Basic Information | |
---|---|
Family ID | F048838 |
Family Type | Metagenome |
Number of Sequences | 147 |
Average Sequence Length | 43 residues |
Representative Sequence | MNVIIDNLNLSPKQVNALRAAIKARYTPEKVKALNARLKATEGK |
Number of Associated Samples | 93 |
Number of Associated Scaffolds | 147 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 82.31 % |
% of genes near scaffold ends (potentially truncated) | 21.77 % |
% of genes from short scaffolds (< 2000 bps) | 76.19 % |
Associated GOLD sequencing projects | 80 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.38 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (45.578 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine (19.728 % of family members) |
Environment Ontology (ENVO) | Unclassified (70.748 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (80.272 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.67% β-sheet: 0.00% Coil/Unstructured: 58.33% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 147 Family Scaffolds |
---|---|---|
PF12705 | PDDEXK_1 | 1.36 |
PF04404 | ERF | 0.68 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 54.42 % |
Unclassified | root | N/A | 45.58 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2236876004|none_p0354277 | Not Available | 530 | Open in IMG/M |
2236876005|none_p104579 | All Organisms → Viruses → environmental samples → uncultured marine virus | 529 | Open in IMG/M |
3300000101|DelMOSum2010_c10054236 | All Organisms → Viruses → Predicted Viral | 1978 | Open in IMG/M |
3300000101|DelMOSum2010_c10065530 | All Organisms → Viruses | 1711 | Open in IMG/M |
3300000101|DelMOSum2010_c10069891 | Not Available | 1623 | Open in IMG/M |
3300000101|DelMOSum2010_c10098156 | Not Available | 1226 | Open in IMG/M |
3300000101|DelMOSum2010_c10099689 | All Organisms → Viruses → Predicted Viral | 1211 | Open in IMG/M |
3300000101|DelMOSum2010_c10114267 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1081 | Open in IMG/M |
3300000101|DelMOSum2010_c10135766 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 933 | Open in IMG/M |
3300000101|DelMOSum2010_c10285725 | Not Available | 500 | Open in IMG/M |
3300000116|DelMOSpr2010_c10034612 | All Organisms → Viruses → Predicted Viral | 2331 | Open in IMG/M |
3300000117|DelMOWin2010_c10167464 | Not Available | 707 | Open in IMG/M |
3300000117|DelMOWin2010_c10249727 | Not Available | 519 | Open in IMG/M |
3300001347|JGI20156J14371_10079362 | Not Available | 1162 | Open in IMG/M |
3300001347|JGI20156J14371_10081743 | All Organisms → Viruses → Predicted Viral | 1129 | Open in IMG/M |
3300001348|JGI20154J14316_10141155 | Not Available | 669 | Open in IMG/M |
3300001352|JGI20157J14317_10079454 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanosphaera → unclassified Methanosphaera → Methanosphaera sp. | 1288 | Open in IMG/M |
3300001353|JGI20159J14440_10192731 | Not Available | 565 | Open in IMG/M |
3300003580|JGI26260J51721_1068197 | Not Available | 523 | Open in IMG/M |
3300004457|Ga0066224_1056959 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1427 | Open in IMG/M |
3300004461|Ga0066223_1067001 | Not Available | 593 | Open in IMG/M |
3300004461|Ga0066223_1154685 | All Organisms → Viruses → Predicted Viral | 1549 | Open in IMG/M |
3300005747|Ga0076924_1313307 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
3300006029|Ga0075466_1010300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 3205 | Open in IMG/M |
3300006029|Ga0075466_1014781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 2607 | Open in IMG/M |
3300006029|Ga0075466_1048083 | All Organisms → Viruses → Predicted Viral | 1267 | Open in IMG/M |
3300006803|Ga0075467_10201645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1106 | Open in IMG/M |
3300006803|Ga0075467_10395693 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 720 | Open in IMG/M |
3300006920|Ga0070748_1042437 | Not Available | 1828 | Open in IMG/M |
3300006920|Ga0070748_1363161 | Not Available | 509 | Open in IMG/M |
3300007539|Ga0099849_1141148 | All Organisms → Viruses → environmental samples → uncultured marine virus | 937 | Open in IMG/M |
