| Basic Information | |
|---|---|
| Family ID | F049779 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 146 |
| Average Sequence Length | 40 residues |
| Representative Sequence | DRGRDVVNQQKEQFRAAYEAGRQAYQEATTETGAPKNL |
| Number of Associated Samples | 135 |
| Number of Associated Scaffolds | 146 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.10 % |
| % of genes near scaffold ends (potentially truncated) | 95.21 % |
| % of genes from short scaffolds (< 2000 bps) | 86.30 % |
| Associated GOLD sequencing projects | 129 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.411 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.014 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.973 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.630 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.48% β-sheet: 0.00% Coil/Unstructured: 51.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 146 Family Scaffolds |
|---|---|---|
| PF03054 | tRNA_Me_trans | 10.96 |
| PF00578 | AhpC-TSA | 3.42 |
| PF00950 | ABC-3 | 1.37 |
| PF00106 | adh_short | 0.68 |
| PF02572 | CobA_CobO_BtuR | 0.68 |
| PF06081 | ArAE_1 | 0.68 |
| PF00285 | Citrate_synt | 0.68 |
| PF08818 | DUF1801 | 0.68 |
| PF00359 | PTS_EIIA_2 | 0.68 |
| PF13515 | FUSC_2 | 0.68 |
| PF02895 | H-kinase_dim | 0.68 |
| PF04632 | FUSC | 0.68 |
| PF14014 | DUF4230 | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
|---|---|---|---|
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 10.96 |
| COG0609 | ABC-type Fe3+-siderophore transport system, permease component | Inorganic ion transport and metabolism [P] | 1.37 |
| COG0643 | Chemotaxis protein histidine kinase CheA | Signal transduction mechanisms [T] | 1.37 |
| COG1108 | ABC-type Mn2+/Zn2+ transport system, permease component | Inorganic ion transport and metabolism [P] | 1.37 |
| COG4606 | ABC-type enterochelin transport system, permease component | Inorganic ion transport and metabolism [P] | 1.37 |
| COG0372 | Citrate synthase | Energy production and conversion [C] | 0.68 |
| COG1289 | Uncharacterized membrane protein YccC | Function unknown [S] | 0.68 |
| COG2109 | ATP:corrinoid adenosyltransferase | Coenzyme transport and metabolism [H] | 0.68 |
| COG4129 | Uncharacterized membrane protein YgaE, UPF0421/DUF939 family | Function unknown [S] | 0.68 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.68 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.68 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.41 % |
| Unclassified | root | N/A | 9.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886012|MBSR1b_contig_7972548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1563 | Open in IMG/M |
| 2170459010|GIO7OMY01C4UU0 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 501 | Open in IMG/M |
| 2228664022|INPgaii200_c0361849 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300001471|JGI12712J15308_10028345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1449 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100670198 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300004102|Ga0058888_1444675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 910 | Open in IMG/M |
| 3300004473|Ga0068919_1408791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 629 | Open in IMG/M |
| 3300004602|Ga0068960_1226832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 542 | Open in IMG/M |
| 3300004607|Ga0068948_1337504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 527 | Open in IMG/M |
| 3300005336|Ga0070680_101201367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 656 | Open in IMG/M |
| 3300005435|Ga0070714_100135880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2202 | Open in IMG/M |
| 3300005437|Ga0070710_10006606 | All Organisms → cellular organisms → Bacteria | 5577 | Open in IMG/M |
| 3300005454|Ga0066687_10145407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1248 | Open in IMG/M |
| 3300005458|Ga0070681_11183047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 686 | Open in IMG/M |
| 3300005467|Ga0070706_102008916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 524 | Open in IMG/M |
