NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F049183

Metagenome / Metatranscriptome Family F049183

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F049183
Family Type Metagenome / Metatranscriptome
Number of Sequences 147
Average Sequence Length 43 residues
Representative Sequence MLRRMPTQASATTRLEPPYETNGSGIPVSGASPITAARLIAA
Number of Associated Samples 130
Number of Associated Scaffolds 147

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 15.65 %
% of genes near scaffold ends (potentially truncated) 96.60 %
% of genes from short scaffolds (< 2000 bps) 90.48 %
Associated GOLD sequencing projects 124
AlphaFold2 3D model prediction Yes
3D model pTM-score0.18

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.673 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(14.966 % of family members)
Environment Ontology (ENVO) Unclassified
(23.129 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.537 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 11.43%    β-sheet: 2.86%    Coil/Unstructured: 85.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.18
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 147 Family Scaffolds
PF03033Glyco_transf_28 72.11
PF04101Glyco_tran_28_C 15.65
PF08245Mur_ligase_M 3.40
PF01565FAD_binding_4 2.04
PF01225Mur_ligase 1.36
PF02873MurB_C 1.36
PF12327FtsZ_C 0.68
PF07690MFS_1 0.68
PF00282Pyridoxal_deC 0.68
PF07228SpoIIE 0.68
PF02347GDC-P 0.68
PF08486SpoIID 0.68

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 147 Family Scaffolds
COG0769UDP-N-acetylmuramyl tripeptide synthaseCell wall/membrane/envelope biogenesis [M] 1.36
COG0770UDP-N-acetylmuramyl pentapeptide synthaseCell wall/membrane/envelope biogenesis [M] 1.36
COG0773UDP-N-acetylmuramate-alanine ligase MurC and related ligases, MurC/Mpl familyCell wall/membrane/envelope biogenesis [M] 1.36
COG0812UDP-N-acetylenolpyruvoylglucosamine reductaseCell wall/membrane/envelope biogenesis [M] 1.36
COG0076Glutamate or tyrosine decarboxylase or a related PLP-dependent proteinAmino acid transport and metabolism [E] 0.68
COG0403Glycine cleavage system protein P (pyridoxal-binding), N-terminal domainAmino acid transport and metabolism [E] 0.68
COG1003Glycine cleavage system protein P (pyridoxal-binding), C-terminal domainAmino acid transport and metabolism [E] 0.68
COG2385Peptidoglycan hydrolase (amidase) enhancer domain SpoIIDCell wall/membrane/envelope biogenesis [M] 0.68


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.67 %
UnclassifiedrootN/A16.33 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352031|2206147832All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300001535|A3PFW1_10286021All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300001686|C688J18823_10181507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1430Open in IMG/M
3300001989|JGI24739J22299_10113913Not Available811Open in IMG/M
3300003990|Ga0055455_10266604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium545Open in IMG/M
3300003996|Ga0055467_10161706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium675Open in IMG/M
3300004081|Ga0063454_100086706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1433Open in IMG/M
3300004114|Ga0062593_101339848All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300005178|Ga0066688_10603890All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300005294|Ga0065705_11109767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium521Open in IMG/M
3300005334|Ga0068869_101111803Not Available692Open in IMG/M
3300005336|Ga0070680_100085484All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2606Open in IMG/M
3300005344|Ga0070661_100946757All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300005435|Ga0070714_100551329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1104Open in IMG/M
3300005440|Ga0070705_101578708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium552Open in IMG/M
3300005441|Ga0070700_101118593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria654Open in IMG/M
3300005451|Ga0066681_10170111All Organisms → cellular organisms → Bacteria1291Open in IMG/M
3300005529|Ga0070741_10028666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter7959Open in IMG/M
