| Basic Information | |
|---|---|
| Family ID | F049183 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 147 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MLRRMPTQASATTRLEPPYETNGSGIPVSGASPITAARLIAA |
| Number of Associated Samples | 130 |
| Number of Associated Scaffolds | 147 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 15.65 % |
| % of genes near scaffold ends (potentially truncated) | 96.60 % |
| % of genes from short scaffolds (< 2000 bps) | 90.48 % |
| Associated GOLD sequencing projects | 124 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.673 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.966 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.129 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.537 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.43% β-sheet: 2.86% Coil/Unstructured: 85.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 147 Family Scaffolds |
|---|---|---|
| PF03033 | Glyco_transf_28 | 72.11 |
| PF04101 | Glyco_tran_28_C | 15.65 |
| PF08245 | Mur_ligase_M | 3.40 |
| PF01565 | FAD_binding_4 | 2.04 |
| PF01225 | Mur_ligase | 1.36 |
| PF02873 | MurB_C | 1.36 |
| PF12327 | FtsZ_C | 0.68 |
| PF07690 | MFS_1 | 0.68 |
| PF00282 | Pyridoxal_deC | 0.68 |
| PF07228 | SpoIIE | 0.68 |
| PF02347 | GDC-P | 0.68 |
| PF08486 | SpoIID | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 147 Family Scaffolds |
|---|---|---|---|
| COG0769 | UDP-N-acetylmuramyl tripeptide synthase | Cell wall/membrane/envelope biogenesis [M] | 1.36 |
| COG0770 | UDP-N-acetylmuramyl pentapeptide synthase | Cell wall/membrane/envelope biogenesis [M] | 1.36 |
| COG0773 | UDP-N-acetylmuramate-alanine ligase MurC and related ligases, MurC/Mpl family | Cell wall/membrane/envelope biogenesis [M] | 1.36 |
| COG0812 | UDP-N-acetylenolpyruvoylglucosamine reductase | Cell wall/membrane/envelope biogenesis [M] | 1.36 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.68 |
| COG0403 | Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain | Amino acid transport and metabolism [E] | 0.68 |
| COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 0.68 |
| COG2385 | Peptidoglycan hydrolase (amidase) enhancer domain SpoIID | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.67 % |
| Unclassified | root | N/A | 16.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352031|2206147832 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300001535|A3PFW1_10286021 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300001686|C688J18823_10181507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1430 | Open in IMG/M |
| 3300001989|JGI24739J22299_10113913 | Not Available | 811 | Open in IMG/M |
| 3300003990|Ga0055455_10266604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 545 | Open in IMG/M |
| 3300003996|Ga0055467_10161706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 675 | Open in IMG/M |
| 3300004081|Ga0063454_100086706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1433 | Open in IMG/M |
| 3300004114|Ga0062593_101339848 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300005178|Ga0066688_10603890 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300005294|Ga0065705_11109767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 521 | Open in IMG/M |
| 3300005334|Ga0068869_101111803 | Not Available | 692 | Open in IMG/M |
| 3300005336|Ga0070680_100085484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2606 | Open in IMG/M |
| 3300005344|Ga0070661_100946757 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300005435|Ga0070714_100551329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1104 | Open in IMG/M |
| 3300005440|Ga0070705_101578708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 552 | Open in IMG/M |
| 3300005441|Ga0070700_101118593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 654 | Open in IMG/M |
| 3300005451|Ga0066681_10170111 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
| 3300005529|Ga0070741_10028666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 7959 | Open in IMG/M |
| 3300005533|Ga0070734_10702937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 575 | Open in IMG/M |
| 3300005563|Ga0068855_102094811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 570 | Open in IMG/M |