| 3300005538|Ga0070731_10807743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 622 | Open in IMG/M |
| 3300005564|Ga0070664_100693155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 949 | Open in IMG/M |
| 3300005569|Ga0066705_10816987 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300005575|Ga0066702_10571874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 681 | Open in IMG/M |
| 3300005994|Ga0066789_10116415 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1143 | Open in IMG/M |
| 3300006052|Ga0075029_100012392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 4714 | Open in IMG/M |
| 3300006059|Ga0075017_101586073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 516 | Open in IMG/M |
| 3300006059|Ga0075017_101649583 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300006176|Ga0070765_100957786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 809 | Open in IMG/M |
| 3300006176|Ga0070765_101835064 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300006358|Ga0068871_101640590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 609 | Open in IMG/M |
| 3300006854|Ga0075425_102560973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 564 | Open in IMG/M |
| 3300006954|Ga0079219_10334848 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300009089|Ga0099828_11947384 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300009092|Ga0105250_10133598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1025 | Open in IMG/M |
| 3300009143|Ga0099792_11236944 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300009174|Ga0105241_10675818 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300009623|Ga0116133_1099315 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300009628|Ga0116125_1206010 | Not Available | 561 | Open in IMG/M |
| 3300009839|Ga0116223_10000227 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 73387 | Open in IMG/M |
| 3300010043|Ga0126380_10645109 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300010048|Ga0126373_10056281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3511 | Open in IMG/M |
| 3300010048|Ga0126373_10244630 | All Organisms → cellular organisms → Bacteria | 1762 | Open in IMG/M |
| 3300010048|Ga0126373_10577368 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
| 3300010341|Ga0074045_10625323 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300010358|Ga0126370_10669483 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300010360|Ga0126372_11945029 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300010366|Ga0126379_11567925 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300010371|Ga0134125_11431719 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300010373|Ga0134128_11508686 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300010866|Ga0126344_1133736 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300011070|Ga0138567_1079231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 622 | Open in IMG/M |
| 3300011120|Ga0150983_12633435 | Not Available | 506 | Open in IMG/M |
| 3300011269|Ga0137392_11437686 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300012096|Ga0137389_10287938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1388 | Open in IMG/M |
| 3300012200|Ga0137382_10203786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1359 | Open in IMG/M |
| 3300012202|Ga0137363_10271642 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
| 3300012211|Ga0137377_11527003 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300012212|Ga0150985_102782004 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300012212|Ga0150985_119180613 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300012212|Ga0150985_119707205 | Not Available | 650 | Open in IMG/M |
| 3300012469|Ga0150984_104279260 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300012958|Ga0164299_10474027 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300012960|Ga0164301_11428924 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300013308|Ga0157375_10353396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1635 | Open in IMG/M |
