| Basic Information | |
|---|---|
| Family ID | F048958 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 147 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MARKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDLCLAIIT |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 147 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 72.60 % |
| % of genes near scaffold ends (potentially truncated) | 97.96 % |
| % of genes from short scaffolds (< 2000 bps) | 88.44 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (75.510 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (21.088 % of family members) |
| Environment Ontology (ENVO) | Unclassified (57.143 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (54.422 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.06% β-sheet: 0.00% Coil/Unstructured: 56.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 147 Family Scaffolds |
|---|---|---|
| PF03406 | Phage_fiber_2 | 5.44 |
| PF05065 | Phage_capsid | 0.68 |
| PF13385 | Laminin_G_3 | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 147 Family Scaffolds |
|---|---|---|---|
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.55 % |
| Unclassified | root | N/A | 22.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002835|B570J40625_100824120 | Not Available | 812 | Open in IMG/M |
| 3300003393|JGI25909J50240_1088416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
| 3300003431|JGI25913J50563_1032090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 820 | Open in IMG/M |
| 3300003431|JGI25913J50563_1075940 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
| 3300004125|Ga0066182_10060917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 861 | Open in IMG/M |
| 3300004448|Ga0065861_1016904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1687 | Open in IMG/M |
| 3300004804|Ga0007796_10202216 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
| 3300005527|Ga0068876_10411865 | Not Available | 752 | Open in IMG/M |
| 3300005527|Ga0068876_10625049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
| 3300005581|Ga0049081_10301560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
| 3300006637|Ga0075461_10216819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
| 3300006639|Ga0079301_1097740 | Not Available | 902 | Open in IMG/M |
| 3300006805|Ga0075464_10180504 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1249 | Open in IMG/M |
| 3300006805|Ga0075464_10438768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 796 | Open in IMG/M |
| 3300006805|Ga0075464_10497046 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 746 | Open in IMG/M |
| 3300006805|Ga0075464_10868358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300006805|Ga0075464_10869392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
| 3300006805|Ga0075464_11016186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
| 3300006917|Ga0075472_10510597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
| 3300006920|Ga0070748_1186011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
| 3300007538|Ga0099851_1113712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1025 | Open in IMG/M |
| 3300007538|Ga0099851_1349555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
| 3300007708|Ga0102859_1084956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 903 | Open in IMG/M |
| 3300007973|Ga0105746_1181674 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 716 | Open in IMG/M |
| 3300008119|Ga0114354_1025401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2651 | Open in IMG/M |
| 3300008266|Ga0114363_1014205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6335 | Open in IMG/M |
| 3300008266|Ga0114363_1075873 | Not Available | 1265 | Open in IMG/M |
| 3300008266|Ga0114363_1228384 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| 3300008448|Ga0114876_1189284 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 707 | Open in IMG/M |
| 3300008448|Ga0114876_1210305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 646 | Open in IMG/M |
| 3300008450|Ga0114880_1118868 | Not Available | 995 | Open in IMG/M |
