3300020716|Ga0214207_1011004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1195 | Open in IMG/M |
| 3300020716|Ga0214207_1017381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 884 | Open in IMG/M |
| 3300020718|Ga0214178_1000018 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 55232 | Open in IMG/M |
| 3300020726|Ga0214220_1007499 | Not Available | 1949 | Open in IMG/M |
| 3300020727|Ga0214246_1066073 | Not Available | 515 | Open in IMG/M |
| 3300020729|Ga0214251_1056176 | Not Available | 592 | Open in IMG/M |
| 3300020731|Ga0214170_1000846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9361 | Open in IMG/M |
| 3300020733|Ga0214172_1031065 | Not Available | 809 | Open in IMG/M |
| 3300020735|Ga0214219_1020922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1076 | Open in IMG/M |
| 3300020735|Ga0214219_1036918 | Not Available | 735 | Open in IMG/M |
| 3300020735|Ga0214219_1053119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
| 3300021124|Ga0214199_1012091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1010 | Open in IMG/M |
| 3300021131|Ga0214206_1000765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8306 | Open in IMG/M |
| 3300021131|Ga0214206_1001685 | Not Available | 5004 | Open in IMG/M |
| 3300021131|Ga0214206_1002589 | Not Available | 3704 | Open in IMG/M |
| 3300021131|Ga0214206_1009119 | Not Available | 1467 | Open in IMG/M |
| 3300021134|Ga0214171_1040684 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 616 | Open in IMG/M |
| 3300021137|Ga0214165_1044513 | Not Available | 982 | Open in IMG/M |
| 3300021139|Ga0214166_1008164 | All Organisms → Viruses → Predicted Viral | 3131 | Open in IMG/M |
| 3300021139|Ga0214166_1064539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 768 | Open in IMG/M |
| 3300022591|Ga0236341_1000231 | Not Available | 35265 | Open in IMG/M |
| 3300022592|Ga0236342_1005734 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4707 | Open in IMG/M |
| 3300022594|Ga0236340_1010261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2963 | Open in IMG/M |
| 3300022602|Ga0248169_114731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5391 | Open in IMG/M |
| 3300022602|Ga0248169_141315 | All Organisms → Viruses → Predicted Viral | 2225 | Open in IMG/M |
| 3300025336|Ga0208619_117892 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300025357|Ga0208383_1000231 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10855 | Open in IMG/M |
| 3300025357|Ga0208383_1025509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
| 3300025357|Ga0208383_1039907 | Not Available | 527 | Open in IMG/M |
| 3300025358|Ga0208504_1000319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12285 | Open in IMG/M |
| 3300025358|Ga0208504_1016235 | Not Available | 1033 | Open in IMG/M |
| 3300025366|Ga0208505_1004586 | Not Available | 2169 | Open in IMG/M |
| 3300025366|Ga0208505_1028164 | Not Available | 741 | Open in IMG/M |
| 3300025369|Ga0208382_1011369 | All Organisms → Viruses → Predicted Viral | 1384 | Open in IMG/M |
| 3300025372|Ga0207957_1013074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1100 | Open in IMG/M |
| 3300025379|Ga0208738_1000204 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18398 | Open in IMG/M |
| 3300025379|Ga0208738_1001226 | Not Available | 5845 | Open in IMG/M |
| 3300025379|Ga0208738_1004553 | Not Available | 2647 | Open in IMG/M |
| 3300025379|Ga0208738_1020062 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1070 | Open in IMG/M |