| 3300014968|Ga0157379_11508133 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300017934|Ga0187803_10012482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3396 | Open in IMG/M |
| 3300017948|Ga0187847_10066538 | All Organisms → cellular organisms → Bacteria | 2021 | Open in IMG/M |
| 3300017973|Ga0187780_10046639 | All Organisms → cellular organisms → Bacteria | 3015 | Open in IMG/M |
| 3300017974|Ga0187777_10725273 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300018020|Ga0187861_10103206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1371 | Open in IMG/M |
| 3300018088|Ga0187771_11002444 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300018468|Ga0066662_12499703 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300019174|Ga0184579_113131 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300019178|Ga0184583_110542 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300019258|Ga0181504_1495803 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300019278|Ga0187800_1867867 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300021046|Ga0215015_10255640 | Not Available | 528 | Open in IMG/M |
| 3300021171|Ga0210405_11319195 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300021361|Ga0213872_10472377 | Not Available | 502 | Open in IMG/M |
| 3300021404|Ga0210389_10033076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3975 | Open in IMG/M |
| 3300021405|Ga0210387_10120093 | All Organisms → cellular organisms → Bacteria | 2220 | Open in IMG/M |
| 3300021406|Ga0210386_10033772 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4025 | Open in IMG/M |
| 3300021406|Ga0210386_11086851 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300021420|Ga0210394_10297682 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
| 3300021444|Ga0213878_10188362 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300021559|Ga0210409_10245293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1623 | Open in IMG/M |
| 3300021560|Ga0126371_12108616 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300022499|Ga0242641_1014040 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300022507|Ga0222729_1023525 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300022515|Ga0224546_1016746 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300022522|Ga0242659_1037048 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300022531|Ga0242660_1110131 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300022708|Ga0242670_1036977 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300022726|Ga0242654_10205465 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300023012|Ga0228597_111374 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300024176|Ga0224565_1041939 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300024330|Ga0137417_1403162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4314 | Open in IMG/M |
| 3300025898|Ga0207692_10000808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11168 | Open in IMG/M |
| 3300025910|Ga0207684_11285848 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300025911|Ga0207654_11307389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 529 | Open in IMG/M |
| 3300025917|Ga0207660_11011833 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300025927|Ga0207687_10102541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2108 | Open in IMG/M |
| 3300025929|Ga0207664_10590496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 997 | Open in IMG/M |
| 3300025944|Ga0207661_10209041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1719 | Open in IMG/M |
| 3300025972|Ga0207668_11329349 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300026542|Ga0209805_1126961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1200 | Open in IMG/M |
| 3300027548|Ga0209523_1007379 | All Organisms → cellular organisms → Bacteria | 1943 | Open in IMG/M |
| 3300027568|Ga0208042_1112145 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300027604|Ga0208324_1189849 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300027619|Ga0209330_1107349 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300027681|Ga0208991_1045518 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300027727|Ga0209328_10274292 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300027738|Ga0208989_10023503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2125 | Open in IMG/M |