| 3300005587|Ga0066654_10730581 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300005598|Ga0066706_11335084 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300005616|Ga0068852_100082140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2862 | Open in IMG/M |
| 3300005616|Ga0068852_100941190 | Not Available | 882 | Open in IMG/M |
| 3300005713|Ga0066905_101287595 | Not Available | 657 | Open in IMG/M |
| 3300005836|Ga0074470_11505490 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300005842|Ga0068858_100426005 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300005885|Ga0075284_1016097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 889 | Open in IMG/M |
| 3300005896|Ga0075282_1066554 | Not Available | 539 | Open in IMG/M |
| 3300006046|Ga0066652_101215178 | Not Available | 713 | Open in IMG/M |
| 3300006046|Ga0066652_101346592 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300006173|Ga0070716_100218874 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300006804|Ga0079221_10753369 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300006852|Ga0075433_10162571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1987 | Open in IMG/M |
| 3300009012|Ga0066710_101902203 | Not Available | 890 | Open in IMG/M |
| 3300009098|Ga0105245_10618711 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300009137|Ga0066709_100915966 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300009137|Ga0066709_101288024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1072 | Open in IMG/M |
| 3300009156|Ga0111538_10191962 | All Organisms → cellular organisms → Bacteria | 2592 | Open in IMG/M |
| 3300009176|Ga0105242_11553149 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300009814|Ga0105082_1107440 | Not Available | 532 | Open in IMG/M |
| 3300009821|Ga0105064_1147956 | Not Available | 505 | Open in IMG/M |
| 3300009870|Ga0131092_10433782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1209 | Open in IMG/M |
| 3300010038|Ga0126315_10116924 | All Organisms → cellular organisms → Bacteria | 1548 | Open in IMG/M |
| 3300010333|Ga0134080_10504451 | Not Available | 575 | Open in IMG/M |
| 3300010360|Ga0126372_11870492 | Not Available | 645 | Open in IMG/M |
| 3300010399|Ga0134127_13034912 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300010399|Ga0134127_13355704 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300010880|Ga0126350_10332028 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300011400|Ga0137312_1028241 | Not Available | 842 | Open in IMG/M |
| 3300012198|Ga0137364_10952503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 650 | Open in IMG/M |
| 3300012200|Ga0137382_10247035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1236 | Open in IMG/M |
| 3300012200|Ga0137382_11135248 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300012488|Ga0157343_1007418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 765 | Open in IMG/M |
| 3300012911|Ga0157301_10285377 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300012915|Ga0157302_10390313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 571 | Open in IMG/M |
| 3300012915|Ga0157302_10466962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 537 | Open in IMG/M |
| 3300012916|Ga0157310_10262276 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300012925|Ga0137419_11096554 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300012951|Ga0164300_10993365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 539 | Open in IMG/M |
| 3300012960|Ga0164301_10437305 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300012972|Ga0134077_10555500 | Not Available | 515 | Open in IMG/M |
| 3300012987|Ga0164307_10824602 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300012989|Ga0164305_10742632 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300013105|Ga0157369_10966769 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300013308|Ga0157375_10928838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1013 | Open in IMG/M |
| 3300014150|Ga0134081_10206367 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300014150|Ga0134081_10350331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
| 3300014157|Ga0134078_10653834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
