| Basic Information | |
|---|---|
| Family ID | F049900 |
| Family Type | Metagenome |
| Number of Sequences | 146 |
| Average Sequence Length | 36 residues |
| Representative Sequence | VGLNPFRQARRSPADYVMVAVAVVVCVALVAWALFG |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 146 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 39.16 % |
| % of genes near scaffold ends (potentially truncated) | 8.90 % |
| % of genes from short scaffolds (< 2000 bps) | 75.34 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.068 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (23.973 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.082 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.096 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.94% β-sheet: 0.00% Coil/Unstructured: 64.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 146 Family Scaffolds |
|---|---|---|
| PF02021 | UPF0102 | 22.60 |
| PF00378 | ECH_1 | 21.23 |
| PF13541 | ChlI | 15.07 |
| PF00300 | His_Phos_1 | 10.27 |
| PF01245 | Ribosomal_L19 | 3.42 |
| PF01746 | tRNA_m1G_MT | 1.37 |
| PF00318 | Ribosomal_S2 | 1.37 |
| PF01654 | Cyt_bd_oxida_I | 0.68 |
| PF13083 | KH_4 | 0.68 |
| PF13683 | rve_3 | 0.68 |
| PF02881 | SRP54_N | 0.68 |
| PF00905 | Transpeptidase | 0.68 |
| PF10502 | Peptidase_S26 | 0.68 |
| PF13442 | Cytochrome_CBB3 | 0.68 |
| PF02899 | Phage_int_SAM_1 | 0.68 |
| PF10611 | DUF2469 | 0.68 |
| PF13365 | Trypsin_2 | 0.68 |
| PF06259 | Abhydrolase_8 | 0.68 |
| PF08659 | KR | 0.68 |
| PF00886 | Ribosomal_S16 | 0.68 |
| PF01243 | Putative_PNPOx | 0.68 |
| PF02481 | DNA_processg_A | 0.68 |
| PF00903 | Glyoxalase | 0.68 |
| PF07859 | Abhydrolase_3 | 0.68 |
| PF01569 | PAP2 | 0.68 |
| PF00034 | Cytochrom_C | 0.68 |
| PF05193 | Peptidase_M16_C | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
|---|---|---|---|
| COG0792 | Predicted endonuclease distantly related to archaeal Holliday junction resolvase, YraN/UPF0102 family | Replication, recombination and repair [L] | 22.60 |
| COG0335 | Ribosomal protein L19 | Translation, ribosomal structure and biogenesis [J] | 3.42 |
| COG0052 | Ribosomal protein S2 | Translation, ribosomal structure and biogenesis [J] | 1.37 |
| COG0758 | Predicted Rossmann fold nucleotide-binding protein DprA/Smf involved in DNA uptake | Replication, recombination and repair [L] | 1.37 |
| COG0228 | Ribosomal protein S16 | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.68 |
| COG1271 | Cytochrome bd-type quinol oxidase, subunit 1 | Energy production and conversion [C] | 0.68 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.68 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.07 % |
| Unclassified | root | N/A | 34.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2070309009|GPKNP_GG3DY5402IDGRX | Not Available | 502 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_13193569 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300000956|JGI10216J12902_103871619 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300000956|JGI10216J12902_108607105 | Not Available | 687 | Open in IMG/M |
| 3300000956|JGI10216J12902_109594242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 981 | Open in IMG/M |
| 3300000956|JGI10216J12902_110460119 | Not Available | 609 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_109575282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 546 | Open in IMG/M |
| 3300001431|F14TB_100151031 | Not Available | 528 | Open in IMG/M |
| 3300005937|Ga0081455_10006425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12598 | Open in IMG/M |
| 3300006038|Ga0075365_10114307 | All Organisms → cellular organisms → Bacteria | 1857 | Open in IMG/M |
| 3300006038|Ga0075365_10571754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 799 | Open in IMG/M |
| 3300006038|Ga0075365_10670331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 733 | Open in IMG/M |
| 3300006042|Ga0075368_10275543 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300006049|Ga0075417_10320114 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300006051|Ga0075364_10048930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2755 | Open in IMG/M |
| 3300006057|Ga0075026_100441305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 739 | Open in IMG/M |
| 3300006172|Ga0075018_10503667 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300006178|Ga0075367_10770466 | Not Available | 612 | Open in IMG/M |