| 3300008450|Ga0114880_1220449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
| 3300008450|Ga0114880_1273685 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
| 3300009149|Ga0114918_10320254 | Not Available | 862 | Open in IMG/M |
| 3300009152|Ga0114980_10172555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1278 | Open in IMG/M |
| 3300009160|Ga0114981_10193604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1116 | Open in IMG/M |
| 3300009164|Ga0114975_10340582 | Not Available | 825 | Open in IMG/M |
| 3300009165|Ga0105102_10556684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
| 3300009169|Ga0105097_10090318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1671 | Open in IMG/M |
| 3300009184|Ga0114976_10420828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
| 3300009194|Ga0114983_1094706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
| 3300009864|Ga0132193_100648 | Not Available | 1571 | Open in IMG/M |
| 3300010158|Ga0114960_10381889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
| 3300010334|Ga0136644_10195290 | All Organisms → Viruses → Predicted Viral | 1210 | Open in IMG/M |
| 3300010885|Ga0133913_11159683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1985 | Open in IMG/M |
| 3300010885|Ga0133913_12073900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1409 | Open in IMG/M |
| 3300010885|Ga0133913_12203138 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1358 | Open in IMG/M |
| 3300010970|Ga0137575_10085432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
| 3300011010|Ga0139557_1069771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
| 3300012012|Ga0153799_1033642 | Not Available | 977 | Open in IMG/M |
| 3300012017|Ga0153801_1031493 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 938 | Open in IMG/M |
| 3300012017|Ga0153801_1046901 | Not Available | 762 | Open in IMG/M |
| 3300012715|Ga0157599_1241427 | Not Available | 1138 | Open in IMG/M |
| 3300012733|Ga0157606_1150325 | Not Available | 1479 | Open in IMG/M |
| 3300013004|Ga0164293_10166936 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1620 | Open in IMG/M |
| 3300013006|Ga0164294_10747789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
| 3300013372|Ga0177922_11338860 | Not Available | 794 | Open in IMG/M |
| 3300014711|Ga0134314_110112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
| 3300014811|Ga0119960_1053675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
| 3300014811|Ga0119960_1059454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
| 3300015050|Ga0181338_1032755 | Not Available | 787 | Open in IMG/M |
| 3300015050|Ga0181338_1059793 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
| 3300017716|Ga0181350_1081313 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 819 | Open in IMG/M |
| 3300017716|Ga0181350_1092058 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
| 3300017736|Ga0181365_1020670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1658 | Open in IMG/M |
| 3300017754|Ga0181344_1149317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
| 3300017766|Ga0181343_1044221 | Not Available | 1321 | Open in IMG/M |
| 3300017766|Ga0181343_1225543 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
| 3300017780|Ga0181346_1226798 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
| 3300017784|Ga0181348_1011003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3919 | Open in IMG/M |
| 3300017784|Ga0181348_1212409 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
| 3300017784|Ga0181348_1262226 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
| 3300017785|Ga0181355_1216254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
| 3300017785|Ga0181355_1296182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300017785|Ga0181355_1389429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
| 3300019784|Ga0181359_1128556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 896 | Open in IMG/M |
| 3300021438|Ga0213920_1072784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
| 3300021956|Ga0213922_1116585 | Not Available | 529 | Open in IMG/M |
| 3300022072|Ga0196889_1074608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