3300005533|Ga0070734_10702937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium575Open in IMG/M
3300005563|Ga0068855_102094811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium570Open in IMG/M
3300005587|Ga0066654_10730581All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300005598|Ga0066706_11335084All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300005616|Ga0068852_100082140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2862Open in IMG/M
3300005616|Ga0068852_100941190Not Available882Open in IMG/M
3300005713|Ga0066905_101287595Not Available657Open in IMG/M
3300005836|Ga0074470_11505490All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300005842|Ga0068858_100426005All Organisms → cellular organisms → Bacteria1276Open in IMG/M
3300005885|Ga0075284_1016097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium889Open in IMG/M
3300005896|Ga0075282_1066554Not Available539Open in IMG/M
3300006046|Ga0066652_101215178Not Available713Open in IMG/M
3300006046|Ga0066652_101346592All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300006173|Ga0070716_100218874All Organisms → cellular organisms → Bacteria1278Open in IMG/M
3300006804|Ga0079221_10753369All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300006852|Ga0075433_10162571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1987Open in IMG/M
3300009012|Ga0066710_101902203Not Available890Open in IMG/M
3300009098|Ga0105245_10618711All Organisms → cellular organisms → Bacteria1111Open in IMG/M
3300009137|Ga0066709_100915966All Organisms → cellular organisms → Bacteria1278Open in IMG/M
3300009137|Ga0066709_101288024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1072Open in IMG/M
3300009156|Ga0111538_10191962All Organisms → cellular organisms → Bacteria2592Open in IMG/M
3300009176|Ga0105242_11553149All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300009814|Ga0105082_1107440Not Available532Open in IMG/M
3300009821|Ga0105064_1147956Not Available505Open in IMG/M
3300009870|Ga0131092_10433782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1209Open in IMG/M
3300010038|Ga0126315_10116924All Organisms → cellular organisms → Bacteria1548Open in IMG/M
3300010333|Ga0134080_10504451Not Available575Open in IMG/M
3300010360|Ga0126372_11870492Not Available645Open in IMG/M
3300010399|Ga0134127_13034912All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300010399|Ga0134127_13355704All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300010880|Ga0126350_10332028All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300011400|Ga0137312_1028241Not Available842Open in IMG/M
3300012198|Ga0137364_10952503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium650Open in IMG/M
3300012200|Ga0137382_10247035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1236Open in IMG/M
3300012200|Ga0137382_11135248All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300012488|Ga0157343_1007418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium765Open in IMG/M
3300012911|Ga0157301_10285377All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300012915|Ga0157302_10390313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium571Open in IMG/M
3300012915|Ga0157302_10466962All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria537Open in IMG/M
3300012916|Ga0157310_10262276All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300012925|Ga0137419_11096554All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300012951|Ga0164300_10993365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium539Open in IMG/M
3300012960|Ga0164301_10437305All Organisms → cellular organisms → Bacteria926Open in IMG/M
3300012972|Ga0134077_10555500Not Available515Open in IMG/M
3300012987|Ga0164307_10824602All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300012989|Ga0164305_10742632All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300013105|Ga0157369_10966769All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300013308|Ga0157375_10928838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1013Open in IMG/M
3300014150|Ga0134081_10206367All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300014150|Ga0134081_10350331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium542Open in IMG/M