| 3300014263|Ga0075324_1175527 | Not Available | 508 | Open in IMG/M |
| 3300014304|Ga0075340_1077930 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300015209|Ga0167629_1024914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2157 | Open in IMG/M |
| 3300015371|Ga0132258_10224004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 4577 | Open in IMG/M |
| 3300015372|Ga0132256_100078718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3146 | Open in IMG/M |
| 3300015373|Ga0132257_103595483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 564 | Open in IMG/M |
| 3300015374|Ga0132255_100211656 | All Organisms → cellular organisms → Bacteria | 2748 | Open in IMG/M |
| 3300016294|Ga0182041_11282978 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300016404|Ga0182037_10861853 | Not Available | 784 | Open in IMG/M |
| 3300017789|Ga0136617_10301505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1318 | Open in IMG/M |
| 3300017792|Ga0163161_10756310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 813 | Open in IMG/M |
| 3300017966|Ga0187776_11483854 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300018032|Ga0187788_10391323 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300018429|Ga0190272_10013368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 4095 | Open in IMG/M |
| 3300019888|Ga0193751_1005493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 7097 | Open in IMG/M |
| 3300019888|Ga0193751_1009599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 5157 | Open in IMG/M |
| 3300020082|Ga0206353_10425368 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
| 3300022883|Ga0247786_1028304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1083 | Open in IMG/M |
| 3300025588|Ga0208586_1087118 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300025906|Ga0207699_10897916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 654 | Open in IMG/M |
| 3300025906|Ga0207699_10989600 | Not Available | 622 | Open in IMG/M |
| 3300025910|Ga0207684_10292991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1403 | Open in IMG/M |
| 3300025912|Ga0207707_10616802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 917 | Open in IMG/M |
| 3300025915|Ga0207693_11215325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 568 | Open in IMG/M |
| 3300025916|Ga0207663_11465028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 550 | Open in IMG/M |
| 3300025927|Ga0207687_10661300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 884 | Open in IMG/M |
| 3300025929|Ga0207664_10595737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 992 | Open in IMG/M |
| 3300025933|Ga0207706_10824628 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300025937|Ga0207669_10128488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1736 | Open in IMG/M |
| 3300025944|Ga0207661_10514307 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300025949|Ga0207667_11032037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 808 | Open in IMG/M |
| 3300025949|Ga0207667_11129574 | Not Available | 766 | Open in IMG/M |
| 3300025972|Ga0207668_11824316 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300025989|Ga0207998_1016899 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300026019|Ga0208528_1001163 | All Organisms → cellular organisms → Bacteria | 2531 | Open in IMG/M |
| 3300026023|Ga0207677_10787493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 850 | Open in IMG/M |
| 3300026111|Ga0208291_1074447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 599 | Open in IMG/M |
| 3300026142|Ga0207698_10082712 | All Organisms → cellular organisms → Bacteria | 2596 | Open in IMG/M |
| 3300026295|Ga0209234_1159398 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300026527|Ga0209059_1290788 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300026527|Ga0209059_1327336 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300027717|Ga0209998_10122746 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300027725|Ga0209178_1227636 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300027725|Ga0209178_1399808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
| 3300027765|Ga0209073_10430485 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300027821|Ga0209811_10163009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 832 | Open in IMG/M |