| 3300022190|Ga0181354_1231290 | Not Available | 536 | Open in IMG/M |
| 3300022407|Ga0181351_1193068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 688 | Open in IMG/M |
| 3300022407|Ga0181351_1243961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
| 3300023174|Ga0214921_10074150 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2748 | Open in IMG/M |
| 3300024346|Ga0244775_11213730 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
| 3300024355|Ga0255157_1038113 | Not Available | 802 | Open in IMG/M |
| 3300024513|Ga0255144_1074272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
| 3300025076|Ga0209316_105643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1289 | Open in IMG/M |
| 3300025645|Ga0208643_1179613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
| 3300025896|Ga0208916_10255211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 762 | Open in IMG/M |
| 3300025896|Ga0208916_10553544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 501 | Open in IMG/M |
| 3300027693|Ga0209704_1239404 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
| 3300027697|Ga0209033_1060390 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1332 | Open in IMG/M |
| 3300027710|Ga0209599_10101087 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 759 | Open in IMG/M |
| 3300027741|Ga0209085_1155900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 960 | Open in IMG/M |
| 3300027763|Ga0209088_10011126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4851 | Open in IMG/M |
| 3300027763|Ga0209088_10044146 | All Organisms → cellular organisms → Bacteria | 2189 | Open in IMG/M |
| 3300027777|Ga0209829_10052116 | All Organisms → Viruses → Predicted Viral | 2160 | Open in IMG/M |
| 3300027785|Ga0209246_10177289 | Not Available | 836 | Open in IMG/M |
| 3300027806|Ga0209985_10059476 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2088 | Open in IMG/M |
| 3300027808|Ga0209354_10013098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3311 | Open in IMG/M |
| 3300027808|Ga0209354_10174152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 876 | Open in IMG/M |
| 3300027816|Ga0209990_10011875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5301 | Open in IMG/M |
| (restricted) 3300027970|Ga0247837_1240070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 720 | Open in IMG/M |
| (restricted) 3300028114|Ga0247835_1184446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 724 | Open in IMG/M |
| (restricted) 3300028559|Ga0247831_1044259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2419 | Open in IMG/M |
| (restricted) 3300029268|Ga0247842_10565770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
| 3300031758|Ga0315907_10187053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1741 | Open in IMG/M |
| 3300031758|Ga0315907_10283995 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1363 | Open in IMG/M |
| 3300031758|Ga0315907_10337806 | Not Available | 1228 | Open in IMG/M |
| 3300031786|Ga0315908_10724526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 818 | Open in IMG/M |
| 3300031787|Ga0315900_10554090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 855 | Open in IMG/M |
| 3300031857|Ga0315909_10028720 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5434 | Open in IMG/M |
| 3300031857|Ga0315909_10359036 | Not Available | 1061 | Open in IMG/M |
| 3300031857|Ga0315909_10402594 | Not Available | 980 | Open in IMG/M |
| 3300031857|Ga0315909_10418704 | Not Available | 953 | Open in IMG/M |
| 3300031857|Ga0315909_10981329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300031951|Ga0315904_10810109 | Not Available | 769 | Open in IMG/M |
| 3300032050|Ga0315906_10378268 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1242 | Open in IMG/M |
| 3300032050|Ga0315906_10978476 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
| 3300032092|Ga0315905_10019873 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6801 | Open in IMG/M |
| 3300032092|Ga0315905_11569818 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300032093|Ga0315902_10209184 | Not Available | 1947 | Open in IMG/M |