3300014157|Ga0134078_10653834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium510Open in IMG/M
3300014263|Ga0075324_1175527Not Available508Open in IMG/M
3300014304|Ga0075340_1077930All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300015209|Ga0167629_1024914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2157Open in IMG/M
3300015371|Ga0132258_10224004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia4577Open in IMG/M
3300015372|Ga0132256_100078718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3146Open in IMG/M
3300015373|Ga0132257_103595483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium564Open in IMG/M
3300015374|Ga0132255_100211656All Organisms → cellular organisms → Bacteria2748Open in IMG/M
3300016294|Ga0182041_11282978All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300016404|Ga0182037_10861853Not Available784Open in IMG/M
3300017789|Ga0136617_10301505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1318Open in IMG/M
3300017792|Ga0163161_10756310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium813Open in IMG/M
3300017966|Ga0187776_11483854All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300018032|Ga0187788_10391323All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300018429|Ga0190272_10013368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia4095Open in IMG/M
3300019888|Ga0193751_1005493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD00597097Open in IMG/M
3300019888|Ga0193751_1009599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia5157Open in IMG/M
3300020082|Ga0206353_10425368All Organisms → cellular organisms → Bacteria1413Open in IMG/M
3300022883|Ga0247786_1028304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1083Open in IMG/M
3300025588|Ga0208586_1087118All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300025906|Ga0207699_10897916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium654Open in IMG/M
3300025906|Ga0207699_10989600Not Available622Open in IMG/M
3300025910|Ga0207684_10292991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1403Open in IMG/M
3300025912|Ga0207707_10616802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium917Open in IMG/M
3300025915|Ga0207693_11215325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium568Open in IMG/M
3300025916|Ga0207663_11465028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium550Open in IMG/M
3300025927|Ga0207687_10661300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium884Open in IMG/M
3300025929|Ga0207664_10595737All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium992Open in IMG/M
3300025933|Ga0207706_10824628All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300025937|Ga0207669_10128488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1736Open in IMG/M
3300025944|Ga0207661_10514307All Organisms → cellular organisms → Bacteria1095Open in IMG/M
3300025949|Ga0207667_11032037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium808Open in IMG/M
3300025949|Ga0207667_11129574Not Available766Open in IMG/M
3300025972|Ga0207668_11824316All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300025989|Ga0207998_1016899All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300026019|Ga0208528_1001163All Organisms → cellular organisms → Bacteria2531Open in IMG/M
3300026023|Ga0207677_10787493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium850Open in IMG/M
3300026111|Ga0208291_1074447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium599Open in IMG/M
3300026142|Ga0207698_10082712All Organisms → cellular organisms → Bacteria2596Open in IMG/M
3300026295|Ga0209234_1159398All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300026527|Ga0209059_1290788All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300026527|Ga0209059_1327336All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300027717|Ga0209998_10122746All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300027725|Ga0209178_1227636All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300027725|Ga0209178_1399808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium522Open in IMG/M