| 3300027745|Ga0209908_10201490 | Not Available | 545 | Open in IMG/M |
| 3300027842|Ga0209580_10347587 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300027882|Ga0209590_10531576 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300027905|Ga0209415_10921473 | Not Available | 591 | Open in IMG/M |
| 3300028556|Ga0265337_1197729 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300029951|Ga0311371_11421811 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300029999|Ga0311339_11276754 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300030057|Ga0302176_10025135 | All Organisms → cellular organisms → Bacteria | 2255 | Open in IMG/M |
| 3300030114|Ga0311333_11475145 | Not Available | 586 | Open in IMG/M |
| 3300030549|Ga0210257_10403354 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300030575|Ga0210288_1196596 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300030741|Ga0265459_11889234 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300030862|Ga0265753_1104929 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300031231|Ga0170824_105794455 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300031231|Ga0170824_121960378 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300031718|Ga0307474_10528393 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300031736|Ga0318501_10147081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1210 | Open in IMG/M |
| 3300031740|Ga0307468_102044959 | Not Available | 550 | Open in IMG/M |
| 3300031753|Ga0307477_10666065 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300031754|Ga0307475_10108436 | All Organisms → cellular organisms → Bacteria | 2175 | Open in IMG/M |
| 3300031754|Ga0307475_11505536 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300031809|Ga0316048_102279 | Not Available | 861 | Open in IMG/M |
| 3300031821|Ga0318567_10185295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1160 | Open in IMG/M |
| 3300031823|Ga0307478_11264841 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300032180|Ga0307471_102051009 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300032515|Ga0348332_14123769 | Not Available | 638 | Open in IMG/M |
| 3300032756|Ga0315742_10733650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 911 | Open in IMG/M |
| 3300032756|Ga0315742_10764297 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300032756|Ga0315742_12139465 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300032783|Ga0335079_11440710 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300033290|Ga0318519_10948643 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300033809|Ga0314871_008147 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300033829|Ga0334854_021741 | All Organisms → cellular organisms → Bacteria | 1552 | Open in IMG/M |
| 3300034282|Ga0370492_0245281 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.01% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.16% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.48% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.48% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.42% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.74% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.74% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.05% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.05% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.05% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.05% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.05% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.37% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.37% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.37% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.37% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.37% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.37% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.37% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.37% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.68% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.68% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.68% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.68% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.68% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.68% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.68% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.68% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.68% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.68% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.68% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.68% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.68% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.68% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004102 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF212 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004473 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004602 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 52 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004607 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 36 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005903 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011070 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 52 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019174 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLA3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019178 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019258 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022499 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022515 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 1-5 | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022708 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023012 | Spruce litter microbial communities from Bohemian Forest, Czech Republic - CLU4 | Environmental | Open in IMG/M |
| 3300024176 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Host-Associated | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030549 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR102SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030575 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE050SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031809 | Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLA5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033809 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_D | Environmental | Open in IMG/M |
| 3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MBSR1b_0273.00007290 | 2162886012 | Miscanthus Rhizosphere | RDVVSQQKEQFRAAYEAGRQAYKESTTEAGVPKNL |
| F62_07365290 | 2170459010 | Grass Soil | AREQASDLVDKGREVAKQQKEQFKSAYEAGRQAYHEATAADGGASKNL |
| INPgaii200_03618491 | 2228664022 | Soil | DVLNQRKDQFRAAYDAGRQAYHEATTETGGPAAKNL |
| JGI12712J15308_100283453 | 3300001471 | Forest Soil | DKGRDVVNQQKEQFRAAYEAGRQAYHEATNEAVAPKS* |
| JGIcombinedJ26739_1006701982 | 3300002245 | Forest Soil | RDVVTQQKDQFRAAYEAGRQAYQEATTEAGGAPKKL* |
| Ga0058888_14446751 | 3300004102 | Forest Soil | ASQWADRGREVVNTQKEQFRAAYEAGRQAYHEATTEAGAPKNL* |
| Ga0068919_14087912 | 3300004473 | Peatlands Soil | AAQWADRGRDVVNTQKEQFRAAYEAGRQAYHEATTETGAPKNL* |
| Ga0068960_12268321 | 3300004602 | Peatlands Soil | RAREARDQASEWVDRGREVVNQQKDQFRAAYEVGRQAYQEAKTETGAPKSL* |
| Ga0068948_13375041 | 3300004607 | Peatlands Soil | RDQASEWVDRGREVVNQQKDQFRAAYEVGRQAYQEAKTETGAPKSL* |
| Ga0070680_1012013672 | 3300005336 | Corn Rhizosphere | DWADRGREVLNQQKEQFKSAYEAGRQAYHQTTAEGTTPKNV* |
| Ga0070714_1001358801 | 3300005435 | Agricultural Soil | VDRSKEVLNQQKDQFRAAYDAGRQAYHEATSEGGTTGAAKNL* |
| Ga0070710_100066061 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | WVDKGRDVVSQQKDQFRAAYEAGRQAYQEATTETTGAPKNL* |
| Ga0066687_101454071 | 3300005454 | Soil | WVDRGKDVLNQQKEQFRAAYEAGRQAYSEATTEGTTPKNL* |
| Ga0070681_111830471 | 3300005458 | Corn Rhizosphere | QANEWVDRGRDILNQQRDQIKTAYDAGREAYRQATSEGEPERPL* |
| Ga0070706_1020089161 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | DNWVGRGKEVLNQQKDQFRAAYEAGRQAYNKATESGTTP* |