| 3300032093|Ga0315902_10418845 | Not Available | 1202 | Open in IMG/M |
| 3300032093|Ga0315902_10506066 | Not Available | 1049 | Open in IMG/M |
| 3300032093|Ga0315902_10644325 | Not Available | 877 | Open in IMG/M |
| 3300032093|Ga0315902_11028588 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
| 3300032116|Ga0315903_10509253 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 948 | Open in IMG/M |
| 3300033981|Ga0334982_0044575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2475 | Open in IMG/M |
| 3300033993|Ga0334994_0287757 | Not Available | 841 | Open in IMG/M |
| 3300033996|Ga0334979_0423377 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
| 3300034012|Ga0334986_0320398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 815 | Open in IMG/M |
| 3300034012|Ga0334986_0412974 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 683 | Open in IMG/M |
| 3300034062|Ga0334995_0397900 | Not Available | 863 | Open in IMG/M |
| 3300034066|Ga0335019_0676450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
| 3300034071|Ga0335028_0387680 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 802 | Open in IMG/M |
| 3300034092|Ga0335010_0440655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
| 3300034101|Ga0335027_0453521 | Not Available | 816 | Open in IMG/M |
| 3300034101|Ga0335027_0884532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
| 3300034104|Ga0335031_0408478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 851 | Open in IMG/M |
| 3300034112|Ga0335066_0531967 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
| 3300034121|Ga0335058_0733593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300034122|Ga0335060_0007353 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7343 | Open in IMG/M |
| 3300034168|Ga0335061_0000778 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16385 | Open in IMG/M |
| 3300034168|Ga0335061_0445966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
| 3300034280|Ga0334997_0344226 | Not Available | 955 | Open in IMG/M |
| 3300034284|Ga0335013_0658543 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 21.09% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 19.73% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 14.29% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.20% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 8.84% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.40% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.72% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.04% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.04% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 1.36% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.36% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.36% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.68% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.68% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.68% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.68% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.68% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.68% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.68% |
| Meromictic Pond | Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond | 0.68% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.68% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.68% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.68% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.68% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003431 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004125 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004804 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
| 3300009864 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 5, surface; RNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300010970 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016 | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012715 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES122 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012733 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES131 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014711 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0111 | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024355 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8h | Environmental | Open in IMG/M |