| 3300027840|Ga0209683_10336956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 694 | Open in IMG/M |
| 3300027869|Ga0209579_10087498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1650 | Open in IMG/M |
| 3300027874|Ga0209465_10484390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 618 | Open in IMG/M |
| 3300028592|Ga0247822_11817097 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300028596|Ga0247821_10470850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 795 | Open in IMG/M |
| 3300028712|Ga0307285_10185700 | Not Available | 579 | Open in IMG/M |
| 3300028722|Ga0307319_10096964 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300028768|Ga0307280_10370260 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300028771|Ga0307320_10466526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
| 3300028814|Ga0307302_10379075 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300028814|Ga0307302_10575073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 560 | Open in IMG/M |
| 3300028870|Ga0302254_10289742 | Not Available | 604 | Open in IMG/M |
| 3300028884|Ga0307308_10027068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2657 | Open in IMG/M |
| 3300029957|Ga0265324_10047418 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
| 3300030606|Ga0299906_11157288 | Not Available | 559 | Open in IMG/M |
| 3300031716|Ga0310813_11739099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 585 | Open in IMG/M |
| 3300031716|Ga0310813_12315061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
| 3300031751|Ga0318494_10250271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1016 | Open in IMG/M |
| 3300031751|Ga0318494_10573314 | Not Available | 659 | Open in IMG/M |
| 3300031781|Ga0318547_10695735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 632 | Open in IMG/M |
| 3300031805|Ga0318497_10765974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 541 | Open in IMG/M |
| 3300031845|Ga0318511_10219120 | Not Available | 849 | Open in IMG/M |
| 3300031910|Ga0306923_11636743 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300031918|Ga0311367_11055284 | Not Available | 812 | Open in IMG/M |
| 3300031938|Ga0308175_101209573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 840 | Open in IMG/M |
| 3300031938|Ga0308175_102068554 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300031946|Ga0310910_11175539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 596 | Open in IMG/M |
| 3300031996|Ga0308176_11744487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 664 | Open in IMG/M |
| 3300031996|Ga0308176_12805716 | Not Available | 518 | Open in IMG/M |
| 3300032174|Ga0307470_10554876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 850 | Open in IMG/M |
| 3300033412|Ga0310810_11358969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 550 | Open in IMG/M |
| 3300033551|Ga0247830_11340881 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.44% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.08% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.40% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.72% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.72% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 2.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.04% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.04% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.04% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.04% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.04% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.36% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.36% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.36% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.36% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.36% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.36% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.36% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.36% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.36% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.36% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.36% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.68% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.68% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.68% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.68% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.68% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.68% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.68% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.68% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.68% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.68% |