| 3300025381|Ga0208871_1002493 | Not Available | 4087 | Open in IMG/M |
| 3300025381|Ga0208871_1019984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1014 | Open in IMG/M |
| 3300025381|Ga0208871_1021831 | Not Available | 956 | Open in IMG/M |
| 3300025382|Ga0208256_1036974 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 690 | Open in IMG/M |
| 3300025383|Ga0208250_1018944 | Not Available | 1176 | Open in IMG/M |
| 3300025387|Ga0207959_1012019 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1524 | Open in IMG/M |
| 3300025396|Ga0208874_1000443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14881 | Open in IMG/M |
| 3300025405|Ga0208381_1019925 | Not Available | 1066 | Open in IMG/M |
| 3300025416|Ga0208877_1001727 | All Organisms → Viruses → Predicted Viral | 4995 | Open in IMG/M |
| 3300025417|Ga0208616_1005251 | Not Available | 2282 | Open in IMG/M |
| 3300025418|Ga0208253_1008037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2559 | Open in IMG/M |
| 3300025418|Ga0208253_1013645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1770 | Open in IMG/M |
| 3300025418|Ga0208253_1051449 | Not Available | 696 | Open in IMG/M |
| 3300025421|Ga0207958_1002149 | Not Available | 4727 | Open in IMG/M |
| 3300025421|Ga0207958_1048959 | Not Available | 618 | Open in IMG/M |
| 3300025426|Ga0208739_1023060 | All Organisms → Viruses → Varidnaviria → Bamfordvirae → Nucleocytoviricota → Megaviricetes → Imitervirales → Mimiviridae → unclassified Mimiviridae → Klosneuvirinae → Klosneuvirus → Klosneuvirus KNV1 | 1097 | Open in IMG/M |
| 3300025450|Ga0208744_1038218 | Not Available | 983 | Open in IMG/M |
| 3300025450|Ga0208744_1073403 | Not Available | 667 | Open in IMG/M |
| 3300025598|Ga0208379_1032456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1423 | Open in IMG/M |
| 3300025598|Ga0208379_1125657 | Not Available | 595 | Open in IMG/M |
| 3300025598|Ga0208379_1155244 | Not Available | 514 | Open in IMG/M |
| 3300025781|Ga0208386_1007571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1911 | Open in IMG/M |
| 3300025789|Ga0208499_1026084 | Not Available | 1035 | Open in IMG/M |
| 3300027896|Ga0209777_10139423 | Not Available | 2013 | Open in IMG/M |
| 3300027896|Ga0209777_10265184 | Not Available | 1344 | Open in IMG/M |
| 3300027896|Ga0209777_10274109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1316 | Open in IMG/M |
| 3300027896|Ga0209777_10478535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 922 | Open in IMG/M |
| 3300027896|Ga0209777_10666816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 744 | Open in IMG/M |
| 3300027896|Ga0209777_11220726 | Not Available | 501 | Open in IMG/M |
| 3300029798|Ga0239581_1129629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
| 3300031813|Ga0316217_10237242 | Not Available | 731 | Open in IMG/M |
| 3300031813|Ga0316217_10277216 | Not Available | 657 | Open in IMG/M |
| 3300032560|Ga0316223_1053544 | All Organisms → Viruses → Predicted Viral | 1574 | Open in IMG/M |