| 3300006844|Ga0075428_100675495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1101 | Open in IMG/M |
| 3300006844|Ga0075428_100969612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 901 | Open in IMG/M |
| 3300006845|Ga0075421_100000510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 40752 | Open in IMG/M |
| 3300006846|Ga0075430_100505205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 998 | Open in IMG/M |
| 3300006847|Ga0075431_100484902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales | 1229 | Open in IMG/M |
| 3300006852|Ga0075433_11574290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
| 3300006894|Ga0079215_11490210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 533 | Open in IMG/M |
| 3300006954|Ga0079219_12087560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Microthrixaceae → Candidatus Microthrix → Candidatus Microthrix parvicella | 542 | Open in IMG/M |
| 3300007004|Ga0079218_11410962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 745 | Open in IMG/M |
| 3300007517|Ga0105045_10036593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales | 4467 | Open in IMG/M |
| 3300007521|Ga0105044_10004413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 19334 | Open in IMG/M |
| 3300007521|Ga0105044_10300834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1519 | Open in IMG/M |
| 3300009094|Ga0111539_10093193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3538 | Open in IMG/M |
| 3300009094|Ga0111539_11920814 | Not Available | 686 | Open in IMG/M |
| 3300009095|Ga0079224_100153116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales | 3335 | Open in IMG/M |
| 3300009095|Ga0079224_101244024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1059 | Open in IMG/M |
| 3300009095|Ga0079224_103352763 | Not Available | 638 | Open in IMG/M |
| 3300009100|Ga0075418_10006060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13649 | Open in IMG/M |
| 3300009100|Ga0075418_10017746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter | 7866 | Open in IMG/M |
| 3300009100|Ga0075418_12544969 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300009120|Ga0117941_1082583 | Not Available | 871 | Open in IMG/M |
| 3300009153|Ga0105094_10050448 | Not Available | 2305 | Open in IMG/M |
| 3300009156|Ga0111538_10715144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1269 | Open in IMG/M |
| 3300009156|Ga0111538_11235191 | Not Available | 944 | Open in IMG/M |
| 3300009162|Ga0075423_12494046 | Not Available | 564 | Open in IMG/M |
| 3300009166|Ga0105100_10578064 | Not Available | 688 | Open in IMG/M |
| 3300009527|Ga0114942_1478281 | Not Available | 513 | Open in IMG/M |
| 3300009789|Ga0126307_10000470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 25854 | Open in IMG/M |
| 3300009789|Ga0126307_10029412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4217 | Open in IMG/M |
| 3300009807|Ga0105061_1029884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 765 | Open in IMG/M |
| 3300009870|Ga0131092_10102981 | All Organisms → cellular organisms → Bacteria | 3355 | Open in IMG/M |
| 3300010037|Ga0126304_10897108 | Not Available | 603 | Open in IMG/M |
| 3300010047|Ga0126382_11820011 | Not Available | 573 | Open in IMG/M |
| 3300010362|Ga0126377_12510524 | Not Available | 591 | Open in IMG/M |
| 3300010362|Ga0126377_12940895 | Not Available | 550 | Open in IMG/M |
| 3300010366|Ga0126379_12453355 | Not Available | 620 | Open in IMG/M |
| 3300012204|Ga0137374_10791072 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300012355|Ga0137369_10097902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2415 | Open in IMG/M |
| 3300012355|Ga0137369_10338304 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300012529|Ga0136630_1080997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1202 | Open in IMG/M |
| 3300012668|Ga0157216_10020249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3482 | Open in IMG/M |
| 3300012679|Ga0136616_10184050 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300012680|Ga0136612_10098680 | Not Available | 1479 | Open in IMG/M |
| 3300012915|Ga0157302_10154625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 783 | Open in IMG/M |
| 3300012973|Ga0123351_1190960 | Not Available | 800 | Open in IMG/M |