3300027765|Ga0209073_10430485All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300027821|Ga0209811_10163009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium832Open in IMG/M
3300027840|Ga0209683_10336956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium694Open in IMG/M
3300027869|Ga0209579_10087498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1650Open in IMG/M
3300027874|Ga0209465_10484390All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium618Open in IMG/M
3300028592|Ga0247822_11817097All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300028596|Ga0247821_10470850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium795Open in IMG/M
3300028712|Ga0307285_10185700Not Available579Open in IMG/M
3300028722|Ga0307319_10096964All Organisms → cellular organisms → Bacteria944Open in IMG/M
3300028768|Ga0307280_10370260All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300028771|Ga0307320_10466526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria510Open in IMG/M
3300028814|Ga0307302_10379075All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300028814|Ga0307302_10575073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium560Open in IMG/M
3300028870|Ga0302254_10289742Not Available604Open in IMG/M
3300028884|Ga0307308_10027068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2657Open in IMG/M
3300029957|Ga0265324_10047418All Organisms → cellular organisms → Bacteria1478Open in IMG/M
3300030606|Ga0299906_11157288Not Available559Open in IMG/M
3300031716|Ga0310813_11739099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium585Open in IMG/M
3300031716|Ga0310813_12315061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium509Open in IMG/M
3300031751|Ga0318494_10250271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1016Open in IMG/M
3300031751|Ga0318494_10573314Not Available659Open in IMG/M
3300031781|Ga0318547_10695735All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium632Open in IMG/M
3300031805|Ga0318497_10765974All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium541Open in IMG/M
3300031845|Ga0318511_10219120Not Available849Open in IMG/M
3300031910|Ga0306923_11636743All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300031918|Ga0311367_11055284Not Available812Open in IMG/M
3300031938|Ga0308175_101209573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium840Open in IMG/M
3300031938|Ga0308175_102068554All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300031946|Ga0310910_11175539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium596Open in IMG/M
3300031996|Ga0308176_11744487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium664Open in IMG/M
3300031996|Ga0308176_12805716Not Available518Open in IMG/M
3300032174|Ga0307470_10554876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium850Open in IMG/M
3300033412|Ga0310810_11358969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium550Open in IMG/M
3300033551|Ga0247830_11340881All Organisms → cellular organisms → Bacteria572Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil14.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.44%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.76%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere4.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.08%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.40%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.72%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.72%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.72%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.72%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil2.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.04%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.04%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.04%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.04%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.04%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.36%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.36%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.36%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.36%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.36%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.36%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