| 3300032665|Ga0316221_1079322 | Not Available | 1241 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 53.79% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 16.55% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 9.66% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.83% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 4.14% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 4.14% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.14% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater | 2.07% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000176 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300000203 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300000439 | Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300000553 | Trout Bog Lake May 28 2007 Hypolimnion (Trout Bog Lake Combined Assembly 47 Hypolimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
| 3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
| 3300002098 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome | Environmental | Open in IMG/M |
| 3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
| 3300003787 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 | Environmental | Open in IMG/M |
| 3300003789 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 | Environmental | Open in IMG/M |
| 3300004684 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (version 2) | Environmental | Open in IMG/M |
| 3300004685 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (version 2) | Environmental | Open in IMG/M |
| 3300004686 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (version 2) | Environmental | Open in IMG/M |
| 3300004687 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul08 (version 2) | Environmental | Open in IMG/M |
| 3300004770 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 | Environmental | Open in IMG/M |
| 3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
| 3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
| 3300006072 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 | Environmental | Open in IMG/M |
| 3300006100 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 | Environmental | Open in IMG/M |
| 3300006101 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 | Environmental | Open in IMG/M |
| 3300006103 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 | Environmental | Open in IMG/M |
| 3300006105 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 | Environmental | Open in IMG/M |
| 3300006108 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 | Environmental | Open in IMG/M |
| 3300006112 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 | Environmental | Open in IMG/M |
| 3300006113 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Aug08 | Environmental | Open in IMG/M |
| 3300006115 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 | Environmental | Open in IMG/M |
| 3300006116 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE12Aug09 | Environmental | Open in IMG/M |
| 3300006118 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 | Environmental | Open in IMG/M |
| 3300006119 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 | Environmental | Open in IMG/M |
| 3300006121 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE05Oct08 | Environmental | Open in IMG/M |
| 3300006124 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH26May08 | Environmental | Open in IMG/M |
| 3300006128 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 | Environmental | Open in IMG/M |
| 3300006129 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE06Nov07 | Environmental | Open in IMG/M |
| 3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
| 3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
| 3300020689 | Freshwater microbial communities from Trout Bog Lake, WI - 03AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300020692 | Freshwater microbial communities from Trout Bog Lake, WI - 10SEP2007 hypolimnion | Environmental | Open in IMG/M |