3300007540|Ga0099847_1070490 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1083 | Open in IMG/M |
3300007540|Ga0099847_1153966 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 683 | Open in IMG/M |
3300007540|Ga0099847_1196164 | Not Available | 590 | Open in IMG/M |
3300009003|Ga0102813_1099375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 930 | Open in IMG/M |
3300009003|Ga0102813_1169558 | Not Available | 678 | Open in IMG/M |
3300009054|Ga0102826_1171351 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300009056|Ga0102860_1246614 | Not Available | 517 | Open in IMG/M |
3300009071|Ga0115566_10325587 | Not Available | 901 | Open in IMG/M |
3300009074|Ga0115549_1127250 | Not Available | 838 | Open in IMG/M |
3300009076|Ga0115550_1030683 | All Organisms → Viruses → Predicted Viral | 2401 | Open in IMG/M |
3300009076|Ga0115550_1222204 | Not Available | 628 | Open in IMG/M |
3300009079|Ga0102814_10030548 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 3060 | Open in IMG/M |
3300009079|Ga0102814_10059401 | All Organisms → Viruses → Predicted Viral | 2112 | Open in IMG/M |
3300009079|Ga0102814_10325483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 836 | Open in IMG/M |
3300009086|Ga0102812_10331349 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 828 | Open in IMG/M |
3300009130|Ga0118729_1034508 | All Organisms → Viruses → Predicted Viral | 3113 | Open in IMG/M |
3300009130|Ga0118729_1122186 | All Organisms → Viruses → Predicted Viral | 1222 | Open in IMG/M |
3300009423|Ga0115548_1134081 | Not Available | 788 | Open in IMG/M |
3300009426|Ga0115547_1183457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 662 | Open in IMG/M |
3300009435|Ga0115546_1066821 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanosphaera → unclassified Methanosphaera → Methanosphaera sp. | 1352 | Open in IMG/M |
3300009440|Ga0115561_1261585 | Not Available | 644 | Open in IMG/M |
3300009443|Ga0115557_1275354 | Not Available | 638 | Open in IMG/M |
3300009443|Ga0115557_1368397 | Not Available | 533 | Open in IMG/M |
3300009447|Ga0115560_1351788 | Not Available | 558 | Open in IMG/M |
3300009449|Ga0115558_1422453 | Not Available | 518 | Open in IMG/M |
3300009449|Ga0115558_1428739 | Not Available | 513 | Open in IMG/M |
3300009496|Ga0115570_10153830 | Not Available | 1072 | Open in IMG/M |
3300009507|Ga0115572_10084235 | All Organisms → Viruses → Predicted Viral | 1932 | Open in IMG/M |
3300009507|Ga0115572_10310727 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanosphaera → unclassified Methanosphaera → Methanosphaera sp. | 892 | Open in IMG/M |
3300009507|Ga0115572_10716283 | Not Available | 544 | Open in IMG/M |
3300009508|Ga0115567_10064938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 2679 | Open in IMG/M |
3300010368|Ga0129324_10202268 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 806 | Open in IMG/M |
3300011118|Ga0114922_10735921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 808 | Open in IMG/M |
3300011258|Ga0151677_1050955 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1164 | Open in IMG/M |
3300017697|Ga0180120_10259405 | Not Available | 704 | Open in IMG/M |
3300017719|Ga0181390_1016375 | All Organisms → Viruses → environmental samples → uncultured marine virus | 2490 | Open in IMG/M |
3300017719|Ga0181390_1072760 | Not Available | 963 | Open in IMG/M |
3300017786|Ga0181424_10026168 | All Organisms → Viruses → Predicted Viral | 2530 | Open in IMG/M |
3300017786|Ga0181424_10361028 | Not Available | 596 | Open in IMG/M |
3300018416|Ga0181553_10685149 | Not Available | 537 | Open in IMG/M |
3300018417|Ga0181558_10046141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 2975 | Open in IMG/M |
3300020165|Ga0206125_10015333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 4936 | Open in IMG/M |
3300020185|Ga0206131_10077644 | Not Available | 2023 | Open in IMG/M |
3300020187|Ga0206130_10063170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 2477 | Open in IMG/M |
3300020187|Ga0206130_10182840 | Not Available | 1036 | Open in IMG/M |
3300020385|Ga0211677_10036752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 2319 | Open in IMG/M |