.36%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.36%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.36%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.36%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.36%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.68%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.68%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.68%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.68%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.68%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.68%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.68%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.68%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.68%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.68%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.68%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.68%
Speleothem And Rock Wall SurfacesEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Speleothem And Rock Wall Surfaces0.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.68%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.68%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.68%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.68%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.68%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.68%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.68%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.68%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352031Cave microbial community (Speleothem B)EnvironmentalOpen in IMG/M
3300001535Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001989Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5Host-AssociatedOpen in IMG/M
3300003990Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2EnvironmentalOpen in IMG/M
3300003996Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005885Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401EnvironmentalOpen in IMG/M
3300005896Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009814Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60EnvironmentalOpen in IMG/M
3300009821Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30EnvironmentalOpen in IMG/M
3300009870Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plantEngineeredOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011400Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012488Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610Host-AssociatedOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014263Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1EnvironmentalOpen in IMG/M
3300014304Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300015209Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G3B, Proglacial river margin, by glacier terminus)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017789Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4EnvironmentalOpen in IMG/M
3300025588Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025989Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303 (SPAdes)EnvironmentalOpen in IMG/M
3300026019Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_305 (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026111Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026527Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)EnvironmentalOpen in IMG/M
3300027717Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027840Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028596Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028870Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300029957Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaGHost-AssociatedOpen in IMG/M
3300030606Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
22077762722199352031Speleothem And Rock Wall SurfacesMLRRIPTPARSTTKLEPPYETNGSGIPVSGAIPSTA
A3PFW1_1028602123300001535PermafrostMLRRTPTPASITTRLEPPYETNGSGIPVSGATPRAAAMLIAACPQTSAVI
C688J18823_1018150733300001686SoilMLRSNPTAASATTRLEPPADTNGSGIPVSGASPRTAAMLMIAC
JGI24739J22299_1011391313300001989Corn RhizosphereMLRSTPTQQSSTRSDEPPYETNGSGIPVSGAMPRTAARLTAACPQI