| 3300012973|Ga0123351_1233877 | Not Available | 698 | Open in IMG/M |
| 3300014314|Ga0075316_1047940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 921 | Open in IMG/M |
| 3300014326|Ga0157380_12056620 | Not Available | 633 | Open in IMG/M |
| 3300014326|Ga0157380_13265615 | Not Available | 518 | Open in IMG/M |
| 3300015163|Ga0167665_1000315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 17012 | Open in IMG/M |
| 3300015209|Ga0167629_1038417 | Not Available | 1660 | Open in IMG/M |
| 3300015209|Ga0167629_1089383 | Not Available | 953 | Open in IMG/M |
| 3300015371|Ga0132258_10523255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2969 | Open in IMG/M |
| 3300015373|Ga0132257_104213473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
| 3300017960|Ga0180429_10131211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1677 | Open in IMG/M |
| 3300018052|Ga0184638_1285997 | Not Available | 560 | Open in IMG/M |
| 3300018072|Ga0184635_10082477 | Not Available | 1262 | Open in IMG/M |
| 3300018422|Ga0190265_10012770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 6404 | Open in IMG/M |
| 3300018422|Ga0190265_10176204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2123 | Open in IMG/M |
| 3300018422|Ga0190265_11388030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 818 | Open in IMG/M |
| 3300018422|Ga0190265_11803001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 720 | Open in IMG/M |
| 3300018422|Ga0190265_13368912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 533 | Open in IMG/M |
| 3300018429|Ga0190272_10279851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1276 | Open in IMG/M |
| 3300018432|Ga0190275_10016456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5622 | Open in IMG/M |
| 3300018432|Ga0190275_10978442 | Not Available | 917 | Open in IMG/M |
| 3300018432|Ga0190275_11250355 | Not Available | 818 | Open in IMG/M |
| 3300018432|Ga0190275_12564628 | Not Available | 587 | Open in IMG/M |
| 3300018465|Ga0190269_10016368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3329 | Open in IMG/M |
| 3300018465|Ga0190269_10215213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1053 | Open in IMG/M |
| 3300018466|Ga0190268_10673849 | Not Available | 752 | Open in IMG/M |
| 3300018469|Ga0190270_10011834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4989 | Open in IMG/M |
| 3300018469|Ga0190270_10115463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2096 | Open in IMG/M |
| 3300018469|Ga0190270_10683356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1015 | Open in IMG/M |
| 3300018469|Ga0190270_10819934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 939 | Open in IMG/M |
| 3300018469|Ga0190270_10928069 | Not Available | 891 | Open in IMG/M |
| 3300018469|Ga0190270_11450783 | Not Available | 734 | Open in IMG/M |
| 3300018476|Ga0190274_11449110 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300018476|Ga0190274_12196252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 649 | Open in IMG/M |
| 3300018476|Ga0190274_13067495 | Not Available | 561 | Open in IMG/M |
| 3300018481|Ga0190271_10514354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1309 | Open in IMG/M |
| 3300018481|Ga0190271_10612989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1208 | Open in IMG/M |
| 3300018481|Ga0190271_11989688 | Not Available | 690 | Open in IMG/M |
| 3300018481|Ga0190271_12107831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 671 | Open in IMG/M |
| 3300018481|Ga0190271_13051081 | Not Available | 562 | Open in IMG/M |
| 3300019361|Ga0173482_10349306 | Not Available | 669 | Open in IMG/M |
| 3300019377|Ga0190264_12065538 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300019487|Ga0187893_10004574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 26107 | Open in IMG/M |
| 3300020509|Ga0208594_1000110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 27059 | Open in IMG/M |
| 3300022213|Ga0224500_10172561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 801 | Open in IMG/M |
| 3300022213|Ga0224500_10384217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 508 | Open in IMG/M |
| 3300022309|Ga0224510_10087330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1762 | Open in IMG/M |
| 3300025791|Ga0210115_1092544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 616 | Open in IMG/M |