| 3300020714 | Freshwater microbial communities from Trout Bog Lake, WI - 14NOV2007 epilimnion | Environmental | Open in IMG/M |
| 3300020716 | Freshwater microbial communities from Trout Bog Lake, WI - 13JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300020718 | Freshwater microbial communities from Trout Bog Lake, WI - 17SEP2007 epilimnion | Environmental | Open in IMG/M |
| 3300020726 | Freshwater microbial communities from Trout Bog Lake, WI - 31JUL2007 hypolimnion | Environmental | Open in IMG/M |
| 3300020727 | Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 hypolimnion | Environmental | Open in IMG/M |
| 3300020729 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 hypolimnion | Environmental | Open in IMG/M |
| 3300020731 | Freshwater microbial communities from Trout Bog Lake, WI - 27JUN2007 epilimnion | Environmental | Open in IMG/M |
| 3300020733 | Freshwater microbial communities from Trout Bog Lake, WI - 12JUL2007 epilimnion | Environmental | Open in IMG/M |
| 3300020735 | Freshwater microbial communities from Trout Bog Lake, WI - 25JUL2007 hypolimnion | Environmental | Open in IMG/M |
| 3300021124 | Freshwater microbial communities from Trout Bog Lake, WI - 04OCT2008 epilimnion | Environmental | Open in IMG/M |
| 3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300021134 | Freshwater microbial communities from Trout Bog Lake, WI - 02JUL2007 epilimnion | Environmental | Open in IMG/M |
| 3300021137 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021139 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300022591 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2 | Environmental | Open in IMG/M |
| 3300022592 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S3 | Environmental | Open in IMG/M |
| 3300022594 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S1 | Environmental | Open in IMG/M |
| 3300022602 | Freshwater microbial communities from Trout Bog Lake, Vilas County, Wisconsin, United States - 30JULY2014 epilimnion | Environmental | Open in IMG/M |
| 3300025336 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025357 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025358 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025366 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jul08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025369 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025372 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025379 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025381 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025382 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025383 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025387 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025396 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025405 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE13Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025416 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH29Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025417 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025418 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025421 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025426 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025450 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025598 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025781 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025789 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300029798 | Freshwater lake microbial communities from Alinen Mustajarvi, Finland - AM11 | Environmental | Open in IMG/M |