| 3300024513 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300025076 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - 3C3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027806 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027970 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5m | Environmental | Open in IMG/M |
| 3300028114 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5m | Environmental | Open in IMG/M |
| 3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
| 3300029268 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_19m | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
| 3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J40625_1008241201 | 3300002835 | Freshwater | MARKKVIDLDTYNALDAYSIALHEYYKSLRKAGFSIEIALALMSDR |
| JGI25909J50240_10884161 | 3300003393 | Freshwater Lake | MAKKKVIDLDTYNALDAWAISLHEMYRALIRAGFRSDIAMGLIV |
| JGI25913J50563_10320901 | 3300003431 | Freshwater Lake | MAKKKVIDLDTYSQLDQYSICMHEFYKSLRRAGFAVDLCLAIIVE |
| JGI25913J50563_10759402 | 3300003431 | Freshwater Lake | MAKKRVIDLDTYSALDVWAISLQEMYRALRRAGFPVDLALAVIVEPMAYPRWILPEPVEVEKF |
| Ga0066182_100609171 | 3300004125 | Freshwater Lake | MAKKKVIDLDTYNALDAWAISLHEMYRALIRAGFRSDIAMGLIVDKDIYPDWILP |
| Ga0065861_10169041 | 3300004448 | Marine | MAKKRVIDLDTYSALDVWAIGLQEMYRALRRAGFDVDLSLAIIVEPMAYPRWILARASRS |
| Ga0007796_102022163 | 3300004804 | Freshwater | MARKKVIDLETYNALDAHCIALNEFYKGLRRAGFAVDVAIAIIVEPSAYPEWIIPKPDLIPHEWDDDEED* |
| Ga0068876_104118651 | 3300005527 | Freshwater Lake | MARKKVIDLDTYTALDAWAISLQEMYRALRRAGMDVDLALAIIIEPT |
| Ga0068876_106250494 | 3300005527 | Freshwater Lake | MARKKVIDLDTYTALDAWAISLQEMYRALRRAGMDVDLA |
| Ga0049081_103015601 | 3300005581 | Freshwater Lentic | MARKKVIDLDTYSALDAWAISLQEMYRALRRAGFDVDIALGIITEPSAYPD |
| Ga0075461_102168191 | 3300006637 | Aqueous | MAKKKVIDLDTYNALDAYAISMHEFYKALRKAGFAVDLC |
| Ga0079301_10977401 | 3300006639 | Deep Subsurface | MARKKVIDLDTYSQLDAWAISLHEMYRALRKAGFA |
| Ga0075464_101805046 | 3300006805 | Aqueous | MAKKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDMCLAI |
| Ga0075464_104387681 | 3300006805 | Aqueous | MAKKKVIDLDTYNALDAWAIGLHEMYRALRRAGFGVDIALGIIMERHAYPD |
| Ga0075464_104970461 | 3300006805 | Aqueous | MARKKAIDLDTYNELDVWAISVNEMYKALRRAGMSID |
| Ga0075464_108683581 | 3300006805 | Aqueous | MARKKAIELDTYNELDAWAISLQEMYRALRRAGMSVDIAL |
| Ga0075464_108693921 | 3300006805 | Aqueous | MARKKAIDLDTYNALDVWAISVNEMYKALRRAGMSI |
| Ga0075464_110161863 | 3300006805 | Aqueous | MAKKKVIDLDTYNALDQWAISLHEMYRALRRAGFGVDIALGIIMERDAYP |
| Ga0075472_105105974 | 3300006917 | Aqueous | MAKKKVIDLDTYNALDVCAISLHEMYRVLIRDGFRSDIAMGIIMERDAYPDWILP |
| Ga0070748_11860114 | 3300006920 | Aqueous | MARKNVIDLDTYTALDAWAISLQEMYRALRRAGFEVDLALGIITEP |
| Ga0099851_11137121 | 3300007538 | Aqueous | MAKKKVIDLDTYNALDAYAISIHEFYKSLRRAGFAVDLCLAIIVERSAYPDWLLPS |
| Ga0099851_13495553 | 3300007538 | Aqueous | MAKKRVIDLDTYSALDVWAISLQEMYRALRRAGFPVDLALAVIVEPMAYPRWILPEPVEA |
| Ga0102859_10849564 | 3300007708 | Estuarine | MARKKVIDLDTYSALDAWAISLQEMYRALRRAGFEVDLALGILVEPSSFPDWILPKPDLIPHSWDDDDDED* |
| Ga0105746_11816741 | 3300007973 | Estuary Water | MAKKKVIDLDTYNALDAWAISLHEMYRALIRAGFRSDIAMGLIVDKEVYPDW |
| Ga0114354_10254011 | 3300008119 | Freshwater, Plankton | MARKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDMAL |
| Ga0114363_10142051 | 3300008266 | Freshwater, Plankton | MARKKVIDLDTYTALDAWAISLQEMYRALRRAGMDVDLALAIIIEPTAYPAWILPSPVDPERFG |
| Ga0114363_10758731 | 3300008266 | Freshwater, Plankton | MAKKKVIDLDTYNALDQYAICMHEFYKSLRRAGFAVDLCLGI |
| Ga0114363_12283841 | 3300008266 | Freshwater, Plankton | MARKKVIDLDTYTALDAWAISLQEMYRALRRAGMDVDLALAIIIEPTAYPAWILP |
| Ga0114876_11892841 | 3300008448 | Freshwater Lake | MARKKVIDLDTYNALDQWAISLHEMYRALRRAGFAVDICL |
| Ga0114876_12103051 | 3300008448 | Freshwater Lake | MAKKKVIDLDTYNALDQWAISLHEMYRALRRAGFAVDICL |