3300020385|Ga0211677_10206998 | Not Available | 811 | Open in IMG/M |
3300021389|Ga0213868_10130090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1584 | Open in IMG/M |
3300021957|Ga0222717_10000487 | All Organisms → cellular organisms → Bacteria | 34240 | Open in IMG/M |
3300021957|Ga0222717_10020171 | All Organisms → Viruses → environmental samples → uncultured marine virus | 4481 | Open in IMG/M |
3300021957|Ga0222717_10092587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1896 | Open in IMG/M |
3300021957|Ga0222717_10159380 | Not Available | 1367 | Open in IMG/M |
3300021957|Ga0222717_10273430 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
3300021957|Ga0222717_10312105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 894 | Open in IMG/M |
3300021960|Ga0222715_10314447 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
3300022061|Ga0212023_1019112 | Not Available | 924 | Open in IMG/M |
3300022072|Ga0196889_1064671 | Not Available | 695 | Open in IMG/M |
3300022306|Ga0224509_10084532 | All Organisms → Viruses → Predicted Viral | 1094 | Open in IMG/M |
(restricted) 3300022913|Ga0233404_10049397 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 964 | Open in IMG/M |
(restricted) 3300022913|Ga0233404_10058809 | All Organisms → Viruses → environmental samples → uncultured marine virus | 886 | Open in IMG/M |
3300022925|Ga0255773_10053495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 2384 | Open in IMG/M |
(restricted) 3300022938|Ga0233409_10284198 | Not Available | 573 | Open in IMG/M |
(restricted) 3300023112|Ga0233411_10008956 | Not Available | 2862 | Open in IMG/M |
(restricted) 3300023112|Ga0233411_10020113 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1977 | Open in IMG/M |
(restricted) 3300023112|Ga0233411_10058898 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
(restricted) 3300023112|Ga0233411_10076890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1056 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10018889 | All Organisms → Viruses → environmental samples → uncultured marine virus | 2734 | Open in IMG/M |
(restricted) 3300023210|Ga0233412_10071357 | Not Available | 1433 | Open in IMG/M |
(restricted) 3300023271|Ga0233403_10084805 | Not Available | 948 | Open in IMG/M |
(restricted) 3300023271|Ga0233403_10164979 | Not Available | 650 | Open in IMG/M |
(restricted) 3300023276|Ga0233410_10098097 | All Organisms → Viruses → environmental samples → uncultured marine virus | 906 | Open in IMG/M |
(restricted) 3300024062|Ga0255039_10084817 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
(restricted) 3300024062|Ga0255039_10138000 | Not Available | 995 | Open in IMG/M |
(restricted) 3300024062|Ga0255039_10316661 | Not Available | 667 | Open in IMG/M |
3300024180|Ga0228668_1010598 | All Organisms → Viruses → Predicted Viral | 2269 | Open in IMG/M |
3300024191|Ga0228636_1006409 | All Organisms → Viruses → environmental samples → uncultured marine virus | 2892 | Open in IMG/M |
3300024321|Ga0228626_1007975 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 3222 | Open in IMG/M |
3300024328|Ga0228635_1013303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 2814 | Open in IMG/M |
3300024329|Ga0228631_1056293 | All Organisms → Viruses → environmental samples → uncultured marine virus | 1040 | Open in IMG/M |
3300024329|Ga0228631_1074954 | Not Available | 850 | Open in IMG/M |
3300024334|Ga0228671_1013336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 2483 | Open in IMG/M |
3300024346|Ga0244775_10071616 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2970 | Open in IMG/M |
(restricted) 3300024518|Ga0255048_10206952 | Not Available | 957 | Open in IMG/M |
(restricted) 3300024520|Ga0255047_10134168 | Not Available | 1268 | Open in IMG/M |
(restricted) 3300024520|Ga0255047_10296099 | Not Available | 819 | Open in IMG/M |
(restricted) 3300024529|Ga0255044_10330081 | Not Available | 628 | Open in IMG/M |
3300025543|Ga0208303_1000752 | Not Available | 13304 | Open in IMG/M |
3300025543|Ga0208303_1053492 | Not Available | 971 | Open in IMG/M |
3300025577|Ga0209304_1055406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1024 | Open in IMG/M |