| Ga0070731_108077432 | 3300005538 | Surface Soil | SQATDWVDRGRDVLNQQKDQFRAAYDAGRQAYHQATTEDDPAAKNL* |
| Ga0070664_1006931553 | 3300005564 | Corn Rhizosphere | AADWADRGREVLNQQKEQFKSAYEAGRQAYHQTTAEGTTPKNV* |
| Ga0066705_108169872 | 3300005569 | Soil | GREVLNQQKDQFRAAYDAGRQAYHEATAEDSTAKNL* |
| Ga0066702_105718741 | 3300005575 | Soil | WADRGREVVGAQKEQFRAAYEAGRQAYHEATTETGTSKA* |
| Ga0075279_100018194 | 3300005903 | Rice Paddy Soil | ERGKDVVGQQKDQFRSAFEAGRQAYREATTEGTTPKS* |
| Ga0066789_101164151 | 3300005994 | Soil | DVVNQQKDQFRAAYEAGRQAYNEATTETASPKNL* |
| Ga0075029_1000123921 | 3300006052 | Watersheds | GRDVLNQQKEQFRSAYEAGRQAYQEATAESSAPKNL* |
| Ga0075017_1015860731 | 3300006059 | Watersheds | SQWADRGREVLNQQKEQFRAAYEAGRQAYQETTADTGATKNL* |
| Ga0075017_1016495832 | 3300006059 | Watersheds | GRDVLNQQKDQFRAAYDAGRQAYHEATSEEDAAAKNL* |
| Ga0070765_1009577861 | 3300006176 | Soil | EQASDLVDRGREVAKQQKEQFKSAYEAGRQAYHEATAADGGASKNL* |
| Ga0070765_1018350641 | 3300006176 | Soil | WVDKSRDTMNQQKDQFRAAYEACRQAYQEATSEAAPSNKV* |
| Ga0068871_1016405901 | 3300006358 | Miscanthus Rhizosphere | DLVDRGREVAKQQKDQFKSAYEAGRQAYHEATATDGGASKNL* |
| Ga0075425_1025609731 | 3300006854 | Populus Rhizosphere | LVDRGREVAKQQKEQFKSAYEAGRQAYHEATAADGSASKNL* |
| Ga0079219_103348481 | 3300006954 | Agricultural Soil | DRGREVLNQQKEQFKSAYEAGRQAYHQTTAEGTTPKNV* |
| Ga0099828_119473841 | 3300009089 | Vadose Zone Soil | REVAKQQKDQFKSAYEAGRQAYHEATAADGGASKNL* |
| Ga0105250_101335981 | 3300009092 | Switchgrass Rhizosphere | REQASDLVDKGREVAKQQKEQFKSAYEAGRQAYHEATAADGGASKNL* |
| Ga0099792_112369442 | 3300009143 | Vadose Zone Soil | RGRDVLNQQKEQFRSAYEAGRQAYHETTAAEGGGSKNL* |
| Ga0105241_106758181 | 3300009174 | Corn Rhizosphere | DQASQWADKGREKVTQQKEQFRQAYEAGRQAYHEATAETAPGKNL* |
| Ga0116133_10993151 | 3300009623 | Peatland | QWADRGRDVVNTQKEQFRAAYEAGRQAYHEATTETGAPKNL* |
| Ga0116125_12060101 | 3300009628 | Peatland | SKDVVNQQKDQFRAAYEAGRQAYQEATSEAAPSNKS* |
| Ga0116223_1000022765 | 3300009839 | Peatlands Soil | RGREVIGQQKEQFRAAYEAGRQAYQEHTTETGAPKNL* |
| Ga0126380_106451092 | 3300010043 | Tropical Forest Soil | WVDRGREVLNQQKDQFRAAYDAGRQAYHEATSENAPAKNL* |
| Ga0126373_100562816 | 3300010048 | Tropical Forest Soil | RGRDVLNQQKDQFRAAYDAGRQAYHQATSEDNTAAKNL* |
| Ga0126373_102446303 | 3300010048 | Tropical Forest Soil | DRGRDAVNQQKEQFRAAYEAGRQAYHEATTETETSKNL* |
| Ga0126373_105773681 | 3300010048 | Tropical Forest Soil | EILSQQKEQFRSAYEAGRQAYQEATTGEGEAKNL* |
| Ga0074045_106253232 | 3300010341 | Bog Forest Soil | QWADRGREVVNQQKEQFHAAYEAGRQAYHETTAETGAPKNL* |
| Ga0126370_106694831 | 3300010358 | Tropical Forest Soil | REAMSQQKDQFRAAYEAGRQAYHEATTETETSKNL* |
| Ga0126372_119450292 | 3300010360 | Tropical Forest Soil | AQQWADRGREAMSQQKDQFRAAYEAGRQAYHEATTETETSKNL* |
| Ga0126379_115679251 | 3300010366 | Tropical Forest Soil | RDILNQQREQFKSAYEAGRQAYHETTTAESASPKNL* |
| Ga0134125_114317191 | 3300010371 | Terrestrial Soil | KEVAKQQKEQFKSAYEAGRQADHEATAGEAGASKNV* |
| Ga0134128_115086862 | 3300010373 | Terrestrial Soil | GREIVSQQKDQFRSAYEAGRQAYHETTKDTTAQNL* |
| Ga0126344_11337363 | 3300010866 | Boreal Forest Soil | RDVVTQQKEQFRAAYEAGRQAYHEATAETASPKNS* |
| Ga0138567_10792312 | 3300011070 | Peatlands Soil | RDYMRSRAREARDQASEWVDRGREVVNQQKDQFRAAYEVGRQAYQEAKTETGAPKSL* |
| Ga0150983_126334351 | 3300011120 | Forest Soil | GRDVVGRQKEQFRAAYEAGRQAYQEATTESGPPKNL* |
| Ga0137392_114376861 | 3300011269 | Vadose Zone Soil | VDRGKDVLDQQKDQFRAAYEAGRQAYHEATTETSTPKAL* |
| Ga0137389_102879383 | 3300012096 | Vadose Zone Soil | LVDKGREVAKQQKEQFKSAYEAGRQAYHEATAADGGTSKNL* |
| Ga0137382_102037863 | 3300012200 | Vadose Zone Soil | WVDRGRDVLSQQKDQFRAAYDAGRQAYHESTSENTPAKNL* |
| Ga0137363_102716423 | 3300012202 | Vadose Zone Soil | WVDRGRDVVNQQKDQFRAAYEAGRQAYQEATTETGAPKNL* |
| Ga0137377_115270031 | 3300012211 | Vadose Zone Soil | LVDRGREVAKQQKEQFKSAYDAGRQAYHEATATDSGASKNL* |
| Ga0150985_1027820042 | 3300012212 | Avena Fatua Rhizosphere | WADKSRDVVGQQKEQFRAAYEAGRQAYHEATSETGTGKNL* |
| Ga0150985_1191806131 | 3300012212 | Avena Fatua Rhizosphere | GKEVAKQQKEQFKSAYEAGRQAYHEATAGEAGASKNL* |
| Ga0150985_1197072052 | 3300012212 | Avena Fatua Rhizosphere | EKVTQQKEQFRQAYEAGRQAYHEATAETAPGKNL* |