| 3300026535|Ga0256867_10121673 | Not Available | 994 | Open in IMG/M |
| 3300027379|Ga0209842_1029130 | Not Available | 1045 | Open in IMG/M |
| 3300027823|Ga0209490_10104424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2054 | Open in IMG/M |
| 3300027831|Ga0209797_10035449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales | 2254 | Open in IMG/M |
| 3300027866|Ga0209813_10323917 | Not Available | 604 | Open in IMG/M |
| 3300027880|Ga0209481_10018202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales | 3082 | Open in IMG/M |
| 3300027897|Ga0209254_10620967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 758 | Open in IMG/M |
| 3300027909|Ga0209382_10039275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5675 | Open in IMG/M |
| (restricted) 3300027997|Ga0255057_10521563 | Not Available | 577 | Open in IMG/M |
| 3300028007|Ga0247718_1173790 | Not Available | 507 | Open in IMG/M |
| 3300028483|Ga0233377_1009537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2808 | Open in IMG/M |
| 3300028590|Ga0247823_10637713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 802 | Open in IMG/M |
| 3300028741|Ga0302256_10060127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 978 | Open in IMG/M |
| 3300028812|Ga0247825_10376488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia | 1000 | Open in IMG/M |
| 3300030336|Ga0247826_10187410 | Not Available | 1403 | Open in IMG/M |
| 3300030496|Ga0268240_10071213 | Not Available | 778 | Open in IMG/M |
| 3300031228|Ga0299914_10091169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales | 2664 | Open in IMG/M |
| 3300031228|Ga0299914_10201746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1764 | Open in IMG/M |
| 3300031229|Ga0299913_10011455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter | 7920 | Open in IMG/M |
| 3300031229|Ga0299913_10656750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1028 | Open in IMG/M |
| 3300031229|Ga0299913_10698586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales | 992 | Open in IMG/M |
| 3300031455|Ga0307505_10041286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2061 | Open in IMG/M |
| 3300031548|Ga0307408_101566595 | Not Available | 625 | Open in IMG/M |
| 3300031548|Ga0307408_101897251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 571 | Open in IMG/M |
| 3300031726|Ga0302321_102998020 | Not Available | 551 | Open in IMG/M |
| 3300031727|Ga0316576_10550946 | Not Available | 845 | Open in IMG/M |
| 3300031903|Ga0307407_10785747 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300031965|Ga0326597_10288627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1872 | Open in IMG/M |
| 3300033407|Ga0214472_11699433 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300033416|Ga0316622_100660621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium | 1207 | Open in IMG/M |
| 3300033417|Ga0214471_10213584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1582 | Open in IMG/M |
| 3300033417|Ga0214471_11148112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 593 | Open in IMG/M |
| 3300034148|Ga0364927_0045197 | Not Available | 1137 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 23.97% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 5.48% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 4.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.11% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 2.74% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.74% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 2.74% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.74% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 2.05% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 2.05% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.05% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.05% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 2.05% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.05% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.37% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.37% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.37% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.37% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.37% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.37% |