| Ga0114880_11188684 | 3300008450 | Freshwater Lake | MARKKVIDLDTYSQLDAWAISLHEMYRALRRAGFPVDMCLAIITDRDAYPDW |
| Ga0114880_12204494 | 3300008450 | Freshwater Lake | MARKKVIDLDTYNALDAYSIGLHEYYKSLRRAGFSIDICLALISDRESYP |
| Ga0114880_12736851 | 3300008450 | Freshwater Lake | MARKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDLCL |
| Ga0114918_103202544 | 3300009149 | Deep Subsurface | MAKKKVIDLDTYNQLDAWAISLHEMYRALRRAGFAVDISLALIADK |
| Ga0114980_101725555 | 3300009152 | Freshwater Lake | MARKKVIDLDTYSALDAWAISLQEMYRALRRAGFDVDIALG |
| Ga0114981_101936041 | 3300009160 | Freshwater Lake | MARKKVIDLDTYSALDAWAISLQEMYRALRRAGFDVDIALGIITEPSAYPDWILPKPDLIPHTYDED |
| Ga0114975_103405824 | 3300009164 | Freshwater Lake | MAKKKVIDLDTYSALDAYAISMNEFYKALRRAGFAVDLCLAIITD |
| Ga0105102_105566844 | 3300009165 | Freshwater Sediment | MAKKKVIDLDTYNALDQYAISMHEFYKSLRRAGFAVDLCLAIIT |
| Ga0105097_100903186 | 3300009169 | Freshwater Sediment | MARKKVIDLDTYTALDAWAISLQEMYRALRKSGFEVDLALAII |
| Ga0114976_104208281 | 3300009184 | Freshwater Lake | MAKKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDLCLAIITDRDS |
| Ga0114983_10947061 | 3300009194 | Deep Subsurface | MARKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDLCLSIIQDRDAYPDWI |
| Ga0132193_1006481 | 3300009864 | Meromictic Pond | MAKKKVIDLDTYSALDAYAISMHEFYKALRRAGFAVDLCLAIITDRDAYPD |
| Ga0114960_103818891 | 3300010158 | Freshwater Lake | MAKKRVIDLDTYNALDSWAITLNEMYKALRRSGFAVDIALAI |
| Ga0136644_101952901 | 3300010334 | Freshwater Lake | MAKKKVIDLDTYNALDSWAITLNEMYKALRRSGFAIDIALA |
| Ga0133913_111596837 | 3300010885 | Freshwater Lake | MAKKKVIDLDTYSALDAYAISMNEFYKALRRAGFAVDLCLAIITDRDAYPDW |
| Ga0133913_120739005 | 3300010885 | Freshwater Lake | MAKKRVIDLDTYNALDSWAITLNEMYKALRRSGFAVDIALAIIVDRDAYP |
| Ga0133913_122031385 | 3300010885 | Freshwater Lake | MARKKVIDLDTYSALDAWAISLQEMYRALRRAGFDVDIALGIITEPSAYPDWILPKPDLIPHTY |
| Ga0137575_100854321 | 3300010970 | Pond Fresh Water | MARKKVIDLDTYNALDAWAISLQEMYKALRRAGFDVETCLAIII |
| Ga0139557_10697711 | 3300011010 | Freshwater | MAKKRVIDLDTYSALDVWAISLQEMYRALRRAGFPVDLALAVIVEPMAYPRWILPEPAEVEKFGD |
| Ga0153799_10336421 | 3300012012 | Freshwater | MAKKKVIDLDTYSALNAYAISMNEFYKALRRAGFA |
| Ga0153801_10314931 | 3300012017 | Freshwater | MARKKVIDLDTYSQLDAWAISLHEMYRALRRAGFP |
| Ga0153801_10469011 | 3300012017 | Freshwater | MARKATNKLVDEGYSKLDAWAIGVHEMYRALRRAG |
| Ga0157599_12414271 | 3300012715 | Freshwater | MARKKVIDLDTYSALDAWAISLQEMYKALRRSGFDVDICLAIIV |
| Ga0157606_11503251 | 3300012733 | Freshwater | MARKKVIDLDTYSALDAWAISLQEMYKALRRSGFDVDICLAIIVEPSAYPD |
| Ga0164293_101669366 | 3300013004 | Freshwater | MAKKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDLCLSIIQDR |
| Ga0164294_107477893 | 3300013006 | Freshwater | MAKKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDISLAI |
| Ga0177922_113388601 | 3300013372 | Freshwater | MARKKVIDLDTYSQLDAWAISLHEMYRALRKAGFAVDLCLAIITDRDSYPDWILPT |
| Ga0134314_1101121 | 3300014711 | Surface Water | MARKKAIDLETYNELDAWAISLQEMYRALRRAGMSVDIALAIIVEP |
| Ga0119960_10536751 | 3300014811 | Aquatic | MARKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDLCLAIKQIVTGK |
| Ga0119960_10594541 | 3300014811 | Aquatic | MARKKVIDLDTYNALDAWAISLHEMYRALRRAGFAVDVALSIIHADRDWE |
| Ga0181338_10327553 | 3300015050 | Freshwater Lake | MARTKKVIDLDTYSALDAYAISMHEFYRALRRAGFAVDLCLGIITS |
| Ga0181338_10597931 | 3300015050 | Freshwater Lake | MAKKKVIDLDTYSALDAYAISMHEFYRALRRAGFAVDLCLGIITERGAYPDWLLPA |
| Ga0181350_10813132 | 3300017716 | Freshwater Lake | MAKKKVIDLDTYNALDAWAISLHEMYRALIRAGFRSDI |
| Ga0181350_10920581 | 3300017716 | Freshwater Lake | MARKKVIDLDTYSQLDAWAISLHEMYRALRRAGFA |
| Ga0181365_10206705 | 3300017736 | Freshwater Lake | MAKKKVIDLDTYNKLDQYAICMHEFYKSLRRAGFAVDLCLGIITERGAYPDWL |
| Ga0181344_11493172 | 3300017754 | Freshwater Lake | MAKKKVIDLDTYNALDAWAISLHEMYSSLRRAGFGVDIA |
| Ga0181343_10442216 | 3300017766 | Freshwater Lake | MAKKKVIDLDTYSRLDAWAISLHEMYRALRRAGFAVDLALSIIQDPDAYPDWILP |
| Ga0181343_12255431 | 3300017766 | Freshwater Lake | MAKKKVIDLDTYNALDQWAISLHEMYRALRRAGFAV |
| Ga0181346_12267984 | 3300017780 | Freshwater Lake | MARKKVIDLDTYSQLDAGAISLHEMYRALRRAGFAVDLC |