| Speleothem And Rock Wall Surfaces | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Speleothem And Rock Wall Surfaces | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.68% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.68% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.68% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352031 | Cave microbial community (Speleothem B) | Environmental | Open in IMG/M |
| 3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Host-Associated | Open in IMG/M |
| 3300003990 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 | Environmental | Open in IMG/M |
| 3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005885 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401 | Environmental | Open in IMG/M |
| 3300005896 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
| 3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
| 3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011400 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014263 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014304 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300015209 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G3B, Proglacial river margin, by glacier terminus) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
| 3300025588 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025989 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303 (SPAdes) | Environmental | Open in IMG/M |
| 3300026019 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_305 (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026111 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028870 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Host-Associated | Open in IMG/M |
| 3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2207776272 | 2199352031 | Speleothem And Rock Wall Surfaces | MLRRIPTPARSTTKLEPPYETNGSGIPVSGAIPSTA |
| A3PFW1_102860212 | 3300001535 | Permafrost | MLRRTPTPASITTRLEPPYETNGSGIPVSGATPRAAAMLIAACPQTSAVI |
| C688J18823_101815073 | 3300001686 | Soil | MLRSNPTAASATTRLEPPADTNGSGIPVSGASPRTAAMLMIAC |
| JGI24739J22299_101139131 | 3300001989 | Corn Rhizosphere | MLRSTPTQQSSTRSDEPPYETNGSGIPVSGAMPRTAARLTAACPQI |
| Ga0055455_102666041 | 3300003990 | Natural And Restored Wetlands | MPTDASMTTRLEPPYDTNGSGIPVSGASPRTAARLIAAWPQTSAVMP |
| Ga0055467_101617061 | 3300003996 | Natural And Restored Wetlands | MPTAASSTSRLVPPNETNGSGMPVSGAIPSTAARFTAACPQTSEVIPA |
| Ga0063454_1000867063 | 3300004081 | Soil | MLRRMPTERSATTRLEPPYETKGSGMPVSGARPSTAARLIAACPEM |
| Ga0062593_1013398482 | 3300004114 | Soil | MLRRMPTHARPTTRLEPPYETNGSGIPVSGARPITAARLIAA |
| Ga0066688_106038901 | 3300005178 | Soil | MLRRMPTDASWTTRLEPPYETNGSGIPVSGASPRTAARLI |
| Ga0065705_111097672 | 3300005294 | Switchgrass Rhizosphere | MPTETSSTTRLEPPYETNGSGIPVSGAIPRTAARLMQAWQQTSAV |
| Ga0068869_1011118031 | 3300005334 | Miscanthus Rhizosphere | MLRSTPTPASITSSDDPPYETNGSGIPVSGAMPSTAARLTAAWPQTSVVI |
| Ga0070680_1000854844 | 3300005336 | Corn Rhizosphere | MLRRIPTERRAMTRLEPPYETNGSGIPVSGASPSTAARLI |
| Ga0070661_1009467571 | 3300005344 | Corn Rhizosphere | MLRSTPTQQSSTRSDEPPYDTNGSGIPVNGAMPRTAARLTAACPQISVVMPAAS |
| Ga0070714_1005513292 | 3300005435 | Agricultural Soil | MLRSMPTEASITTRLEPPYETKGSGIPVSGARPTAAAMLIAACPQT |
| Ga0070705_1015787082 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRRIPVAASRTTRLEPPYETNGSGIPVSGATPIAAAMLIAACP |
| Ga0070700_1011185932 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRRIPTDASSTTRLDPPYETNGSGIPVSGASPITAARLIAA |
| Ga0066681_101701112 | 3300005451 | Soil | MLRRIPTPRRVTTRLEPPYDTNGSGIPVRGASPSTAARLIAAWPQMSA |
| Ga0070741_100286669 | 3300005529 | Surface Soil | MLRSTPTAPRTTTRLEPPYETNGSGTPVSGAIPTTAARL |
| Ga0070734_107029371 | 3300005533 | Surface Soil | MLRRMPTLARRTIRLDPPYERNGSGIPVRGATPMTAAMLTKA* |