Ga0055455_1026660413300003990Natural And Restored WetlandsMPTDASMTTRLEPPYDTNGSGIPVSGASPRTAARLIAAWPQTSAVMP
Ga0055467_1016170613300003996Natural And Restored WetlandsMPTAASSTSRLVPPNETNGSGMPVSGAIPSTAARFTAACPQTSEVIPA
Ga0063454_10008670633300004081SoilMLRRMPTERSATTRLEPPYETKGSGMPVSGARPSTAARLIAACPEM
Ga0062593_10133984823300004114SoilMLRRMPTHARPTTRLEPPYETNGSGIPVSGARPITAARLIAA
Ga0066688_1060389013300005178SoilMLRRMPTDASWTTRLEPPYETNGSGIPVSGASPRTAARLI
Ga0065705_1110976723300005294Switchgrass RhizosphereMPTETSSTTRLEPPYETNGSGIPVSGAIPRTAARLMQAWQQTSAV
Ga0068869_10111180313300005334Miscanthus RhizosphereMLRSTPTPASITSSDDPPYETNGSGIPVSGAMPSTAARLTAAWPQTSVVI
Ga0070680_10008548443300005336Corn RhizosphereMLRRIPTERRAMTRLEPPYETNGSGIPVSGASPSTAARLI
Ga0070661_10094675713300005344Corn RhizosphereMLRSTPTQQSSTRSDEPPYDTNGSGIPVNGAMPRTAARLTAACPQISVVMPAAS
Ga0070714_10055132923300005435Agricultural SoilMLRSMPTEASITTRLEPPYETKGSGIPVSGARPTAAAMLIAACPQT
Ga0070705_10157870823300005440Corn, Switchgrass And Miscanthus RhizosphereMLRRIPVAASRTTRLEPPYETNGSGIPVSGATPIAAAMLIAACP
Ga0070700_10111859323300005441Corn, Switchgrass And Miscanthus RhizosphereMLRRIPTDASSTTRLDPPYETNGSGIPVSGASPITAARLIAA
Ga0066681_1017011123300005451SoilMLRRIPTPRRVTTRLEPPYDTNGSGIPVRGASPSTAARLIAAWPQMSA
Ga0070741_1002866693300005529Surface SoilMLRSTPTAPRTTTRLEPPYETNGSGTPVSGAIPTTAARL
Ga0070734_1070293713300005533Surface SoilMLRRMPTLARRTIRLDPPYERNGSGIPVRGATPMTAAMLTKA*
Ga0068855_10209481113300005563Corn RhizosphereMLRRTPTEASDTTRLDPPYETNGSGIPVSGARPMTAARLIAAWPQTSAV
Ga0066654_1073058123300005587SoilMLRRIPTPARRTTRLEPPYERNGSGIPVNGALPIT
Ga0066706_1133508423300005598SoilMLRRTPTEASETMRLDPPYDTQGSVIPASGARPTTAARLISAW
Ga0068852_10008214013300005616Corn RhizosphereMLRRIPTPASSTTRLEPPYERNGSGIPVNGAAPITARM
Ga0068852_10094119023300005616Corn RhizosphereMLRRMPTDASMTTRLVPPYDTRGSGIPVSGATPTTAARLSA
Ga0066905_10128759523300005713Tropical Forest SoilMPTDASITTRLEPPYETNGSGIPVSGASPMTALTLRAAWPQMSAVIPVARS
Ga0074470_1150549013300005836Sediment (Intertidal)MLRRTPTEASSTISDEPPYETNGSGIPVSGAIPSTAQRLIAACPQTSVVM
Ga0068858_10042600513300005842Switchgrass RhizosphereMLRRIPTAARRTTRLEPPYERNGSGIPVSGAIPITAAVLIAAWPQTS
Ga0075284_101609713300005885Rice Paddy SoilMLRRTPTPASITTRLEPPYDTNGSGIPVSGASPTAAAMLIAACPQ
Ga0075282_106655423300005896Rice Paddy SoilMLRRTPTAASITTRLEPPYETNGSGMPVSGATPIAAAMLIAA
Ga0066652_10121517823300006046SoilMLRRMPTEASATTRLDPPYETNGSVIPVRGAMPTT
Ga0066652_10134659223300006046SoilMPTQASATTRLEPPYETNGSGIPVNGASPITAARLIAAWPQTSA
Ga0070716_10021887433300006173Corn, Switchgrass And Miscanthus RhizosphereMLRSMPTEASITTRLEPPYETKGSGIPVSGARPTAAAMLIAACP
Ga0079221_1075336923300006804Agricultural SoilMPTETSSTTRLEPPYETNGSGIPVNGARPRTAARLIVAWQ
Ga0075433_1016257113300006852Populus RhizosphereMLRRTPTPVSSTSRDEPPYETNGSGIPVNGAIPRTAARLTAA
Ga0066710_10190220323300009012Grasslands SoilMPTEASATTRLDPPYETNGSVIPVRGAMPTTAATFSA
Ga0105245_1061871113300009098Miscanthus RhizosphereMLRRIPTPASSTTRLEPPYDRNGSGIPVNGAAPITARMFT
Ga0066709_10091596613300009137Grasslands SoilMLRRMPTDRSATTRLEPPYETKGSGIPVSGASPRTA
Ga0066709_10128802413300009137Grasslands SoilMLRRIPTAARRTTRLDPPYERNGSGIPVRGALPITARMLIDA
Ga0111538_1019196213300009156Populus RhizosphereMLRSTPTQQSSTRSDEPPYETNGSGIPVNGAIPRTAARLTA
Ga0105242_1155314913300009176Miscanthus RhizosphereMLRRTPTPTSITTRLEPPYETKGSGMPVSGASPSTAARLTAA
Ga0105082_110744013300009814Groundwater SandMLRRMPTEASMTTRLEPPYETNGSGIPVRGARPITALTLTAACPQMSAV
Ga0105064_114795623300009821Groundwater SandMLRRIPTEASMTTRLEPPYETNGSGIPVRGARPITALTLTAAWPQMS
Ga0131092_1043378213300009870Activated SludgeMLRRMPTAPSNMRSDEPPYEMNGRVIPVSGATPSTAARFTAACPAMS
Ga0126315_1011692413300010038Serpentine SoilMPTAASATIKLEPPYETNGSGMPVSGAMPITAQRLTVAWPQTSA
Ga0134080_1050445113300010333Grasslands SoilMLRRMPTEASATTRLDPPYETNGSVIPVRGAMPTTAATFSA
Ga0126372_1187049223300010360Tropical Forest SoilMLRRIPTLASRTTRLEPPYERNGSGMPVSGALPITARMLIAAW
Ga0134127_1303491213300010399Terrestrial SoilMLRSTPTDRSATTRLEPPYETNGSGMPVSGARPSTAARLTADCPHTSA
Ga0134127_1335570413300010399Terrestrial SoilMLRRIPTPASSTTRLEPPYERNGSGIPVNGAAPITAR
Ga0126350_1033202813300010880Boreal Forest SoilMLRRIPTARRVMTRLEPPYDTNGSGIPVNGASPRTAARLIAACPQMR
Ga0137312_102824123300011400SoilMLRRTPTPVSITTRLEPPAETNGRGIPVSGAIPSTAARLTV
Ga0137364_1095250313300012198Vadose Zone SoilMLRSTPTEASATTRFEPPYEMNGRGIPVSGARPSTAARLIAA