| Ga0150984_1042792602 | 3300012469 | Avena Fatua Rhizosphere | QWADKSRDVVGQQKEQFRAAYEAGRQAYHEATSETGTGKNL* |
| Ga0164299_104740271 | 3300012958 | Soil | REVAKQQKEQFKSAYEAGRQAYHEATAADGGASKNL* |
| Ga0164301_114289242 | 3300012960 | Soil | RWSAKGREKVTQQKEQFRQAYEAGRQAYHEATAETAPGKNL* |
| Ga0157375_103533963 | 3300013308 | Miscanthus Rhizosphere | LVDRGKEVAKQQKEQFKSAYEAGRQAYHEATAGEAGASKNL* |
| Ga0157379_115081331 | 3300014968 | Switchgrass Rhizosphere | NDWVDRGREIVSQQKDQFRSAYEAGRQAYHETTKDTTAQNL* |
| Ga0187803_100124821 | 3300017934 | Freshwater Sediment | QAGDWIDRGRDVLNQQKEQFRNAYDAGRQAYKETTTAETGAPKNV |
| Ga0187847_100665384 | 3300017948 | Peatland | WVDKGREAVNQQKDQFRAAYEAGRQAYQEATTETAPTKGV |
| Ga0187780_100466395 | 3300017973 | Tropical Peatland | DRGREVLNQQKDQFRAAYEAGRQAYQEHTAETGTSKNL |
| Ga0187777_107252732 | 3300017974 | Tropical Peatland | HANKARNQASDMVDRGRDMLNQQKDQFRAAYDAGRQAYHEATRPEDTAAKNL |
| Ga0187861_101032061 | 3300018020 | Peatland | VSQQKDQIRSAFEAGRQAYQEATSSPEPEGGAPKA |
| Ga0187771_110024441 | 3300018088 | Tropical Peatland | SQWADRGRDVLNQQKEQFRAAYEAGRQAYQEHTAETGTAQER |
| Ga0066662_124997032 | 3300018468 | Grasslands Soil | QWVDRGRDYMNQQRDQFKAAYDAGREAYQETTTGETGTPKNV |
| Ga0184579_1131312 | 3300019174 | Soil | DRGRDVVNQQKDQFRAAYEAGRQAYQEATSETGAPKNL |
| Ga0184583_1105422 | 3300019178 | Soil | GRDVVNQQKDQFRAAYEAGRQAYQEATSETGAPKNL |
| Ga0181504_14958031 | 3300019258 | Peatland | ATQWADRGRDVVNQQKEQFRAAYEAGRQAYQEASSETGSPKNL |
| Ga0187800_18678673 | 3300019278 | Peatland | EWADRGREILSQQKEQFRAAYEAGRQAYQEHTTETGAPKDR |
| Ga0215015_102556402 | 3300021046 | Soil | RGRDVVGRQKEQFRAAYEAGRQAYQEATTETGAPKNL |
| Ga0210405_113191952 | 3300021171 | Soil | TQWADKGRDVVTQQKEQFRAAYEAGRQAYHDATTETVAPKNL |
| Ga0213872_104723772 | 3300021361 | Rhizosphere | TWVDRGRDYIAQQKDQFRAAVDAGKQAYREATAENPAGTPSQ |
| Ga0210389_100330761 | 3300021404 | Soil | KGRDVVSQQKDQFKAAYEAGRQAYQEATSETVAGPPKNL |
| Ga0210387_101200935 | 3300021405 | Soil | DRGRDVVNTQKEQFRAAYEAGRQAYHEATTETGAPKNL |
| Ga0210386_100337726 | 3300021406 | Soil | GWVDKGRDVVTQQKDQFKAAYEAGRQAYQEATTDTSPPKGM |
| Ga0210386_110868511 | 3300021406 | Soil | SGWVDRGRDVVSQQKDQFRAAYEAGRQAYQEATSETAGGVTAPKNL |
| Ga0210394_102976825 | 3300021420 | Soil | ADKGRDVVTQQKEQFRAAYEAGRQAYHDATTETVAPKNL |
| Ga0213878_101883621 | 3300021444 | Bulk Soil | DRGRDVLNQQKEQFRAAYDAGRQAYHEATSDSEAAAKNL |
| Ga0210409_102452933 | 3300021559 | Soil | RGRDVLSQQKDQFRAAYDAGRQAYHEATAEDQAASKNL |
| Ga0126371_121086161 | 3300021560 | Tropical Forest Soil | WADRGREAVSQQKEQFRAAYEAGRQAYHEATADTAPAKNL |
| Ga0242641_10140402 | 3300022499 | Soil | RGRDAVNQQKEQFRSAYEAGRQAYREATTETGAPKS |
| Ga0222729_10235252 | 3300022507 | Soil | RDAVSQQKEQFRAAYEAGRQEYHEATTETGAPKSL |
| Ga0224546_10167461 | 3300022515 | Soil | RGREVVNQQKDQFRAAYEAGRQAYQEATTETGAPKNL |
| Ga0242659_10370482 | 3300022522 | Soil | QWADKGRDVVTQQKEQFRAAYEAGRQAYHDATTETVAPKNL |
| Ga0242660_11101312 | 3300022531 | Soil | DWVDRGREVLNQQKDQFRAAYDAGRQAYHEATSEGEEAAKNL |
| Ga0242670_10369771 | 3300022708 | Soil | GREVAKQQKEQFKSAYEAGRQAYHEATAADGGASKNL |
| Ga0242654_102054651 | 3300022726 | Soil | RDVVNTQKEQFRAAYEAGRQAYHEATTETGAPKNL |
| Ga0228597_1113741 | 3300023012 | Plant Litter | ATDWADRGRDVVNQQKDQFRAAYEAGRQAYQEATSETGAAKNL |
| Ga0224565_10419391 | 3300024176 | Plant Litter | IDWADRGRDVVNQQKDQFRAAYEAGRQAYQEATSETGAPKNL |
| Ga0137417_14031621 | 3300024330 | Vadose Zone Soil | MGGSWPDVLNQQKDQFRQPTTPPEAYHEATAEDAAAKNL |
| Ga0207692_100008081 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | SEWVDKGRDVVSQQKDQFRAAYEAGRQAYQEATTETTGAPKNL |
| Ga0207684_112858481 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | DNWVGRGKEVLNQQKDQFRAAYEAGRQAYNKATESGTTP |
| Ga0207654_113073892 | 3300025911 | Corn Rhizosphere | ASQWADKGREKVTQQKEQFRQAYEAGRQAYHEATAETAPGKNL |
| Ga0207660_110118331 | 3300025917 | Corn Rhizosphere | DWADRGREVLNQQKEQFKSAYEAGRQAYHQTTAEGTTPKNV |
| Ga0207687_101025411 | 3300025927 | Miscanthus Rhizosphere | REVAKQQKEQFKSAYEAGRQAYHEATAGEAGASKNL |
| Ga0207664_105904963 | 3300025929 | Agricultural Soil | GREVLNQQKDQFRAAYDAGRQAYHEATAEDSTAKNL |
| Ga0207661_102090413 | 3300025944 | Corn Rhizosphere | KGRDVAKQQKEQFKSAYEAGRQAYHEATAADGGASKNL |
| Ga0207668_113293491 | 3300025972 | Switchgrass Rhizosphere | ASDLVDKGREVAKQQKEQFKSAYEAGRQAYHEATAADGGASKNL |