| Ga0068855_1020948111 | 3300005563 | Corn Rhizosphere | MLRRTPTEASDTTRLDPPYETNGSGIPVSGARPMTAARLIAAWPQTSAV |
| Ga0066654_107305812 | 3300005587 | Soil | MLRRIPTPARRTTRLEPPYERNGSGIPVNGALPIT |
| Ga0066706_113350842 | 3300005598 | Soil | MLRRTPTEASETMRLDPPYDTQGSVIPASGARPTTAARLISAW |
| Ga0068852_1000821401 | 3300005616 | Corn Rhizosphere | MLRRIPTPASSTTRLEPPYERNGSGIPVNGAAPITARM |
| Ga0068852_1009411902 | 3300005616 | Corn Rhizosphere | MLRRMPTDASMTTRLVPPYDTRGSGIPVSGATPTTAARLSA |
| Ga0066905_1012875952 | 3300005713 | Tropical Forest Soil | MPTDASITTRLEPPYETNGSGIPVSGASPMTALTLRAAWPQMSAVIPVARS |
| Ga0074470_115054901 | 3300005836 | Sediment (Intertidal) | MLRRTPTEASSTISDEPPYETNGSGIPVSGAIPSTAQRLIAACPQTSVVM |
| Ga0068858_1004260051 | 3300005842 | Switchgrass Rhizosphere | MLRRIPTAARRTTRLEPPYERNGSGIPVSGAIPITAAVLIAAWPQTS |
| Ga0075284_10160971 | 3300005885 | Rice Paddy Soil | MLRRTPTPASITTRLEPPYDTNGSGIPVSGASPTAAAMLIAACPQ |
| Ga0075282_10665542 | 3300005896 | Rice Paddy Soil | MLRRTPTAASITTRLEPPYETNGSGMPVSGATPIAAAMLIAA |
| Ga0066652_1012151782 | 3300006046 | Soil | MLRRMPTEASATTRLDPPYETNGSVIPVRGAMPTT |
| Ga0066652_1013465922 | 3300006046 | Soil | MPTQASATTRLEPPYETNGSGIPVNGASPITAARLIAAWPQTSA |
| Ga0070716_1002188743 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRSMPTEASITTRLEPPYETKGSGIPVSGARPTAAAMLIAACP |
| Ga0079221_107533692 | 3300006804 | Agricultural Soil | MPTETSSTTRLEPPYETNGSGIPVNGARPRTAARLIVAWQ |
| Ga0075433_101625711 | 3300006852 | Populus Rhizosphere | MLRRTPTPVSSTSRDEPPYETNGSGIPVNGAIPRTAARLTAA |
| Ga0066710_1019022032 | 3300009012 | Grasslands Soil | MPTEASATTRLDPPYETNGSVIPVRGAMPTTAATFSA |
| Ga0105245_106187111 | 3300009098 | Miscanthus Rhizosphere | MLRRIPTPASSTTRLEPPYDRNGSGIPVNGAAPITARMFT |
| Ga0066709_1009159661 | 3300009137 | Grasslands Soil | MLRRMPTDRSATTRLEPPYETKGSGIPVSGASPRTA |
| Ga0066709_1012880241 | 3300009137 | Grasslands Soil | MLRRIPTAARRTTRLDPPYERNGSGIPVRGALPITARMLIDA |
| Ga0111538_101919621 | 3300009156 | Populus Rhizosphere | MLRSTPTQQSSTRSDEPPYETNGSGIPVNGAIPRTAARLTA |
| Ga0105242_115531491 | 3300009176 | Miscanthus Rhizosphere | MLRRTPTPTSITTRLEPPYETKGSGMPVSGASPSTAARLTAA |
| Ga0105082_11074401 | 3300009814 | Groundwater Sand | MLRRMPTEASMTTRLEPPYETNGSGIPVRGARPITALTLTAACPQMSAV |
| Ga0105064_11479562 | 3300009821 | Groundwater Sand | MLRRIPTEASMTTRLEPPYETNGSGIPVRGARPITALTLTAAWPQMS |
| Ga0131092_104337821 | 3300009870 | Activated Sludge | MLRRMPTAPSNMRSDEPPYEMNGRVIPVSGATPSTAARFTAACPAMS |
| Ga0126315_101169241 | 3300010038 | Serpentine Soil | MPTAASATIKLEPPYETNGSGMPVSGAMPITAQRLTVAWPQTSA |
| Ga0134080_105044511 | 3300010333 | Grasslands Soil | MLRRMPTEASATTRLDPPYETNGSVIPVRGAMPTTAATFSA |
| Ga0126372_118704922 | 3300010360 | Tropical Forest Soil | MLRRIPTLASRTTRLEPPYERNGSGMPVSGALPITARMLIAAW |
| Ga0134127_130349121 | 3300010399 | Terrestrial Soil | MLRSTPTDRSATTRLEPPYETNGSGMPVSGARPSTAARLTADCPHTSA |
| Ga0134127_133557041 | 3300010399 | Terrestrial Soil | MLRRIPTPASSTTRLEPPYERNGSGIPVNGAAPITAR |
| Ga0126350_103320281 | 3300010880 | Boreal Forest Soil | MLRRIPTARRVMTRLEPPYDTNGSGIPVNGASPRTAARLIAACPQMR |
| Ga0137312_10282412 | 3300011400 | Soil | MLRRTPTPVSITTRLEPPAETNGRGIPVSGAIPSTAARLTV |
| Ga0137364_109525031 | 3300012198 | Vadose Zone Soil | MLRSTPTEASATTRFEPPYEMNGRGIPVSGARPSTAARLIAA |
| Ga0137382_102470352 | 3300012200 | Vadose Zone Soil | MLRRMPTETSATTRLEPPYETNGSGIPVSGARPITAARLIDAWPQT |
| Ga0137382_111352481 | 3300012200 | Vadose Zone Soil | MLRRIPTETSATTMLEPPYETNGSGIPVSGARPITAARLID |
| Ga0157343_10074181 | 3300012488 | Arabidopsis Rhizosphere | MLRTIPTEASSTTRLEPPYDRNGSGIPVSGAIPITAAMLIAACPATS |
| Ga0157301_102853771 | 3300012911 | Soil | MLRRMPTQASATTRLDPPYETNGSGIPVSGARPITAARLIA |
| Ga0157302_103903132 | 3300012915 | Soil | MLRRMPTETSSTTRLEPPYETNGSGIPVSGAMPSTAARLIAA* |
| Ga0157302_104669622 | 3300012915 | Soil | MLRRIPTAPSSTTRLDPPYERNGSGMPVSGAMPITAQMLTAAWPQTST |
| Ga0157310_102622761 | 3300012916 | Soil | MLRRTPTAVSSTMSDEPPYETNGSGIPVSGAMPRTAQRLIAACPQTRVV |
| Ga0137419_110965541 | 3300012925 | Vadose Zone Soil | MLRRIPTAARRTTRLEPPYERKGSGIPVSGAVPITASM |
| Ga0164300_109933651 | 3300012951 | Soil | MLRRMPTEMSATTRLEPPYETNGSGIPVSGASPITAARLIAAWPQTSTVRP |
| Ga0164301_104373052 | 3300012960 | Soil | MLRRMPTQASATTRLEPPYETNGNGIPVSGASPITAARL |