| Ga0181348_10110039 | 3300017784 | Freshwater Lake | MAKKKVIDLDTYSALDAYAISMHEFYRALRRAGFAVD |
| Ga0181348_12124091 | 3300017784 | Freshwater Lake | MARKKVIDLDTYSQLDQYAICMHEFYKSLRRAGFAVDLCLAIITDR |
| Ga0181348_12622263 | 3300017784 | Freshwater Lake | MARKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDMCL |
| Ga0181355_12162541 | 3300017785 | Freshwater Lake | MAKKKVIDLDTYNALDQWAISLHEMYRALRRAGFAVDISLALISDKDAYPDWILPSI |
| Ga0181355_12961824 | 3300017785 | Freshwater Lake | MARKKVIDLDTYTALDAWAISLQEMYRALRRAGFEVDLALAVIVEP |
| Ga0181355_13894292 | 3300017785 | Freshwater Lake | MAKKRVIDLDTYSALDVWAISLQEMYRALRRAGFPVDLALAVIVEPMAYPRWILPEP |
| Ga0181359_11285563 | 3300019784 | Freshwater Lake | MARKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDL |
| Ga0213920_10727841 | 3300021438 | Freshwater | MARKKVIDLDTYSALDAYAISMHEFYKALRRAGFAVDLCLAIITDRDAY |
| Ga0213922_11165851 | 3300021956 | Freshwater | MARKKAIDLETYNELDVWAISINEMYKALRRAGMSVDIALAI |
| Ga0196889_10746081 | 3300022072 | Aqueous | MARKKVIDLDTYSQLDAWAISLHEMYRALRKAGFAVDLCLA |
| Ga0181354_12312902 | 3300022190 | Freshwater Lake | MARKKVIDLDTYNALDAWAIGINEMYKALRRAGVATDLCVAIIIEPSAYPD |
| Ga0181351_11930681 | 3300022407 | Freshwater Lake | MARKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDLCLAIITDREAYPGWT |
| Ga0181351_12439611 | 3300022407 | Freshwater Lake | MAKKKVIDLDTYNELDAWAISLHEMYRALIRAGFRSDIAMGLIVD |
| Ga0214921_100741508 | 3300023174 | Freshwater | MAKKKVIDLDTYSALDAWAISLQEMYRALRRAGFDVELSLAIIVEPSA |
| Ga0244775_112137301 | 3300024346 | Estuarine | MARTKKVIDLDTYSALDAYAISIHEFYRALRRAGFA |
| Ga0255157_10381134 | 3300024355 | Freshwater | MAKKKVIDLDTYNALDAWAICLHEMWTALKKAGFTTDIALA |
| Ga0255144_10742724 | 3300024513 | Freshwater | MAKKKVIDLDTYNALDAWAICLHEMWTALKKAGFTTDIALALVMDKDAYPE |
| Ga0209316_1056436 | 3300025076 | Freshwater | MARKKVIDLDTYTALDAWAISLQEMYRALRRAGFEVDLALAVIVEPSAYPDWIIPKPDLIPHTYE |
| Ga0208643_11796131 | 3300025645 | Aqueous | MARKKVIDLDTYNALDQWAISLHEMYKALRRAGFATDICMGII |
| Ga0208916_102552111 | 3300025896 | Aqueous | MAKKRVIDLDTYNALDSWAITLNEMYKALRRSGFAVD |
| Ga0208916_105535443 | 3300025896 | Aqueous | MARKKVIDLDTYTALDAWAISLQEMYRALRRAGFDVELSLAIIVEPMAY |
| Ga0209704_12394041 | 3300027693 | Freshwater Sediment | MARKKVIDLDTYTALDAWAISLQEMYRALRKSGFEVDLALAIIVEPSAYPDWILPKPDLIPHT |
| Ga0209033_10603901 | 3300027697 | Freshwater Lake | MAKKKVIDLDTYNALDQWAISLHEMYRALRRAGFGVDIALGII |
| Ga0209599_101010874 | 3300027710 | Deep Subsurface | MARKKVIDLDTYTALDAWAISLQEMYRALRRAGFEVDLALG |
| Ga0209085_11559001 | 3300027741 | Freshwater Lake | MAKKKVIDLDTYNALDSWAITLNEMYKALRRSGFAIDIALAIIVDRDAYPDWIL |
| Ga0209088_100111261 | 3300027763 | Freshwater Lake | MARKKVIDLDTYSALDAWAISLQEMYRALRRAGFDVDIALGIITEPSAYPDWILPKPD |
| Ga0209088_100441461 | 3300027763 | Freshwater Lake | MAKKKVIDLDTYSALDAYAISMNEFYKALRRAGFAVDLCLAII |
| Ga0209829_100521161 | 3300027777 | Freshwater Lake | MAKKKVIDLDTYNALDSWAITLNEMYKALRRSGFA |
| Ga0209246_101772892 | 3300027785 | Freshwater Lake | MAKKKVIDLDTYSALDAYAISMHEFYRALRRAGFAVDLCLGIITERSAYPDWLLP |
| Ga0209985_100594761 | 3300027806 | Freshwater Lake | MARKKVIDLDTYTALDAWAISLQEMYRALRRAGMDVDLALAIIIEPTA |
| Ga0209354_100130987 | 3300027808 | Freshwater Lake | MAKKRVIDLDTYSALDVWAISLQEMYRALRRAGFPV |
| Ga0209354_101741521 | 3300027808 | Freshwater Lake | MAKKRVIDLDTYSALDVWAISLQEMYRALRRAGFDV |
| Ga0209990_100118751 | 3300027816 | Freshwater Lake | MARKKVIDLDTYTALDAWAISLQEMYRALRRAGMDVDLALAIIIEPTAYPAWILPSPV |
| (restricted) Ga0247837_12400702 | 3300027970 | Freshwater | MARKKVIDLDTYSQLDQWAISLHEMYRALRRAGFAVDLCLA |
| (restricted) Ga0247835_11844462 | 3300028114 | Freshwater | MARKKVIDLDTYNALDAYAISMHEFYKSLRRAGFAVD |
| (restricted) Ga0247831_10442597 | 3300028559 | Freshwater | MARKKVIDLDTYSQLDQWAISLHEMYRALRRAGFAVDLCLAIISDRDAYPDWILPSI |
| (restricted) Ga0247842_105657704 | 3300029268 | Freshwater | MARKKVIDLDTYNALDAYAISMHEFYKSLRRAGFAVDLCLAIIT |
| Ga0315907_101870531 | 3300031758 | Freshwater | MARKKVIDLDTYNALDAYAISMHEFYKALRRAGFAVDLCLAIIT |
| Ga0315907_102839956 | 3300031758 | Freshwater | MARKKVIDLDTYSRLDAWAISLHEMYRALRRAGFAVDIALS |