Ga0137382_1024703523300012200Vadose Zone SoilMLRRMPTETSATTRLEPPYETNGSGIPVSGARPITAARLIDAWPQT
Ga0137382_1113524813300012200Vadose Zone SoilMLRRIPTETSATTMLEPPYETNGSGIPVSGARPITAARLID
Ga0157343_100741813300012488Arabidopsis RhizosphereMLRTIPTEASSTTRLEPPYDRNGSGIPVSGAIPITAAMLIAACPATS
Ga0157301_1028537713300012911SoilMLRRMPTQASATTRLDPPYETNGSGIPVSGARPITAARLIA
Ga0157302_1039031323300012915SoilMLRRMPTETSSTTRLEPPYETNGSGIPVSGAMPSTAARLIAA*
Ga0157302_1046696223300012915SoilMLRRIPTAPSSTTRLDPPYERNGSGMPVSGAMPITAQMLTAAWPQTST
Ga0157310_1026227613300012916SoilMLRRTPTAVSSTMSDEPPYETNGSGIPVSGAMPRTAQRLIAACPQTRVV
Ga0137419_1109655413300012925Vadose Zone SoilMLRRIPTAARRTTRLEPPYERKGSGIPVSGAVPITASM
Ga0164300_1099336513300012951SoilMLRRMPTEMSATTRLEPPYETNGSGIPVSGASPITAARLIAAWPQTSTVRP
Ga0164301_1043730523300012960SoilMLRRMPTQASATTRLEPPYETNGNGIPVSGASPITAARL
Ga0134077_1055550023300012972Grasslands SoilMLRSTPTAPSITMRLEPPYERNGSGIPVSGAAPTTAAMLI
Ga0164307_1082460213300012987SoilMLRRMPTQASATTRLEPPYETNGNGIPVSGASPITAA
Ga0164305_1074263223300012989SoilMLRRMPTDASSTTRLDPPYDRKGSGIPVSGATPMTAAMLMAAWP
Ga0157369_1096676923300013105Corn RhizosphereMLRRTPTARSETIRLEPPYETNGSGIPVSGASPKTAARLIAAWPLIRAVM
Ga0157375_1092883813300013308Miscanthus RhizosphereMLRRIPTEASATTRLEPPYETNGSGIPVSGASPITAARLIAAWP
Ga0134081_1020636723300014150Grasslands SoilMLRRTPTPTSITTRLDPPYDTKGSGIPVSGATPMQAAMLIAAC
Ga0134081_1035033113300014150Grasslands SoilMLRRTPTPTSITTRLEPPYETNGSGIPVSGATPMAAAMLIAACPQ
Ga0134078_1065383423300014157Grasslands SoilMLRRMPTETSSTTRLDPPYETNGSGIPVSGASPRTAARLITA*
Ga0075324_117552723300014263Natural And Restored WetlandsMLRSTPTPQSITRSEEPPYETNGSGMPVRGARPSTA
Ga0075340_107793013300014304Natural And Restored WetlandsMLRRIPTEASNTRSDEPPYETNGSGIPVSGAMPSTAARFTAACPQM
Ga0167629_102491443300015209Glacier Forefield SoilMSTPTAAIEMTRAEPPKETNGSGTPVTGARPITAQMFTTAC
Ga0132258_1022400463300015371Arabidopsis RhizosphereMLRRMPTQASATTSLEPPYETNGSGIPVSGASPITAARLIAACPQT
Ga0132256_10007871813300015372Arabidopsis RhizosphereMLRTIPTEASSTTRLEPPYDRNGSGIPVSGAIPITAAMLIAA
Ga0132257_10359548313300015373Arabidopsis RhizosphereMLRRTPTPTSITTRLEPPYETKGSGIPVSGATPMTAAMLIAAWPQTSAVIP
Ga0132255_10021165643300015374Arabidopsis RhizosphereMLRRIPVAASSTMRLEPPYETNGSGIPVSGAMPSVAARLIAACPH
Ga0182041_1128297823300016294SoilMLRRIPTAASAAIRLEPPYETKGRVMPVSGAIARTAARLIAAWPQ
Ga0182037_1086185313300016404SoilMLRRTPTPTSITTRLEPPYETNGSGIPVSGATPITAAMFTVA
Ga0136617_1030150513300017789Polar Desert SandMLRRTPTPVSITTRLDPPAETNGSGIPVSGAIPRTAARLTAA
Ga0163161_1075631023300017792Switchgrass RhizosphereMLRRIPTQASATTRLEPPYETNGSGIPVSGASPITAARLIAAWPQTSAVR
Ga0187776_1148385413300017966Tropical PeatlandMLRRIPTDTSATTRLEPPYDTNGSGIPVSGASPITAARLIA
Ga0187788_1039132313300018032Tropical PeatlandMLRRMPTPISSTTRLDPPYDRNGSGIPVSGAAPITA
Ga0190272_1001336853300018429SoilMLGRIPVAARRTTRLDPPYETKGSGMPVSGAIPSTAA
Ga0193751_100549393300019888SoilMLRSTPTPASMTTRLEPPYETNGSGIPVSGATPIAAAMLIAA
Ga0193751_100959913300019888SoilMLRRTPTPASITTRLEPPYETNGSGIPVSGATPSAAAML
Ga0206353_1042536833300020082Corn, Switchgrass And Miscanthus RhizosphereMLRRIPTPASSTTRLEPPYERNGSGIPVNGAAPITARMFT
Ga0247786_102830413300022883SoilMLRSTPTQQSSTRSDEPPYETKGSGIPVNGAMPSTAARLTAACPQISVVMPAASRL
Ga0208586_108711813300025588Arctic Peat SoilMLRRIPTPRRVMTRLEPPYDTNGSGIPVSGASPRTAARLIAACPQ
Ga0207699_1089791613300025906Corn, Switchgrass And Miscanthus RhizosphereMLRSTPTDRSATTRLEPPYETNGSGIPVSGASPRTAARLIAAW
Ga0207699_1098960013300025906Corn, Switchgrass And Miscanthus RhizosphereMLRRIPTEASSTTRLEPPYERNGSGMPVRGATPITAATLTTACP
Ga0207684_1029299133300025910Corn, Switchgrass And Miscanthus RhizosphereMLRRIPTDRSTTTRLEPPYDTNGSGIPVRGASPSTAA
Ga0207707_1061680213300025912Corn RhizosphereMLRRIPTQASATTRLEPPYETNGSGIPVSGASPITAARLIAAWPQT
Ga0207693_1121532513300025915Corn, Switchgrass And Miscanthus RhizosphereMLRRTPTESSATTRLEPPYDTNGSGMPVSGARPRTAARLIAACPVMSAV
Ga0207663_1146502813300025916Corn, Switchgrass And Miscanthus RhizosphereMLRRIPTQASATTRLEPPYDTNGSGIPVSGASPITAARLIAAWPQTSAVR
Ga0207687_1066130023300025927Miscanthus RhizosphereMLRRTPTPTSITTRLEPPYETNGSGIPVSGATPMAAAMLIAAW
Ga0207664_1059573713300025929Agricultural SoilMPTEASITTRLEPPYETKGSGIPVSGARPTAAAMLIAACPQTS
Ga0207706_1082462813300025933Corn RhizosphereMLRRMPTHARPTTRLEPPYETNGSGIPVSGARPITAARLI