| Ga0134077_105555002 | 3300012972 | Grasslands Soil | MLRSTPTAPSITMRLEPPYERNGSGIPVSGAAPTTAAMLI |
| Ga0164307_108246021 | 3300012987 | Soil | MLRRMPTQASATTRLEPPYETNGNGIPVSGASPITAA |
| Ga0164305_107426322 | 3300012989 | Soil | MLRRMPTDASSTTRLDPPYDRKGSGIPVSGATPMTAAMLMAAWP |
| Ga0157369_109667692 | 3300013105 | Corn Rhizosphere | MLRRTPTARSETIRLEPPYETNGSGIPVSGASPKTAARLIAAWPLIRAVM |
| Ga0157375_109288381 | 3300013308 | Miscanthus Rhizosphere | MLRRIPTEASATTRLEPPYETNGSGIPVSGASPITAARLIAAWP |
| Ga0134081_102063672 | 3300014150 | Grasslands Soil | MLRRTPTPTSITTRLDPPYDTKGSGIPVSGATPMQAAMLIAAC |
| Ga0134081_103503311 | 3300014150 | Grasslands Soil | MLRRTPTPTSITTRLEPPYETNGSGIPVSGATPMAAAMLIAACPQ |
| Ga0134078_106538342 | 3300014157 | Grasslands Soil | MLRRMPTETSSTTRLDPPYETNGSGIPVSGASPRTAARLITA* |
| Ga0075324_11755272 | 3300014263 | Natural And Restored Wetlands | MLRSTPTPQSITRSEEPPYETNGSGMPVRGARPSTA |
| Ga0075340_10779301 | 3300014304 | Natural And Restored Wetlands | MLRRIPTEASNTRSDEPPYETNGSGIPVSGAMPSTAARFTAACPQM |
| Ga0167629_10249144 | 3300015209 | Glacier Forefield Soil | MSTPTAAIEMTRAEPPKETNGSGTPVTGARPITAQMFTTAC |
| Ga0132258_102240046 | 3300015371 | Arabidopsis Rhizosphere | MLRRMPTQASATTSLEPPYETNGSGIPVSGASPITAARLIAACPQT |
| Ga0132256_1000787181 | 3300015372 | Arabidopsis Rhizosphere | MLRTIPTEASSTTRLEPPYDRNGSGIPVSGAIPITAAMLIAA |
| Ga0132257_1035954831 | 3300015373 | Arabidopsis Rhizosphere | MLRRTPTPTSITTRLEPPYETKGSGIPVSGATPMTAAMLIAAWPQTSAVIP |
| Ga0132255_1002116564 | 3300015374 | Arabidopsis Rhizosphere | MLRRIPVAASSTMRLEPPYETNGSGIPVSGAMPSVAARLIAACPH |
| Ga0182041_112829782 | 3300016294 | Soil | MLRRIPTAASAAIRLEPPYETKGRVMPVSGAIARTAARLIAAWPQ |
| Ga0182037_108618531 | 3300016404 | Soil | MLRRTPTPTSITTRLEPPYETNGSGIPVSGATPITAAMFTVA |
| Ga0136617_103015051 | 3300017789 | Polar Desert Sand | MLRRTPTPVSITTRLDPPAETNGSGIPVSGAIPRTAARLTAA |
| Ga0163161_107563102 | 3300017792 | Switchgrass Rhizosphere | MLRRIPTQASATTRLEPPYETNGSGIPVSGASPITAARLIAAWPQTSAVR |
| Ga0187776_114838541 | 3300017966 | Tropical Peatland | MLRRIPTDTSATTRLEPPYDTNGSGIPVSGASPITAARLIA |
| Ga0187788_103913231 | 3300018032 | Tropical Peatland | MLRRMPTPISSTTRLDPPYDRNGSGIPVSGAAPITA |
| Ga0190272_100133685 | 3300018429 | Soil | MLGRIPVAARRTTRLDPPYETKGSGMPVSGAIPSTAA |
| Ga0193751_10054939 | 3300019888 | Soil | MLRSTPTPASMTTRLEPPYETNGSGIPVSGATPIAAAMLIAA |
| Ga0193751_10095991 | 3300019888 | Soil | MLRRTPTPASITTRLEPPYETNGSGIPVSGATPSAAAML |
| Ga0206353_104253683 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRRIPTPASSTTRLEPPYERNGSGIPVNGAAPITARMFT |
| Ga0247786_10283041 | 3300022883 | Soil | MLRSTPTQQSSTRSDEPPYETKGSGIPVNGAMPSTAARLTAACPQISVVMPAASRL |
| Ga0208586_10871181 | 3300025588 | Arctic Peat Soil | MLRRIPTPRRVMTRLEPPYDTNGSGIPVSGASPRTAARLIAACPQ |
| Ga0207699_108979161 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRSTPTDRSATTRLEPPYETNGSGIPVSGASPRTAARLIAAW |
| Ga0207699_109896001 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRRIPTEASSTTRLEPPYERNGSGMPVRGATPITAATLTTACP |
| Ga0207684_102929913 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRRIPTDRSTTTRLEPPYDTNGSGIPVRGASPSTAA |
| Ga0207707_106168021 | 3300025912 | Corn Rhizosphere | MLRRIPTQASATTRLEPPYETNGSGIPVSGASPITAARLIAAWPQT |
| Ga0207693_112153251 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRRTPTESSATTRLEPPYDTNGSGMPVSGARPRTAARLIAACPVMSAV |
| Ga0207663_114650281 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRRIPTQASATTRLEPPYDTNGSGIPVSGASPITAARLIAAWPQTSAVR |
| Ga0207687_106613002 | 3300025927 | Miscanthus Rhizosphere | MLRRTPTPTSITTRLEPPYETNGSGIPVSGATPMAAAMLIAAW |
| Ga0207664_105957371 | 3300025929 | Agricultural Soil | MPTEASITTRLEPPYETKGSGIPVSGARPTAAAMLIAACPQTS |
| Ga0207706_108246281 | 3300025933 | Corn Rhizosphere | MLRRMPTHARPTTRLEPPYETNGSGIPVSGARPITAARLI |
| Ga0207669_101284881 | 3300025937 | Miscanthus Rhizosphere | MLRRIPTDASSTTRLDPPYETNGSGIPVSGATPSTAARLTAAWPQTSEV |
| Ga0207661_105143071 | 3300025944 | Corn Rhizosphere | MLRRIPTEASSTTRLEPPYERNGSGMPVSGAMPITA |
| Ga0207667_110320372 | 3300025949 | Corn Rhizosphere | MLRRTPTPTSITTRLEPPYDTKGSGIPVSGAMPTQAAMLIAACPQTSAVIPAA |
| Ga0207667_111295741 | 3300025949 | Corn Rhizosphere | MLRRIPTPASRTTRLEQPYERNGSGIPVRGAAPITARMFTAAC |
| Ga0207668_118243161 | 3300025972 | Switchgrass Rhizosphere | MLRRTPTDASDTTRLDPPYETNGSVIPVSGASPRTAARLTSA |