| Ga0209805_11269613 | 3300026542 | Soil | EQAADLVDRGREVAKQQKEQFRSAYEAGRQAYHEATAPEGGASKNL |
| Ga0209523_10073794 | 3300027548 | Forest Soil | KDVLNQQKDQFKAAYDAGRQAYSEATTGEGSAPKNL |
| Ga0208042_11121451 | 3300027568 | Peatlands Soil | RRAREAREQAAQWADRGRDVVNTQKEQFRAAYEVGRQAYQEAKTETGAPKSL |
| Ga0208324_11898491 | 3300027604 | Peatlands Soil | RGRDVVNTQKEQFRAAYEAGRQAYHEATTETGAPKNL |
| Ga0209330_11073491 | 3300027619 | Forest Soil | QATQWADKGRDVVTQQKEQFRAAYEAGRQAYHDATTETVAPKNS |
| Ga0208991_10455181 | 3300027681 | Forest Soil | KDVLDQQKDQFRAAYEAGRQAYHEETAKTSTPKAL |
| Ga0209328_102742922 | 3300027727 | Forest Soil | SDLVDKGREVAKQQKEQFKSAYEAGRQAYHEATAADGGTSKNL |
| Ga0208989_100235034 | 3300027738 | Forest Soil | GRDVVGQQKEQFRAAYEAGRQAYQEATTETGAPKNL |
| Ga0209908_102014902 | 3300027745 | Thawing Permafrost | QATQWADKGRDVVTQQKEQFRAAYEAGRQAYHDATTETVAPKNL |
| Ga0209580_103475871 | 3300027842 | Surface Soil | RGREVVNQQREQFKSAYEAGRQAYKEATTEGAPKNL |
| Ga0209590_105315762 | 3300027882 | Vadose Zone Soil | VDRGKDVLSQQKEQFRAAYEAGRQAYQEATTADATPKNL |
| Ga0209415_109214732 | 3300027905 | Peatlands Soil | KTRARDAREQASGWVDRGREAVSQQKDQFRAAYEAVRQAYQEATSETGAGAPKNL |
| Ga0265337_11977292 | 3300028556 | Rhizosphere | WADKGRDVVNTQKEQFRAAYEAGRQAYHEATETGAPKGL |
| Ga0311371_114218112 | 3300029951 | Palsa | ASDWVDRGRDVVNQQKDQFRAAYEAGRQAYQEATTETGAPKNL |
| Ga0311339_112767541 | 3300029999 | Palsa | QAAGWVDRGREVVNQQKDQFRAAYEAGKQAYQEATTETGGPKNL |
| Ga0302176_100251351 | 3300030057 | Palsa | VDRGREAVNQQKDQFRAAYEAGRQAYQEATTETGAPKTL |
| Ga0311333_114751452 | 3300030114 | Fen | RQWAERGRDVLSQQKDQIRAAYDAGRQAYRETTTPEAGASKNL |
| Ga0210257_104033542 | 3300030549 | Soil | VDRGRDVVNQQKDQFRAAYEAGRQAYQEATTETGAPKI |
| Ga0210288_11965961 | 3300030575 | Soil | GRDVVNQQKDQFRAAYEAGRQAYQEATTETGAPKNL |
| Ga0265459_118892341 | 3300030741 | Soil | REAVSTQKEQFRAAYEAGRQASHEATTETGAPKGL |
| Ga0265753_11049292 | 3300030862 | Soil | VDKGRDVVTQQKDQFRAAYEAGRQAYQEATTETAPPKAL |
| Ga0170824_1057944552 | 3300031231 | Forest Soil | SDLVDKGREVAKQQKEQFKSAYEAGRQAYHEATAADGGASKNL |
| Ga0170824_1219603781 | 3300031231 | Forest Soil | TEWAAKGKDAVKQQKEQFKAAYEAGRQAYRDTATPEKS |
| Ga0307474_105283933 | 3300031718 | Hardwood Forest Soil | RDVVSQQKDQFKAAYEAGRQAYQEATSETTPPKGV |
| Ga0318501_101470813 | 3300031736 | Soil | VDRGRDVLNQQKDQFRAAYDAGRQAYHEATAEPGTGAAKNL |
| Ga0307468_1020449591 | 3300031740 | Hardwood Forest Soil | VDRGREVVNQQKDQFRAAYEAGRQAYQEATTEAGAGAPKNL |
| Ga0307477_106660652 | 3300031753 | Hardwood Forest Soil | DRGRDVVNQQKEQFRAAYEAGRQAYQEATTETGAPKNL |
| Ga0307475_101084365 | 3300031754 | Hardwood Forest Soil | RDVVGQQKEQFRAAYEAGRQAYHEATAETSAPKNS |
| Ga0307475_115055362 | 3300031754 | Hardwood Forest Soil | RGREVAKQQKEQFKSAYEAGRQAYHEATAADGGASKNL |
| Ga0316048_1022792 | 3300031809 | Soil | GRDVVTQQKDQFRAAYEAGRQAYQEATTEAGGAPKNL |
| Ga0318567_101852951 | 3300031821 | Soil | WVDRGRDVLNQQKDQFRAAYDAGRQAYHEATAEPGTGAAKNL |
| Ga0307478_112648411 | 3300031823 | Hardwood Forest Soil | RDVVSQQKEQFRAAYEAGRQAYHEATAETAAPKNL |
| Ga0307471_1020510092 | 3300032180 | Hardwood Forest Soil | VDRGREVAKQQKEQFKSAYEAGRQAYHEATATEGGASKNV |
| Ga0348332_141237691 | 3300032515 | Plant Litter | RDVVSQQKEQFRAAYEAGRQAYHEATTETVTPKNS |
| Ga0315742_107336501 | 3300032756 | Forest Soil | SEWVDKGRDVVSQQKDQFKAAYEAGRQAYQEATSETVAGPPKNL |
| Ga0315742_107642973 | 3300032756 | Forest Soil | ADKGRDVVTQQKEQFRAAYEAGRQAYHEATAETASPKNS |
| Ga0315742_121394651 | 3300032756 | Forest Soil | RDVVNQQKEQFRAAYEAGRQAYQEATTETGAPKSL |
| Ga0335079_114407101 | 3300032783 | Soil | DRGREVVNQQKEQFRAAYEAGRQAYQEATDTGTSKNL |
| Ga0318519_109486432 | 3300033290 | Soil | DRGRDVLNQQKDQFRAAYEAGRQAYHEATSEGEATAKNL |
| Ga0310811_111651432 | 3300033475 | Soil | GKDVVGQQKDQFRSAFEAGRQAYREATTEGTTPKS |
| Ga0314871_008147_433_540 | 3300033809 | Peatland | LNQQKDQFRAAYDAGRQAYHEATAEGGTSSAAKNL |
| Ga0334854_021741_1429_1551 | 3300033829 | Soil | EWADRGRDVVSQQKEQFRSAYEAGRQAYREATTETGAPKS |
| Ga0326723_0610376_3_110 | 3300034090 | Peat Soil | KGRDVVTQQKEQFKSAYDAGRQAYREATEGEGKSV |
| Ga0370492_0245281_600_719 | 3300034282 | Untreated Peat Soil | VDKGRDVVTQQKDQFRAAYEAGKQAYQEATSDTAPPKGL |
| ⦗Top⦘ |