| 3300031813 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - 1anoA | Environmental | Open in IMG/M |
| 3300032560 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18009 | Environmental | Open in IMG/M |
| 3300032665 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18007 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB03JUN2009E_00154215 | 3300000176 | Freshwater | MMDWIDIIVGGVVAIFIVGGCLALYADATNHPWEDSDD* |
| TB18AUG2009E_0020557 | 3300000203 | Freshwater | MDWIDIIVGGIVAIFIVGGCLALYADAVNHPWGEDE* |
| TB18AUG2009E_0022957 | 3300000203 | Freshwater | MDWIDIIVGGIVAIFIVGGCLALYADATNHPWENSDD* |
| TB18AUG2009E_0027227 | 3300000203 | Freshwater | MDWIDIIVGGIVAIFIVGGCLALYADAINHPWGEDDEH* |
| TBL_comb48_EPIDRAFT_10127955 | 3300000439 | Freshwater | MMDWIDIIVGGIVAIFIVGGCLALYSDAINHPWEDSDD* |
| TBL_comb48_EPIDRAFT_10476252 | 3300000439 | Freshwater | MDWIDIVVGGIVAIFIVGGCLALYADATSHPWEDSDD* |
| TBL_comb47_HYPODRAFT_1000042981 | 3300000553 | Freshwater | MDWIDIIVGGVVAIFIVGGCLALYADATNHPWEDSDD* |
| TBL_comb47_HYPODRAFT_100668875 | 3300000553 | Freshwater | MDWIDIIVGGIVAIFIVGGCLALYADATNHPWEDSDD* |
| JGI24028J26656_100122911 | 3300002091 | Lentic | MDFIDWIVAIVVTVFVVGGALALYADAVKHPWGEDDEH* |
| JGI24028J26656_100184212 | 3300002091 | Lentic | MMDWIDIIVGGIVAIFIVGGCLALYADATSHPWEDSDEH* |
| JGI24028J26656_10245772 | 3300002091 | Lentic | MDWIDIVVGGIVAIFIVGGCLALYADATSHPWGDSDEH* |
| JGI24218J26658_10094365 | 3300002092 | Lentic | MMDWIDIVVGGIVAIFIVGGCLALYADATSHPWGDSDEH* |
| JGI24218J26658_10102883 | 3300002092 | Lentic | MDWIDIIVGGIVAIFIVGGCLALYADATSHPWEDSDEH* |
| JGI24219J26650_10141953 | 3300002098 | Lentic | MDWIDILVGIIVTVFIVGGALALYADAVNHPWENKDD* |
| JGI26470J50227_10034091 | 3300003375 | Freshwater | MTDWIDIVVGGIVVIFIVGGALALYADAINHPWGEDDEH* |
| JGI26470J50227_10591521 | 3300003375 | Freshwater | MMDWIDIVVGGIVAIFIVGGCLALYADAINHPWGEDDEH* |
| JGI26470J50227_10619891 | 3300003375 | Freshwater | TWRQMMDWIDIVVGGIVAIFIVGGCLALYADATSHPWEDSDD* |
| Ga0007811_100013721 | 3300003787 | Freshwater | MMDWIDIVVGGIVAIFIVGGCLALYADAVNHPWGEDDDH* |
| Ga0007835_10048423 | 3300003789 | Freshwater | MTDWIDIVVGGIVVIFIVGGCLALYADAVNHPWGEDDEH* |
| Ga0065168_10047657 | 3300004684 | Freshwater | MMDWIDIIVGGIVAIFIVGGCLALYADATNHPWGEDDEH* |
| Ga0065177_10920091 | 3300004685 | Freshwater | QMMDWIDIVVGGIVAIFIVGGCLALYADAVNHPWAEDDENVNKE* |
| Ga0065173_10074485 | 3300004686 | Freshwater | MDFIDWIVAIVVTVFVVGGALALYADAVGKHPWEGEDDEH* |
| Ga0065174_10329843 | 3300004687 | Freshwater | MDWIDIVVGGIVAIFIVGGCLALYADAVNHPWAEDDENVNKE* |
| Ga0007804_10148556 | 3300004770 | Freshwater | MMDWIDIIVGGIVAIFIVGGCLALYADATSHPWGEDDEH* |
| Ga0007809_100851412 | 3300004807 | Freshwater | MMDWIDIVVGSIVAIFIVGGCLALYADAVNHPWGEDDEH* |
| Ga0007876_10109716 | 3300006071 | Freshwater | MMDWIDIVVGGIVAIFIVGGCLALYADATNHPWENSDD* |
| Ga0007876_10295012 | 3300006071 | Freshwater | MDWIDIIVGGIVAIFIVGGCLALYADATIHPWEDSDD* |
| Ga0007876_10436402 | 3300006071 | Freshwater | MDWIDIVVGGIVAIFIVGGCLALYADAVNHPWEDSDD* |
| Ga0007876_10726104 | 3300006071 | Freshwater | MDWIDIIVGGIVAIFIVGGCLALYADAVNHPWGEDDEH* |
| Ga0007876_10856542 | 3300006071 | Freshwater | MDWIDIVVGGIVAIFIVGGCLALYADATNHPWEDSDD* |