| Fecal | Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Fecal | 1.37% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.37% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.68% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.68% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.68% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.68% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.68% |
| Seawater | Environmental → Aquatic → Marine → Gulf → Unclassified → Seawater | 0.68% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.68% |
| Lake Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.68% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.68% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.68% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.68% |
| Elk Feces | Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Elk Feces | 0.68% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.68% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.68% |
| Anaerobic Biogas Reactor | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2070309009 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007517 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-02 (megahit assembly) | Environmental | Open in IMG/M |
| 3300007521 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009095 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009120 | Lake sediment microbial communities from Tanners Lake, St. Paul, MN | Environmental | Open in IMG/M |
| 3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009527 | Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold Creek | Environmental | Open in IMG/M |
| 3300009770 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_A C12 SIP DNA | Engineered | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009807 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 | Environmental | Open in IMG/M |
| 3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012529 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ568 (21.06) | Environmental | Open in IMG/M |
| 3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
| 3300012679 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ299 (21.06) | Environmental | Open in IMG/M |
| 3300012680 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06) | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012973 | Fecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung E36 Day 36 Metagenome | Host-Associated | Open in IMG/M |
| 3300014314 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015163 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb1b, glacier snout) | Environmental | Open in IMG/M |
| 3300015209 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G3B, Proglacial river margin, by glacier terminus) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017960 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_S_1 metaG | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300020509 | Freshwater microbial communities from Lake Mendota, WI - 14SEP2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022309 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300025791 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
| 3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027650 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeq | Environmental | Open in IMG/M |
| 3300027823 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-06 (SPAdes) | Environmental | Open in IMG/M |
| 3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027997 (restricted) | Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_6 | Environmental | Open in IMG/M |
| 3300028007 | Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 2-1-E_D | Environmental | Open in IMG/M |
| 3300028483 | Fecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung E36 | Host-Associated | Open in IMG/M |
| 3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
| 3300028741 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_4 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPKNP_01662660 | 2070309009 | Soil | MGLNPFGQQRRSAADYVMVVAAVVACILLVAWALFG |
| ICChiseqgaiiFebDRAFT_131935692 | 3300000363 | Soil | VGLNPFRQQRRSPADILMVVGALVVCVALVAWALFA* |
| JGI10216J12902_1038716192 | 3300000956 | Soil | MGLNPFRQIHRSPADYVMVVVAVLVCVALVAWAVLG* |
| JGI10216J12902_1086071052 | 3300000956 | Soil | LNPFRETHRSPADYLMVVVAVLICIALVAWALFG* |
| JGI10216J12902_1095942422 | 3300000956 | Soil | MLVAVGLNPFRQAHRSPADYVMVAVAVLVCVALVAWALFG* |