| Ga0315907_103378065 | 3300031758 | Freshwater | MARKKVIDLDTYNALDQWAISLHEMYRALRRAGFAVDLCLSIIQDRDAYPDW |
| Ga0315908_107245261 | 3300031786 | Freshwater | MARKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDMALAI |
| Ga0315900_105540904 | 3300031787 | Freshwater | MAKKKVIDLDTYNALDQWAISLHEMYRALRRAGFAVDISLALISDKDAYPDWIL |
| Ga0315909_100287209 | 3300031857 | Freshwater | MARKKVIDLDTYSALDAYAISMHEFYRALRRAGFAV |
| Ga0315909_103590365 | 3300031857 | Freshwater | MARKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDMALAIIT |
| Ga0315909_104025941 | 3300031857 | Freshwater | MAKKKVIDLDTYNALDQWAISLHEMYRALRRAGFAVDISLALISDKDAYPDWILP |
| Ga0315909_104187041 | 3300031857 | Freshwater | MAKKKVIDLDTYNALDAYAISMHEFYKSLRRAGFAVDLCLAIIVERSAY |
| Ga0315909_109813292 | 3300031857 | Freshwater | MARKKVIDLDTYNALDTWAIGLQEMYRALRRAGFDVELSLAIIIEPGA |
| Ga0315904_108101091 | 3300031951 | Freshwater | MARKKVIDLDTYSQLDAWAIGLHEMYRALRRAGFAVDM |
| Ga0315906_103782681 | 3300032050 | Freshwater | MARKKVIDLDTYSQLDQYAICMHEFYKSLRRAGFA |
| Ga0315906_109784761 | 3300032050 | Freshwater | MARKKVIDLDTYTALDAWAISLQEMYRALRRAGMDVDLALAIIIEPTAYPAWILPSPVDPERFGD |
| Ga0315905_100198731 | 3300032092 | Freshwater | MARKKVIDLDTYNALDTWAIGLQEMYRALRRAGFDVELSLAII |
| Ga0315905_115698182 | 3300032092 | Freshwater | MARKKVIDLDTYNALDTWAIGLQEMYRALRRAGFDVELSLAIIIEPA |
| Ga0315902_102091847 | 3300032093 | Freshwater | MARKKVIDLDTYSQLDAWAIGLHEMYRALRRAGFAVDIALSIIQDRDAYPE |
| Ga0315902_104188451 | 3300032093 | Freshwater | MARKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVD |
| Ga0315902_105060661 | 3300032093 | Freshwater | MAKKKVIDLDTYNALDQWAISLHEMYRALRRAGFAVDL |
| Ga0315902_106443251 | 3300032093 | Freshwater | MARKKVIDLDTYSALDAYAISMHEFYRALRRAGFAVDLCLG |
| Ga0315902_110285881 | 3300032093 | Freshwater | MAKKKVIDLDTYNALDAYAISMHEFYKSLRRAGFAVDLCLAIITDR |
| Ga0315903_105092534 | 3300032116 | Freshwater | MARKKVIDLDTYTQLDAWAISLHEMYRALRRAGFAVDMCLAIITD |
| Ga0334982_0044575_3_170 | 3300033981 | Freshwater | MAKKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAIDICLAIISDRDAYPDWILPS |
| Ga0334994_0287757_2_172 | 3300033993 | Freshwater | MARKKVIDLDTYNALDAYSIALHEYYKSLRKAGFSIEIALALMSDRDTYPEWILPKL |
| Ga0334979_0423377_1_138 | 3300033996 | Freshwater | MARKKVIDLDTYSALDAWAISLQEMYRALRRAGFDVELSLAIIVEP |
| Ga0334986_0320398_659_814 | 3300034012 | Freshwater | MARKKVIDLDTYTALDAWAISLQEMYRALRRAGFEVDLALAVIVEPSAYPDW |
| Ga0334986_0412974_531_683 | 3300034012 | Freshwater | MAKKRVIDLDTYNALDAWAIALHEMYRALRRAGFAVDLCLAIISDRDAYPD |
| Ga0334995_0397900_3_140 | 3300034062 | Freshwater | MAKTRKKVIDLDTYSKLDAYSIAMHEFYKSLRRAGFAVDLSLAIIS |
| Ga0335019_0676450_1_162 | 3300034066 | Freshwater | MAKKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAIDICLAIISDRDAYPDWIL |
| Ga0335028_0387680_3_170 | 3300034071 | Freshwater | MARKKVIDLDTYSQLDQWAISLHEMYRALRRAGFAVDLCLAIISDRDAYPDWILPS |
| Ga0335010_0440655_1_108 | 3300034092 | Freshwater | MAKKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAI |
| Ga0335027_0453521_3_161 | 3300034101 | Freshwater | MARKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDLCLAIITDRDSYPDWI |
| Ga0335027_0884532_2_148 | 3300034101 | Freshwater | MAKKKVIDLDTYNALDAYAICMHEFYKSLRRAGFAVDLCLAIIVERSAY |
| Ga0335031_0396766_3_209 | 3300034104 | Freshwater | MARKKVIDLDTYSALDAWAISLQEMYRALRRAGFDVDLALAIIVEPSAYPAWILPTPIDPERFGDYDDE |
| Ga0335031_0408478_1_132 | 3300034104 | Freshwater | MAKKKVIDLDTYNALDQWAISLHEMYRALRRAGFAVDISLALIS |
| Ga0335066_0531967_500_616 | 3300034112 | Freshwater | MAKKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAIDIC |
| Ga0335058_0733593_3_107 | 3300034121 | Freshwater | MAKKKVIDLDTYNALDAWAISLHEMYSSLRRAGFG |
| Ga0335060_0007353_1_150 | 3300034122 | Freshwater | MARKKVIDLDTYSALDAWAIGLQEMYRALRRAGFDVELSLAIIVEPNSYP |
| Ga0335061_0000778_1_117 | 3300034168 | Freshwater | MAKKKVIDLDTYSALDAWAIGLQEMYRALRKAGFDVELS |
| Ga0335061_0445966_2_133 | 3300034168 | Freshwater | MARKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDLCLAIIT |
| Ga0334997_0344226_834_953 | 3300034280 | Freshwater | MARKKVIDLDTYNALDQWAISLHEMYRALRRAGFAVDLCL |
| Ga0335013_0658543_1_126 | 3300034284 | Freshwater | MARKKVIDLDTYSQLDAWAISLHEMYRALRRAGFAVDLCLAI |
| ⦗Top⦘ |