Ga0207669_1012848813300025937Miscanthus RhizosphereMLRRIPTDASSTTRLDPPYETNGSGIPVSGATPSTAARLTAAWPQTSEV
Ga0207661_1051430713300025944Corn RhizosphereMLRRIPTEASSTTRLEPPYERNGSGMPVSGAMPITA
Ga0207667_1103203723300025949Corn RhizosphereMLRRTPTPTSITTRLEPPYDTKGSGIPVSGAMPTQAAMLIAACPQTSAVIPAA
Ga0207667_1112957413300025949Corn RhizosphereMLRRIPTPASRTTRLEQPYERNGSGIPVRGAAPITARMFTAAC
Ga0207668_1182431613300025972Switchgrass RhizosphereMLRRTPTDASDTTRLDPPYETNGSVIPVSGASPRTAARLTSA
Ga0207998_101689913300025989Rice Paddy SoilMLRRMPTDASVTTRLEPPYETNGSGIPVSGASPSTAARL
Ga0208528_100116313300026019Rice Paddy SoilMLRRMPTDASVTTRLEPPYETNGSGIPVSGASPSTAARLIAACPQTSAV
Ga0207677_1078749313300026023Miscanthus RhizosphereMLRRIPTQASATTRLEPPYETNGSGIPVSGASPITAARLIAAWPQ
Ga0208291_107444713300026111Natural And Restored WetlandsMPTPASSTTRLDPPYETNGSGIPVSGAIPSTAARLIAACPATS
Ga0207698_1008271243300026142Corn RhizosphereMLRRIPTPASSTTRLEPPYERNGSGIPVNGAAPITARMFTAA
Ga0209234_115939823300026295Grasslands SoilMLRRIPTPRSATTRLEPPYEMNGSGIPVSGASPTTAARLIT
Ga0209059_129078823300026527SoilMLRRTPTAASITTRLDPPYETNGSGIPVNGATPIAAAMLIAACPQ
Ga0209059_132733623300026527SoilMLRRTPTDRSATTRDEPPYEMNGSGMPVNGASPRTAA
Ga0209998_1012274613300027717Arabidopsis Thaliana RhizosphereMLRRMPTHARPTTRLEPPYETNGSGIPVSGARPITA
Ga0209178_122763623300027725Agricultural SoilMLRRTPTEASITTRLEPPYETNGSGIPVSGARPTAA
Ga0209178_139980823300027725Agricultural SoilMLRRIPTQASATTRLDPPYETNGSGIPVSGARPMTAARLIAAWPQTSAVSPA
Ga0209073_1043048513300027765Agricultural SoilMLRRIPTDASTTTTLVPPYDTRGSGMPVSGAIPTTAVRFSA
Ga0209811_1016300913300027821Surface SoilMLRRIPTQASATTRLEPPYETNGSGIPVSGASPITAARLIAAWP
Ga0209683_1033695613300027840Wetland SedimentMPTDASNTTRLEPPYERNGSGIPVSGAIPTTAAAFTAAWPQTSVVSPA
Ga0209579_1008749813300027869Surface SoilMPTAASRTTRLDPPYERNGSGIPVNGAIPITAAMLTAACPHTSTVS
Ga0209465_1048439013300027874Tropical Forest SoilMLRRIPTEARRTTRLEPPYETNGSGIPVSGATPITAAM
Ga0247822_1181709723300028592SoilMLRSTPTQQSSTRSDEPPYETNGSGIPVNGAIPRTAARLTAACPQIRVV
Ga0247821_1047085013300028596SoilMLRSTPTDASSTSSEEPPYETNGSGIPVSGASPSTAERLTAAWAQTSVVM
Ga0307285_1018570013300028712SoilMLRRIPIAARSTTRLEPPYETNGSGIPVSGAIPRAAA
Ga0307319_1009696413300028722SoilMLRRMPTDASATTRLEPPYETNGSGIPVSGARPITAAR
Ga0307280_1037026013300028768SoilMLRRMPTDASMTTRLVPPYDTRGSGIPVSGATPTTAARLS
Ga0307320_1046652613300028771SoilMLRRMPVAASRTTRLDPPYETNGSGIPVRGATPSTA
Ga0307302_1037907513300028814SoilMLRRMPTDARTTTRLVPPYETSGSGIPVSGAIPTTAARFSAACPQTRAVS
Ga0307302_1057507313300028814SoilMLRRTPTETSATTRLVPPYETNGSGIPVSGARPITAARLIAAWPQTS
Ga0302254_1028974223300028870FenMLRRIPTAPSNISNDEPPYEMNGRVIPVSGATPRTAARLTAACPAMSAVIP
Ga0307308_1002706813300028884SoilMLRRMPTEKSSTTRLEPPYETNGRGIPVSGANPRTAARLM
Ga0265324_1004741833300029957RhizosphereMLRSTPTEPSITMRLEPPYERNGSGIPVNGAAPTTA
Ga0299906_1115728813300030606SoilMLRRMPTAARPTTRLEPPYETNGSGIPVSGARPMTALTFTAACPQT
Ga0310813_1173909923300031716SoilMLRRIPTDASTTTTLVPPYDTSGSGIPVNGAIPTTAARFSAACPQTSTVSPVAT
Ga0310813_1231506113300031716SoilMLRSTPTQQSSTRSDEPPYETKGSGIPVNGAMPRTAARLTAACPQISVVMPAASR
Ga0318494_1025027113300031751SoilMLRRTPTPTSITTRLEPPYETNGSGIPVSGATPIAAAMLIAACPQTSAVI
Ga0318494_1057331413300031751SoilMLRRIPTAASSTTRLDPPYERNGSGMPVSGASPITAAMFTAA
Ga0318547_1069573523300031781SoilMLRRMPTPASRTTRLEPPYERNGSGMPVSGAIPITAAMLIAACAHTS
Ga0318497_1076597413300031805SoilMLRRIPTAARRTTRLDPPYERNGSGIPVSGASPMTAAMLTAAWPQMS
Ga0318511_1021912013300031845SoilMLRRIPTETSSTTRLEPPYETNGSGIPVSGASPRTA
Ga0306923_1163674323300031910SoilMLRRIPTAASAAIRLEPPYETKGRVMPVSGAIARTAARLIAAWPQM
Ga0311367_1105528423300031918FenMLRRTPTAASRTINDDPPYETKGSGIPVSGAIPRTAQRFTAA
Ga0308175_10120957313300031938SoilMLRRTPTPASITTRLEPPYETNGRGIPVSGARPMAAAMLIAACPQTR
Ga0308175_10206855423300031938SoilMLRRTPTPTSITTRLEPPDETNGSGIPVSGAIPTQAAM
Ga0310910_1117553923300031946SoilMLRRTPTPTSITTRLEPPYETNGSGIPVSGATPIAAAMLIAACPQ
Ga0308176_1174448723300031996SoilMLRRIPTAARRTTRLEPPYERNGSGIPVSGALPITARMLMAA
Ga0308176_1280571613300031996SoilMLRTIPTDASRTIRLDPPYDRNGSGIPVSGALPITAATLIAA
Ga0307470_1055487623300032174Hardwood Forest SoilMLRRIPTEASATTRLEPPYETNGSGIPVSGASPSTAARLIAACPQM
Ga0310810_1135896923300033412SoilMLRRMPTQASATTRLEPPYETNGSGIPVSGASPITAARLIAA
Ga0247830_1134088113300033551SoilMLRRMPTDASMTTRLVPPYDTRGRGTPVSGAAPTTAA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.