| JGI10216J12902_1104601192 | 3300000956 | Soil | VGLNPFRQARRSPADYLMVAVAVLVCIALVAWALFG* |
| JGIcombinedJ13530_1095752821 | 3300001213 | Wetland | PDRARILDVVGFNPFRQQRRSFADYAMVGGALIVLVLLVLWAFFG* |
| F14TB_1001510311 | 3300001431 | Soil | VGFNPFRKARRSSADYLMVATALVVCALLVIWALFG* |
| Ga0081455_100064256 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VGFNPFRQSRRSPADYVMVAAALVVCAALVIWALVG* |
| Ga0075365_101143073 | 3300006038 | Populus Endosphere | MNPFRPHRRSPADYVMVVAALLVVAALIAWAFLG* |
| Ga0075365_105717542 | 3300006038 | Populus Endosphere | MNPFRQHRRSPADYVMVAVAFAVIVALVLWAFFG* |
| Ga0075365_106703312 | 3300006038 | Populus Endosphere | VGLNPFRQARRSPADYVMVAVAVVVCVALVAWALFG* |
| Ga0075368_102755432 | 3300006042 | Populus Endosphere | MNPFRQHRRSPADYVMVAVAGVVILALVLWAFFG* |
| Ga0075417_103201142 | 3300006049 | Populus Rhizosphere | VGLNPFRQQRRSPADIVMVAGAIVVVVLLVAWALFG* |
| Ga0075364_100489303 | 3300006051 | Populus Endosphere | MNPFRQHRRSPADYVMVAAALLILAALVAWAFFG* |
| Ga0075026_1004413052 | 3300006057 | Watersheds | MNPFRPHRRSPADFVMVGAALLVVIGLVVWAIHG* |
| Ga0075018_105036672 | 3300006172 | Watersheds | MGMNPFRPPRRTPADYVMVAAALVVLAALVFWAVHG* |
| Ga0075367_107704662 | 3300006178 | Populus Endosphere | MNPFRQHRRSPADYVMVAVAAVVILALVLWAFFG* |
| Ga0075428_1006754952 | 3300006844 | Populus Rhizosphere | VGFNPFRQSRRSPADYVMVAAALVVCAALVIWALAG* |
| Ga0075428_1009696124 | 3300006844 | Populus Rhizosphere | DTDGVGLNPFRQQRRSPADIVMVAGAIVVVVLLVAWALFG* |
| Ga0075421_1000005108 | 3300006845 | Populus Rhizosphere | VGFNPFRQQRRSYADYVMVAAAIVICIVLVAWALFG* |
| Ga0075430_1005052052 | 3300006846 | Populus Rhizosphere | VGLNPFRQQRRSPADIVMVAGAIVVVILLVAWALFG* |
| Ga0075431_1004849022 | 3300006847 | Populus Rhizosphere | VGFNPFRQTRRSSADYVIVAAALVVCAALVIWALAG* |
| Ga0075433_115742902 | 3300006852 | Populus Rhizosphere | MDVGLNPFRQHRRSPADILLVAAAVAVCVALVAWALFA* |
| Ga0079215_114902103 | 3300006894 | Agricultural Soil | MNAVGFNPFRQQRRSSADYLMVAVAMVIIVALVAWGLFG* |
| Ga0079219_120875601 | 3300006954 | Agricultural Soil | MGLNPYRPHRRSPADYALVAGAVLVCVLLVAWALFG* |
| Ga0079218_114109622 | 3300007004 | Agricultural Soil | MGLNPFRQAHRSPADYVMVAVAILVCVALVAWAFFG* |
| Ga0105045_100365937 | 3300007517 | Freshwater | MNPFRPHRRSPADVVMVVAAVLVCAALVAWALFG* |
| Ga0105044_100044136 | 3300007521 | Freshwater | MNPFRQHRRSPADYVMVAAAFVVLAALVAWAFFG* |
| Ga0105044_103008342 | 3300007521 | Freshwater | MGLNPYRKHHRSPVDYVMVAGAVLACLALVLWAFLG* |
| Ga0111539_100931933 | 3300009094 | Populus Rhizosphere | VGLNPFRQHRRSPADILMVAVALVVCLALVLWALLG* |
| Ga0111539_119208142 | 3300009094 | Populus Rhizosphere | MGFNPFRAQRRSTGDYVMVAVAVVVCVLLVAWAVLG* |
| Ga0079224_1001531164 | 3300009095 | Agricultural Soil | MGRTILTGVGFNPFRPRRNSYADYLMVASALVVSAALVAWALFG* |
| Ga0079224_1012440242 | 3300009095 | Agricultural Soil | MGLNPFRPHRRSYGDLAVMAGALIVTAALVAWALLG* |
| Ga0079224_1033527632 | 3300009095 | Agricultural Soil | VGLNPFRQHRRSPADIAMVVGALLACAVLVAWALFG* |
| Ga0075418_100060604 | 3300009100 | Populus Rhizosphere | VGFNPFRKTRRSSADYLMVAAALAVCALLVIWALFG* |
| Ga0075418_100177463 | 3300009100 | Populus Rhizosphere | VGFNPFRQTRRSPADYVMVAVALVVCAALVIWALAG* |
| Ga0075418_125449692 | 3300009100 | Populus Rhizosphere | VGLNPFRQQRRSPVDYVLVAVALAVCVLLVAWAAFGL* |
| Ga0117941_10825832 | 3300009120 | Lake Sediment | MGLNPYRQRRRSPADYLMVAAAVVACLLLVLWAVLG* |
| Ga0105094_100504484 | 3300009153 | Freshwater Sediment | VGLNPFRQQRRSPADIVMLVAALAVCVALVAWALFA* |
| Ga0111538_107151441 | 3300009156 | Populus Rhizosphere | TDGVGLNPFRQQRRSPADIVMVAGAIVVVILLVAWALFG* |
| Ga0111538_112351911 | 3300009156 | Populus Rhizosphere | VGLNPFRQHRRSPADVLLVAAALLVCLALVAWALFG* |
| Ga0075423_124940462 | 3300009162 | Populus Rhizosphere | VGLNPFRQHRRSPADILMVVGALVVCVALVAWALFA* |
| Ga0105100_105780641 | 3300009166 | Freshwater Sediment | MGLNPFGPRRRSAADYLMVAGAVIACAVLVLWAFLG* |
| Ga0114942_14782812 | 3300009527 | Groundwater | MNPFRQHRRSPADYVMVAAALLILLALVAWAFFG* |
| Ga0123332_11229912 | 3300009770 | Anaerobic Biogas Reactor | MGFNPHRPHRNSIADYLMVGAALAVVVLLVLWAVFG* |
| Ga0126307_1000047021 | 3300009789 | Serpentine Soil | VGLNPFRQHRRSPADYLMVAVAVAVCLALVLWAALG* |
| Ga0126307_100294122 | 3300009789 | Serpentine Soil | VGLNPFRQHRRSPADYLMVAGAVVVCLALVLWAFFG* |
| Ga0105061_10298842 | 3300009807 | Groundwater Sand | VGFNPFRQTRRSPADYVMVAAALVACAALVIWALAG* |