| Ga0207998_10168991 | 3300025989 | Rice Paddy Soil | MLRRMPTDASVTTRLEPPYETNGSGIPVSGASPSTAARL |
| Ga0208528_10011631 | 3300026019 | Rice Paddy Soil | MLRRMPTDASVTTRLEPPYETNGSGIPVSGASPSTAARLIAACPQTSAV |
| Ga0207677_107874931 | 3300026023 | Miscanthus Rhizosphere | MLRRIPTQASATTRLEPPYETNGSGIPVSGASPITAARLIAAWPQ |
| Ga0208291_10744471 | 3300026111 | Natural And Restored Wetlands | MPTPASSTTRLDPPYETNGSGIPVSGAIPSTAARLIAACPATS |
| Ga0207698_100827124 | 3300026142 | Corn Rhizosphere | MLRRIPTPASSTTRLEPPYERNGSGIPVNGAAPITARMFTAA |
| Ga0209234_11593982 | 3300026295 | Grasslands Soil | MLRRIPTPRSATTRLEPPYEMNGSGIPVSGASPTTAARLIT |
| Ga0209059_12907882 | 3300026527 | Soil | MLRRTPTAASITTRLDPPYETNGSGIPVNGATPIAAAMLIAACPQ |
| Ga0209059_13273362 | 3300026527 | Soil | MLRRTPTDRSATTRDEPPYEMNGSGMPVNGASPRTAA |
| Ga0209998_101227461 | 3300027717 | Arabidopsis Thaliana Rhizosphere | MLRRMPTHARPTTRLEPPYETNGSGIPVSGARPITA |
| Ga0209178_12276362 | 3300027725 | Agricultural Soil | MLRRTPTEASITTRLEPPYETNGSGIPVSGARPTAA |
| Ga0209178_13998082 | 3300027725 | Agricultural Soil | MLRRIPTQASATTRLDPPYETNGSGIPVSGARPMTAARLIAAWPQTSAVSPA |
| Ga0209073_104304851 | 3300027765 | Agricultural Soil | MLRRIPTDASTTTTLVPPYDTRGSGMPVSGAIPTTAVRFSA |
| Ga0209811_101630091 | 3300027821 | Surface Soil | MLRRIPTQASATTRLEPPYETNGSGIPVSGASPITAARLIAAWP |
| Ga0209683_103369561 | 3300027840 | Wetland Sediment | MPTDASNTTRLEPPYERNGSGIPVSGAIPTTAAAFTAAWPQTSVVSPA |
| Ga0209579_100874981 | 3300027869 | Surface Soil | MPTAASRTTRLDPPYERNGSGIPVNGAIPITAAMLTAACPHTSTVS |
| Ga0209465_104843901 | 3300027874 | Tropical Forest Soil | MLRRIPTEARRTTRLEPPYETNGSGIPVSGATPITAAM |
| Ga0247822_118170972 | 3300028592 | Soil | MLRSTPTQQSSTRSDEPPYETNGSGIPVNGAIPRTAARLTAACPQIRVV |
| Ga0247821_104708501 | 3300028596 | Soil | MLRSTPTDASSTSSEEPPYETNGSGIPVSGASPSTAERLTAAWAQTSVVM |
| Ga0307285_101857001 | 3300028712 | Soil | MLRRIPIAARSTTRLEPPYETNGSGIPVSGAIPRAAA |
| Ga0307319_100969641 | 3300028722 | Soil | MLRRMPTDASATTRLEPPYETNGSGIPVSGARPITAAR |
| Ga0307280_103702601 | 3300028768 | Soil | MLRRMPTDASMTTRLVPPYDTRGSGIPVSGATPTTAARLS |
| Ga0307320_104665261 | 3300028771 | Soil | MLRRMPVAASRTTRLDPPYETNGSGIPVRGATPSTA |
| Ga0307302_103790751 | 3300028814 | Soil | MLRRMPTDARTTTRLVPPYETSGSGIPVSGAIPTTAARFSAACPQTRAVS |
| Ga0307302_105750731 | 3300028814 | Soil | MLRRTPTETSATTRLVPPYETNGSGIPVSGARPITAARLIAAWPQTS |
| Ga0302254_102897422 | 3300028870 | Fen | MLRRIPTAPSNISNDEPPYEMNGRVIPVSGATPRTAARLTAACPAMSAVIP |
| Ga0307308_100270681 | 3300028884 | Soil | MLRRMPTEKSSTTRLEPPYETNGRGIPVSGANPRTAARLM |
| Ga0265324_100474183 | 3300029957 | Rhizosphere | MLRSTPTEPSITMRLEPPYERNGSGIPVNGAAPTTA |
| Ga0299906_111572881 | 3300030606 | Soil | MLRRMPTAARPTTRLEPPYETNGSGIPVSGARPMTALTFTAACPQT |
| Ga0310813_117390992 | 3300031716 | Soil | MLRRIPTDASTTTTLVPPYDTSGSGIPVNGAIPTTAARFSAACPQTSTVSPVAT |
| Ga0310813_123150611 | 3300031716 | Soil | MLRSTPTQQSSTRSDEPPYETKGSGIPVNGAMPRTAARLTAACPQISVVMPAASR |
| Ga0318494_102502711 | 3300031751 | Soil | MLRRTPTPTSITTRLEPPYETNGSGIPVSGATPIAAAMLIAACPQTSAVI |
| Ga0318494_105733141 | 3300031751 | Soil | MLRRIPTAASSTTRLDPPYERNGSGMPVSGASPITAAMFTAA |
| Ga0318547_106957352 | 3300031781 | Soil | MLRRMPTPASRTTRLEPPYERNGSGMPVSGAIPITAAMLIAACAHTS |
| Ga0318497_107659741 | 3300031805 | Soil | MLRRIPTAARRTTRLDPPYERNGSGIPVSGASPMTAAMLTAAWPQMS |
| Ga0318511_102191201 | 3300031845 | Soil | MLRRIPTETSSTTRLEPPYETNGSGIPVSGASPRTA |
| Ga0306923_116367432 | 3300031910 | Soil | MLRRIPTAASAAIRLEPPYETKGRVMPVSGAIARTAARLIAAWPQM |
| Ga0311367_110552842 | 3300031918 | Fen | MLRRTPTAASRTINDDPPYETKGSGIPVSGAIPRTAQRFTAA |
| Ga0308175_1012095731 | 3300031938 | Soil | MLRRTPTPASITTRLEPPYETNGRGIPVSGARPMAAAMLIAACPQTR |
| Ga0308175_1020685542 | 3300031938 | Soil | MLRRTPTPTSITTRLEPPDETNGSGIPVSGAIPTQAAM |
| Ga0310910_111755392 | 3300031946 | Soil | MLRRTPTPTSITTRLEPPYETNGSGIPVSGATPIAAAMLIAACPQ |
| Ga0308176_117444872 | 3300031996 | Soil | MLRRIPTAARRTTRLEPPYERNGSGIPVSGALPITARMLMAA |
| Ga0308176_128057161 | 3300031996 | Soil | MLRTIPTDASRTIRLDPPYDRNGSGIPVSGALPITAATLIAA |
| Ga0307470_105548762 | 3300032174 | Hardwood Forest Soil | MLRRIPTEASATTRLEPPYETNGSGIPVSGASPSTAARLIAACPQM |
| Ga0310810_113589692 | 3300033412 | Soil | MLRRMPTQASATTRLEPPYETNGSGIPVSGASPITAARLIAA |
| Ga0247830_113408811 | 3300033551 | Soil | MLRRMPTDASMTTRLVPPYDTRGRGTPVSGAAPTTAA |
| ⦗Top⦘ |