| Ga0007876_11318321 | 3300006071 | Freshwater | MMDWIDIVVGGIIAIFIVGGCLALYADAVNHPWEDSDD* |
| Ga0007876_11504162 | 3300006071 | Freshwater | MDWIDIIVGGIVAIFIVGGCLALYADATSHPWEDSDD* |
| Ga0007881_10367573 | 3300006072 | Freshwater | MMDWIDIIVGGIVAIFIVGGCLALYADATSHPWEDSDD* |
| Ga0007881_11489573 | 3300006072 | Freshwater | MDWIDIVVGGIVAIFIVGGCLALYADAVNHPWGEDDE* |
| Ga0007806_10459414 | 3300006100 | Freshwater | MDWIDIVVGGIVAIFIVGGCLALYADATSHPWEDSDDH* |
| Ga0007810_10009589 | 3300006101 | Freshwater | MDWIDIIVGGIVAIFIVGGCLALYADATNHPWGEDDEH* |
| Ga0007810_10948083 | 3300006101 | Freshwater | MTDWIDIFVGVIVVLFIVGGCLALYADAINHPWGEDE* |
| Ga0007813_11114311 | 3300006103 | Freshwater | MDWIDIIVGGIVAIFIVGGCLALYADAVSHPWGEDDEH* |
| Ga0007819_10183863 | 3300006105 | Freshwater | MTDWIDIFVGVIVVLFIVGGVLALYADAINHPWGEDE* |
| Ga0007819_10295015 | 3300006105 | Freshwater | MDWIDIVVGGIIAIFIVGGCLALYADAVNHPWEDSDD* |
| Ga0007862_10171806 | 3300006108 | Freshwater | MDWIDIVVGGIVAIFIVGGCLALYADAVSHPWGEDDER* |
| Ga0007862_10278592 | 3300006108 | Freshwater | MTDWIDIFVGVIVVLFIVGGCLALYADAINHPWGEDDE* |
| Ga0007857_10019002 | 3300006112 | Freshwater | MTDWIDIFVGGIVVIFIVGGCLALYSDAINHPWGKDDEH* |
| Ga0007858_10205602 | 3300006113 | Freshwater | MDWIDIVVGGIVAIFIVGGALALYADAVNHPWENSDD* |
| Ga0007858_10531531 | 3300006113 | Freshwater | MMDWIDIVVGGIVAIFIVGGCLALYADAVNYPWGEDDE* |
| Ga0007816_10254592 | 3300006115 | Freshwater | MDWIDIVVGGIVAIFIVGGCLALYADAVNHPWEDSDDH* |
| Ga0007807_10490442 | 3300006116 | Freshwater | MMDWIDIVVGGIVAIFIVGGCLALYADAVNHPWGEDDE* |
| Ga0007859_10214436 | 3300006118 | Freshwater | MDWIDIIVGGIVAIFIVGGCLALYADATNHPWADSDD* |
| Ga0007859_11008672 | 3300006118 | Freshwater | MMDWIDIIVGGIVAIFIVGGCLALYADATSHPWENSDE* |
| Ga0007866_10334411 | 3300006119 | Freshwater | MMDWIDIVVGGIVAIFIVGGCLALYADAVSHPWGEDDE* |
| Ga0007866_10428853 | 3300006119 | Freshwater | MDWIDIVVGGIVAIFIVGGCLALYADATNHPWADSDD* |
| Ga0007824_11134632 | 3300006121 | Freshwater | RRQMMDWIDIIVGGIVAIFIVGGCLALYADATNHPWSEDENE* |
| Ga0007873_10439132 | 3300006124 | Freshwater | MMDWIDIVVGGIVAIFIVGGCLALYADAVNHPWGEDDEH* |
| Ga0007828_10120387 | 3300006128 | Freshwater | MMDWIDIVVGGIVAIFIVGGCLALYSDAINHPWGEDDEH* |
| Ga0007828_10135256 | 3300006128 | Freshwater | MTDWIDIFVGVIVVLFIVGGVLALYADAINHPWGEDDE* |
| Ga0007828_10221573 | 3300006128 | Freshwater | MDWIDIIVGGIVAIFIVGGCLALYADAVSHPWKDSDD* |
| Ga0007828_10605793 | 3300006128 | Freshwater | MDWIDIIVGGIVAIFIVGGCLALYSDAINHPWGEDDE* |
| Ga0007834_11037792 | 3300006129 | Freshwater | MMDWIDIVVGGIVAIFIVGGCLALYADAVSHPWGEDDEH* |
| Ga0114951_1003666110 | 3300009502 | Freshwater | MMDWIDIIVGGIVAIFIVGGCLALYADATSHPWED |
| Ga0114951_100897656 | 3300009502 | Freshwater | MMDWIDIVVGGIVAIFIVGGCLALYADATSHPWEDSDD* |
| Ga0114951_102332112 | 3300009502 | Freshwater | MMDWIDIVVGGIVAIFIVGGCLALYADATSHPWGEDDEH* |
| Ga0114951_103799762 | 3300009502 | Freshwater | MMDWIDIIVGGIVAIFIVGGCLALYADATSYPWKDSDD* |
| Ga0164296_102022613 | 3300013093 | Freshwater | MDWIDIVVGGIVAIFIVGGCLALYADAINHPWGEDDDH* |
| Ga0164296_10241986 | 3300013093 | Freshwater | MDWIDWIVAIVVSVFIVGGGLALYADAVNHPWGEDDDH* |
| Ga0164296_12338012 | 3300013093 | Freshwater | MMDWIDIVVGGIVAIFIVGGCLALYADAVNHPWEDSDDH* |
| Ga0164296_12557513 | 3300013093 | Freshwater | MMDWIDIVVGGIVAIFIVGGCLALYADATNHPWEDSDD* |
| Ga0214210_10109013 | 3300020689 | Freshwater | MMDWIDIVVGGIVAIFIVGGCLALYADAINHPWGEDDE |
| Ga0214210_10165652 | 3300020689 | Freshwater | MDWIDIIVGGIVAIFIVGGCLALYADVVNHPWGEDE |
| Ga0214224_10048443 | 3300020692 | Freshwater | MDWIDIVVGGIVAIFIVGGCLALYADATSHPWEDSDG |