| Ga0131092_101029814 | 3300009870 | Activated Sludge | VGFNPFRQQRRSFADYAMVGGALIVLTLLVLWALFG* |
| Ga0126304_108971082 | 3300010037 | Serpentine Soil | MGFNPHRPHRRSAADYVMVAAAFVVCIGLVLWAALG* |
| Ga0126382_118200112 | 3300010047 | Tropical Forest Soil | VGLNPFRQHRRSPGDILMVVAALVVCVALVLWALLG* |
| Ga0126377_125105242 | 3300010362 | Tropical Forest Soil | VGLNPFRQHRRSPADILLVAAAVAVCVALVAWALFG* |
| Ga0126377_129408952 | 3300010362 | Tropical Forest Soil | VGLNPFRQHRRSPADILMLAAALVVCVLLVAWALFG* |
| Ga0126379_124533552 | 3300010366 | Tropical Forest Soil | VGLNPFRQHRRSPADILLVAAAVAVCVALVAWALFA* |
| Ga0137374_107910722 | 3300012204 | Vadose Zone Soil | VGFNPFHQQRRSNADYVMVAAALVVCIALVAWALFG* |
| Ga0137369_100979026 | 3300012355 | Vadose Zone Soil | VGFNPFARHRRSAADYVMVAAALVLVVLLVAWALFG* |
| Ga0137369_103383042 | 3300012355 | Vadose Zone Soil | MGFNPFRQHRRSYADYVLVGLAVVVCVALVLWALFG* |
| Ga0136630_10809971 | 3300012529 | Polar Desert Sand | MGLNPFRLHRRTPADYLMVVGAVVVSLALVLWAFLG* |
| Ga0157216_100202493 | 3300012668 | Glacier Forefield Soil | MGLNPFRQHRRSAADYLMVAGAVLACVLLVVWALFG* |
| Ga0136616_101840501 | 3300012679 | Polar Desert Sand | VGLNPFRQHRRSPIDYVLVVAALLVCVLLVYWAAFGF* |
| Ga0136612_100986802 | 3300012680 | Polar Desert Sand | VGLNPFRQQRRTSVDYVMVAVALTVCLLLVAWAFFG* |
| Ga0157302_101546252 | 3300012915 | Soil | MLGQMGLNPFRQIHRSPFDYVMVALAVLVCVALVAWAFLG* |
| Ga0123351_11909602 | 3300012973 | Fecal | VGLNPFRQHRRSPADIVMVAAALLACVALVAWALFG* |
| Ga0123351_12338772 | 3300012973 | Fecal | MNPFRPHRRSPADYVMVAAAILVCLALVGWALFG* |
| Ga0075316_10479402 | 3300014314 | Natural And Restored Wetlands | VGLNPFRQQRRRPSDYVLVAGAMLLTLLLVAWGIGLIP* |
| Ga0157380_120566202 | 3300014326 | Switchgrass Rhizosphere | MNPFRQHRRSPADYVMVAAALLILVALVAWAFFG* |
| Ga0157380_132656152 | 3300014326 | Switchgrass Rhizosphere | MNPFRQHRRSPADYVMVAAAFVVLVALVAWAFFG* |
| Ga0167665_100031516 | 3300015163 | Glacier Forefield Soil | MGLNPFRQHRRSPADYLMVAGAVLACVLLVVWALFG* |
| Ga0167629_10384173 | 3300015209 | Glacier Forefield Soil | VGLNPFRQQRRSPADYVLVAAAVVVTLLLVLWALLG* |
| Ga0167629_10893832 | 3300015209 | Glacier Forefield Soil | VGLNPFRQQRRSPADYVLVAAAIVVTLLLVLWALLG* |
| Ga0132258_105232552 | 3300015371 | Arabidopsis Rhizosphere | VGLNPFRQTHRSPADYLMVVVAVLACVALVAWAILG* |
| Ga0132257_1042134732 | 3300015373 | Arabidopsis Rhizosphere | MRMGFNPFRHQRRSPADYVMVVAAFVIVALLVVWALFG* |
| Ga0180429_101312113 | 3300017960 | Hypersaline Lake Sediment | MGFNPHRTHRRSPADYVMVAGAFVVVILLVAWALLG |
| Ga0184638_12859972 | 3300018052 | Groundwater Sediment | MGFNPFHKRRPSYADYLLVGLAVAVCLALVLWALFG |
| Ga0184635_100824772 | 3300018072 | Groundwater Sediment | VGFNPFRQTRRSPADYVMVAAALVACAALVIWALAG |
| Ga0190265_100127704 | 3300018422 | Soil | MGLNPYRPHRRSPADIVMVVCALLACLALVLWALFG |
| Ga0190265_101762042 | 3300018422 | Soil | VGLNPFRHARHSPADYVMVAVAVLVCVALVVWAFVG |
| Ga0190265_113880302 | 3300018422 | Soil | MGLNPFRQQRRSSADYVMVAMAVLVCIALVVWAFAG |
| Ga0190265_118030012 | 3300018422 | Soil | VGLNPFRQHRRSPADIAMVVGALLVCVALVAWAIFA |
| Ga0190265_133689121 | 3300018422 | Soil | MGLNPFRQAHRSPADYVMVAVAILVCVALVAWALFG |
| Ga0190272_102798512 | 3300018429 | Soil | VGLNPFRQQRRSPVDYVLVAIALVVCVLLVAWAAFGL |
| Ga0190275_100164566 | 3300018432 | Soil | MGLNPFRQQRRSAADYLMVAGAIVVCILLVAWALFG |
| Ga0190275_109784422 | 3300018432 | Soil | VGLNPFRQARRSPVDYLMVAGAVLVCVALVVWAFLG |
| Ga0190275_112503551 | 3300018432 | Soil | MGLNPYRPHRTSAADVVMVVGALLACLALVLWALFG |
| Ga0190275_125646282 | 3300018432 | Soil | MGLNPFRQQRRSVVDYLMVAGAVVVCILLVAWALLG |
| Ga0190269_100163683 | 3300018465 | Soil | MGLNPFRQQRRSAADYLMVAGAVLACVLLVLWALLG |
| Ga0190269_102152134 | 3300018465 | Soil | MGLNPFRQHRRSAADYLMVAGAVVACLLLVLWALFG |
| Ga0190268_106738492 | 3300018466 | Soil | VGLNPFRQHRRSPADILMVAVALAVCVALVAWALLG |
| Ga0190270_100118344 | 3300018469 | Soil | VGLNPFRQHRRSPADVLMVAVALLVCAALVAWALFA |
| Ga0190270_101154632 | 3300018469 | Soil | VGFNPFRQTRRSPADYLMVGAALIVCAALVIWALAG |
| Ga0190270_106833562 | 3300018469 | Soil | VTVGLNPFRQTHRSPADYLMVAVAVLVCVALVAWALFG |
| Ga0190270_108199343 | 3300018469 | Soil | APMGMNPFRQHRRSPADYVMVAAALLILVALVAWAFFG |
| Ga0190270_109280692 | 3300018469 | Soil | MGFNPFRAQRRSTGDYVMVAVAVVVCVLLVAWAVLG |
| Ga0190270_114507832 | 3300018469 | Soil | VGLNPFRQAHRSPADYLMVAVAVLVCVALVAWAVFG |
| Ga0190274_114491102 | 3300018476 | Soil | VGLNPFRQHRRSPADILMVAVALLVCVALVAWALFA |
| Ga0190274_121962522 | 3300018476 | Soil | MGLNPFRQVHRSPLDYVMVALAVLVCLALVAWAFFG |
| Ga0190274_130674952 | 3300018476 | Soil | MGLNPFREVHRSPLDYVMVALAVLVCLALVAWAFFG |
| Ga0190271_105143543 | 3300018481 | Soil | MGLNPFGTRTHGWADYLMVAAAVVACLALVAWALLG |
| Ga0190271_106129893 | 3300018481 | Soil | MGLNPFGTRTHGWADYLMVAGAVVACLALVAWALLG |
| Ga0190271_119896882 | 3300018481 | Soil | MGLNPFRQVHRAPADYVIAALAVLVTVALVAWAFLG |
| Ga0190271_121078311 | 3300018481 | Soil | MLGRMGLNPFRQAHRAPADYVIAAVAILVCLALVAWAFFG |
| Ga0190271_130510812 | 3300018481 | Soil | AGRMGLNPFREVHRSPADYVIAALAILVIVALVAWAMFG |
| Ga0173482_103493062 | 3300019361 | Soil | MLGRMGLNPFREIHRSPFDYVMVALAVLVCVALVAWAFLG |
| Ga0190264_120655382 | 3300019377 | Soil | MGLNPFRQHRRSPADYLMVAGAVVVCLALVLWAFFG |
| Ga0187893_1000457414 | 3300019487 | Microbial Mat On Rocks | VGLNPFRQHRRSPIDYLLVATTLVVVAALVAWALFG |
| Ga0208594_100011026 | 3300020509 | Freshwater | MGFNPHRVHRRSAADYFMVAGAFIVVAALVVWALVG |
| Ga0224500_101725613 | 3300022213 | Sediment | GLNPYRKQRRSPADYVMVAGAVMACAALVLWALLG |
| Ga0224500_103842172 | 3300022213 | Sediment | MGLNPYRKQRRSPAYYVMVAGAVMACAALVLWALLG |
| Ga0224510_100873302 | 3300022309 | Sediment | MGLNPYRKQRRSPADYVMVAGAVMACAALVLWALLG |
| Ga0210115_10925442 | 3300025791 | Natural And Restored Wetlands | VGLNPFRQQRRRPSDYVLVAGAMLLTLLLVAWGIGLIP |
| Ga0256867_101216732 | 3300026535 | Soil | VGLNPFRQHRRSSADILMVAGALVVCAALVAWALLG |
| Ga0209842_10291301 | 3300027379 | Groundwater Sand | VGFNPFRQTRRPPADYVMVAAALVACAALVIWALAG |
| Ga0256866_10891681 | 3300027650 | Soil | VARRGHDTEPVGFNPFRQTRRSPADYVMVAAALVVCAAL |
| Ga0209490_101044243 | 3300027823 | Freshwater | MGLNPYRKHHRSPVDYVMVAGAVLACLALVLWAFLG |
| Ga0209797_100354492 | 3300027831 | Wetland Sediment | VGLNPFRQHRRTAADYLMVAAALVVCGLLVLWAFLG |
| Ga0209813_103239171 | 3300027866 | Populus Endosphere | AGYVADTEAMGMNPFRQHRRSPADYVMVAVAGVVILALVLWAFFG |
| Ga0209481_100182026 | 3300027880 | Populus Rhizosphere | VGFNPFRQQRRSYADYVMVAAAIVICIVLVAWALFG |
| Ga0209254_106209672 | 3300027897 | Freshwater Lake Sediment | MGLNPFHQHRRSAADYLMVAGAVVVCLVLVAWALLG |
| Ga0209253_105910053 | 3300027900 | Freshwater Lake Sediment | GAVGFNPQRPKRRSSADYLMVGAAAIVVVGLVVWALFG |
| Ga0209382_100392752 | 3300027909 | Populus Rhizosphere | VGFNPFRKARRSSADYLMVAAALAVCALLVIWALFG |
| (restricted) Ga0255057_105215631 | 3300027997 | Seawater | RILGAVGFNPFRAQSRSLGDYVMVASALVVTALLVAWALLG |
| Ga0247718_11737902 | 3300028007 | Soil | MGLNPFREQRRSAADYLLVAAAVAACVLLVLWALFG |
| Ga0233377_10095375 | 3300028483 | Elk Feces | VGLNPFRQHRRSPADIVMVAAALLACVALVAWALFG |
| Ga0247823_106377132 | 3300028590 | Soil | MGLNPFRQGRRGAADYLMVAGAVLVCILLVAWAFLG |
| Ga0302256_100601272 | 3300028741 | Fen | MGLNPFRPQHHSALDYLMVAAALLASAALVAWAFLG |
| Ga0247825_103764881 | 3300028812 | Soil | DTGAMGLNPFRQGRRGAADYLMVAGAVLVCILLVAWAFLG |
| Ga0247826_101874103 | 3300030336 | Soil | MGFNPFRAQRRSTGDYVMVAVAVLVCVLLVAWAVLG |
| Ga0268240_100712131 | 3300030496 | Soil | VGLNPFRQHCRSTADYVLVAAALAVCLALVLWAALG |
| Ga0299914_100911691 | 3300031228 | Soil | TDHVGLNPFHQHRRSPADIAMVVGALVVCAALVTWALLG |
| Ga0299914_102017464 | 3300031228 | Soil | MGLNPFRQQRRSPVDYLMVAGAVLACVLLVVWAMFG |
| Ga0299913_100114551 | 3300031229 | Soil | VGNTAAVGFNPFRQRRSTADYLMVAVALAICVALVVWAAAG |
| Ga0299913_106567502 | 3300031229 | Soil | MGLNPFRPNHRSYGDYVMVAGALVVCALLVVWALVG |
| Ga0299913_106985862 | 3300031229 | Soil | MGLNPFRQQRRSAVDYVMVAGAVLACVLLVLWAMFG |
| Ga0307505_100412864 | 3300031455 | Soil | MNPFRPHRSSPVADALFVGAALVVCAALVLWAFFG |
| Ga0307408_1015665952 | 3300031548 | Rhizosphere | MGMNPFRQHRRSPADYVMVAAALLILVALVAWAFFG |
| Ga0307408_1018972512 | 3300031548 | Rhizosphere | VGLNPFRQQRRSPVDYVLVAVALAVCVLLVAWAAFGL |
| Ga0302321_1029980201 | 3300031726 | Fen | MGMNPFRQHRRSPADYVMVGAALVVLAGLVFWAIHG |
| Ga0316576_105509462 | 3300031727 | Rhizosphere | GFNPHRKHRRSPADILFVVGALAVAVGLLAWALFG |
| Ga0307407_107857473 | 3300031903 | Rhizosphere | VGLNPFRQQRRSPVDYVLVAVALVVCVLLVAWAAFGL |
| Ga0326597_102886271 | 3300031965 | Soil | MGLNPFRQQRRSPADYVMVAAAVAACVLLVLWALFG |
| Ga0214472_116994332 | 3300033407 | Soil | EPMGLNPFRQQRRSPADYLMVVGAVLACILLVLWALLG |
| Ga0316622_1006606212 | 3300033416 | Soil | MGMNPFRQHRRSPADYLMVVAALVICALLVGWALFGG |
| Ga0214471_102135844 | 3300033417 | Soil | MGLNPFRQQRHSAADYLMVAAAVLACIVLVLWAVLG |
| Ga0214471_111481122 | 3300033417 | Soil | MGLNPFRQQRRSPVDYVMVAGAVLACVLLVLWAMFG |
| Ga0364927_0045197_417_527 | 3300034148 | Sediment | VGFNPFARHRRSTADYVMVAAAFAVVVLLLAWALFG |
| ⦗Top⦘ |