| Ga0214182_100049928 | 3300020714 | Freshwater | MDWIDIVVGGIVAIFIVGGCLALYADAVNHPWGEDDEH |
| Ga0214207_100002846 | 3300020716 | Freshwater | MDWIDIIVGGIVAIFIVGGCLALYADAVNHPWGEDE |
| Ga0214207_10009965 | 3300020716 | Freshwater | MDWIDIIVGGIVAIFIVGGCLALYADAINHPWGEDDEH |
| Ga0214207_10110044 | 3300020716 | Freshwater | MMDWIDIIVGGVVAIFIVGGCLALYADATNHPWEDSDD |
| Ga0214207_10173813 | 3300020716 | Freshwater | MMDWIDIIVGGIVAIFIVGGCLALYADATSHLWGEDDE |
| Ga0214178_10000187 | 3300020718 | Freshwater | MDWIDIIVGGVVAIFIVGGCLALYADATNHPWEDSDD |
| Ga0214220_10074995 | 3300020726 | Freshwater | MDWIDIVVGGIVAIFIVGGCLALYADATSHPWEDSDD |
| Ga0214246_10660733 | 3300020727 | Freshwater | MMDWIDIVVGGIVAIFMVGGCLALYADAINHPWGEDDE |
| Ga0214251_10561761 | 3300020729 | Freshwater | MDWIDIIVGGIVAIFIVGGCLALYADAINHPWGEDD |
| Ga0214170_10008464 | 3300020731 | Freshwater | MTDWIDIVVGGIVVIFIVGGCLALYSDAINHPWGEDDEH |
| Ga0214172_10310652 | 3300020733 | Freshwater | MDWIDIIVGGIVAIFIVGGCLALYADATNHPWADSDD |
| Ga0214219_10209222 | 3300020735 | Freshwater | MMDWIDIVVGGIVAIFIVGGCLALYADATSHPWEDSDD |
| Ga0214219_10369183 | 3300020735 | Freshwater | MDWIDIIVGGIVAIFIVGGCLALYADATNHPWEDSDD |
| Ga0214219_10531191 | 3300020735 | Freshwater | MMDWIDIVVGGIVAIFIVGGCLALYADAVNHPWGEDDEH |
| Ga0214199_10120913 | 3300021124 | Freshwater | MDWIDIVVGGIVAIFMVGGCLALYADAINHPWGEDDE |
| Ga0214206_100076514 | 3300021131 | Freshwater | MMDWIDIVVGGIVAIFIVGGCLALYADATSHPWENSDD |
| Ga0214206_10016853 | 3300021131 | Freshwater | MMDWIDIVVGGIVAIFIVGGCLALYADATSHPWGEDDEH |
| Ga0214206_10025898 | 3300021131 | Freshwater | MDWIDIIVGGIVAIFIVGGCLALYADAVNHPWGEDDEH |
| Ga0214206_10091195 | 3300021131 | Freshwater | MTDWIDIFVGVIVVLFIVGGCLALYADAVNHPWEEDE |
| Ga0214171_10406842 | 3300021134 | Freshwater | MTDWIDIVVGGIVAIFIVGGCLALYADATSHPWEDSDD |
| Ga0214165_10445132 | 3300021137 | Freshwater | MDWIDIVVGGIVAIFIVGGCLALYADAINHPWGEDDEH |
| Ga0214166_10081647 | 3300021139 | Freshwater | MDWIDIIVGGIVAIFIVGGCLALYADATNHPWENSDD |
| Ga0214166_10645393 | 3300021139 | Freshwater | MDWIDIVVGGIVAIFIVGGCLALYADATSHLWGEDDE |
| Ga0236341_100023127 | 3300022591 | Freshwater | MDWIDIIVGGIVAIFIVGGCLALYADAVSHPWGEDDEH |
| Ga0236342_10057344 | 3300022592 | Freshwater | MMDWIDIIVGGIVAIFIVGGCLALYADAVSHPWGEDDEH |
| Ga0236340_10102616 | 3300022594 | Freshwater | MMDWIDIIVGGIVAIFIVGGCLAVYADAVSHPWGEDDEH |
| Ga0248169_1147311 | 3300022602 | Freshwater | MDWIDIIVGGIVAIFIVGGCLALYADATSHPWEDSDD |
| Ga0248169_1413155 | 3300022602 | Freshwater | MDWIDIIVGGIVAIFIVGGCLALYADAVNHPWGEDDE |
| Ga0208619_1178922 | 3300025336 | Freshwater | MMDWIDIIVGGIVAIFIVGGCLALYADATSHPWENSDE |
| Ga0208383_100023117 | 3300025357 | Freshwater | MTDWIDIVVGGIVVIFIVGGCLALYADAVNHPWGEDDEH |
| Ga0208383_10255092 | 3300025357 | Freshwater | MTDWIDIFVGVIVVLFIVGGCLALYADAINHPWGEDDE |
| Ga0208383_10399072 | 3300025357 | Freshwater | MDWIDIIVGGIVAIFIVGGCLALYADAVSHPWKDSDD |
| Ga0208504_100031915 | 3300025358 | Freshwater | MDWIDIIVGGIVAIFIVGGCLALYADATNHPWGEDDEH |
| Ga0208504_10162352 | 3300025358 | Freshwater | MDWIDIIVGGIVAIFIVGGCLALYADATSHPWGEDDEH |
| Ga0208505_10045867 | 3300025366 | Freshwater | MDWIDIVVGGIVAIFIVGGCLALYADAVSHPWGEDDER |
| Ga0208505_10281642 | 3300025366 | Freshwater | MDWIDIVVGGIIAIFIVGGCLALYADAVNHPWEDSDD |
| Ga0208382_10113696 | 3300025369 | Freshwater | MDWIDIVVGGIVAIFIVGGALALYADAVNHPWENSDD |
| Ga0207957_10130742 | 3300025372 | Freshwater | MMDWIDIVVGSIVAIFIVGGCLALYADAVNHPWGEDDEH |
| Ga0208738_100020421 | 3300025379 | Freshwater | MMDWIDIVVGGIVAIFIVGGCLALYADAVNHPWGEDDDH |
| Ga0208738_10012265 | 3300025379 | Freshwater | MDWIDIVVGGIVAIFIVGGCLALYADATNHPWEDSDD |
| Ga0208738_10045534 | 3300025379 | Freshwater | MDWIDIVVGGIVAIFIVGGCLALYADAVNHPWAEDDENVNKE |
| Ga0208738_10200621 | 3300025379 | Freshwater | MDWIDIIVGGIVAIFIVGGCLALYADATSHPWGEDDDH |
| Ga0208871_10024936 | 3300025381 | Freshwater | MTDWIDIFVGVIVVLFIVGGCLALYADAINHPWGEDE |
| Ga0208871_10199844 | 3300025381 | Freshwater | MMDWIDIIVGGIVAIFIVGGCLALYADATSHPWGEDDDH |
| Ga0208871_10218313 | 3300025381 | Freshwater | MDWIDIVVGGIVAIFIVGGCLALYADAVNHPWGEDDE |
| Ga0208256_10369742 | 3300025382 | Freshwater | MMDWIDIIVGGIVAIFIVGGCLALYSDAINHPWEDSDD |
| Ga0208250_10189442 | 3300025383 | Freshwater | MDWIDIIVGGIVAIFIVGGCLALYADATIHPWEDSDD |
| Ga0207959_10120194 | 3300025387 | Freshwater | MTDWIDIFVGVIVVLFIVGGVLALYADAINHPWGEDE |
| Ga0208874_10004432 | 3300025396 | Freshwater | MDWIDIIVGGIVAIFIVGGCLALYADATSHPWENSDE |
| Ga0208381_10199251 | 3300025405 | Freshwater | VGGIVAIFIVGGCLALYADAVNHPWAEDDENVNKE |
| Ga0208877_100172711 | 3300025416 | Freshwater | MMDWIDIIVGGIVAIFIVGGCLALYADATSHPWEDSDD |
| Ga0208616_10052516 | 3300025417 | Freshwater | MTDWIDIFVGVIVVLFIVGGVLALYADAINHPWGEDDE |
| Ga0208253_10080377 | 3300025418 | Freshwater | MDWIDIIVGGIVAIFIVGGCLALYADATNHPWSEDENE |
| Ga0208253_10136452 | 3300025418 | Freshwater | MDFIDWIVAIVVTVFVVGGALALYADAVGKHPWEGEDDEH |
| Ga0208253_10514492 | 3300025418 | Freshwater | MMDWIDIVVGGIVAIFIVGGCLALYADAINHPWGEDDEH |
| Ga0207958_100214914 | 3300025421 | Freshwater | MTDWIDIFVGGIVVIFIVGGCLALYADAVNHPWGEDDDH |
| Ga0207958_10489592 | 3300025421 | Freshwater | MMDWIDIIVGGIVAIFIVGGCLALYADATNHPWADSDD |
| Ga0208739_10230605 | 3300025426 | Freshwater | MDWIDIVVGGIVAIFIVGGCLALYADAVNHPWEDSDDH |
| Ga0208744_10382183 | 3300025450 | Freshwater | MDWIDIVVGGIVAIFIVGGCLALYADAVNHPWEDSDD |
| Ga0208744_10734033 | 3300025450 | Freshwater | MMDWIDIVVGGIIAIFIVGGCLALYADAVNHPWEDSDD |
| Ga0208379_10324564 | 3300025598 | Freshwater | MDWIDIVVGGIVAIFIVGGCLALYADATNHPWADSDD |
| Ga0208379_11256571 | 3300025598 | Freshwater | MDWIDIVVGGIVAIFIVGGCLALYADAVSHPWGEDD |
| Ga0208379_11552441 | 3300025598 | Freshwater | MDWIDIVVGGIVAIFIVGGCLALYADAVSHPWGEDDE |
| Ga0208386_10075711 | 3300025781 | Freshwater | MMDWIDIVVGGIVAIFIVGGCLALYADAVNNPWGEDDEH |
| Ga0208499_10260841 | 3300025789 | Freshwater | MTDWIDIFVGVIVVLFIVGGCLALYADAINHPWGED |
| Ga0209777_101394238 | 3300027896 | Freshwater Lake Sediment | MDWIDIVVGGIVAIFIVGGCLALYADATSHPWENSDE |
| Ga0209777_102651844 | 3300027896 | Freshwater Lake Sediment | MMDWIDIVVGGIVAIFIVGGCLALYADATNHPWEDSDD |
| Ga0209777_102741094 | 3300027896 | Freshwater Lake Sediment | MDWIDIIVGGIVAIFIVGGCLALYADAVNHPWAEDENE |
| Ga0209777_104785352 | 3300027896 | Freshwater Lake Sediment | MDWIDIVVGGIVAIFIIGGCLALYADAVSHPWGEDDEH |
| Ga0209777_106668161 | 3300027896 | Freshwater Lake Sediment | MDWIDIIVGGIVAIFIVGGCLALYADATSHLWEDSDD |
| Ga0209777_112207261 | 3300027896 | Freshwater Lake Sediment | MMDWIDIIVGGIVAIFIVGGCLALYADAINHPWGEDDE |
| Ga0239581_11296293 | 3300029798 | Freshwater Lake | MDWIDIVVGGIVAIFIVGGCLALYADATSHPWEDKD |
| Ga0316217_102372423 | 3300031813 | Freshwater | MMDWIDVIVGGIVAVFIVGGCLALYADATSHPWEDSDD |
| Ga0316217_102772162 | 3300031813 | Freshwater | MDWIDIIVGGIVAIFIVGGCLALYADATSHPWGEDDE |
| Ga0316223_10535442 | 3300032560 | Freshwater | MDWIDVIVGGIVAVFIVGGCLALYADATSHPWEDSDD |
| Ga0316221_10793223 | 3300032665 | Freshwater | MDWIDIVVGGIVAIFIVGGCLALYSDAVNHPWEDSDD |
| ⦗Top⦘ |