3300025577|Ga0209304_1055930 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanosphaera → unclassified Methanosphaera → Methanosphaera sp. | 1017 | Open in IMG/M |
3300025594|Ga0209094_1049257 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanosphaera → unclassified Methanosphaera → Methanosphaera sp. | 1102 | Open in IMG/M |
3300025621|Ga0209504_1024080 | Not Available | 2243 | Open in IMG/M |
3300025621|Ga0209504_1024849 | Not Available | 2188 | Open in IMG/M |
3300025637|Ga0209197_1189670 | Not Available | 523 | Open in IMG/M |
3300025641|Ga0209833_1018049 | Not Available | 2887 | Open in IMG/M |
3300025641|Ga0209833_1118787 | Not Available | 736 | Open in IMG/M |
3300025641|Ga0209833_1152266 | Not Available | 605 | Open in IMG/M |
3300025704|Ga0209602_1150659 | Not Available | 747 | Open in IMG/M |
3300025876|Ga0209223_10112056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1470 | Open in IMG/M |
3300025880|Ga0209534_10486310 | Not Available | 511 | Open in IMG/M |
3300025881|Ga0209309_10069214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 2022 | Open in IMG/M |
3300026479|Ga0228622_1030789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1391 | Open in IMG/M |
3300026483|Ga0228620_1026774 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
3300027751|Ga0208304_10154647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 842 | Open in IMG/M |
3300027757|Ga0208671_10160969 | Not Available | 813 | Open in IMG/M |
(restricted) 3300027861|Ga0233415_10000741 | Not Available | 14933 | Open in IMG/M |
(restricted) 3300027861|Ga0233415_10058920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1622 | Open in IMG/M |
(restricted) 3300027861|Ga0233415_10214131 | Not Available | 892 | Open in IMG/M |
(restricted) 3300027861|Ga0233415_10342823 | Not Available | 710 | Open in IMG/M |
(restricted) 3300027996|Ga0233413_10015840 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2803 | Open in IMG/M |
(restricted) 3300027996|Ga0233413_10245085 | Not Available | 762 | Open in IMG/M |
(restricted) 3300027996|Ga0233413_10255147 | Not Available | 747 | Open in IMG/M |
3300028008|Ga0228674_1033730 | All Organisms → Viruses → environmental samples → uncultured marine virus | 2037 | Open in IMG/M |
3300028396|Ga0228643_1132797 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 568 | Open in IMG/M |
3300031519|Ga0307488_10203717 | All Organisms → Viruses → Predicted Viral | 1338 | Open in IMG/M |
3300032277|Ga0316202_10023732 | Not Available | 2989 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 19.73% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 14.97% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.20% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 8.16% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 7.48% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 6.80% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.44% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.76% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 4.76% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 2.72% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 2.04% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 2.04% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.04% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.36% |
Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine | 1.36% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.36% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.68% |
Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.68% |
Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.68% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.68% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.68% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.68% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.68% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2236876004 | Estuarine microbial communities from Columbia River, sample from South Channel ETM site, GS313-0p1-ETM-15m | Environmental | Open in IMG/M |
2236876005 | Estuarine microbial communities from Columbia River, sample from South Channel ETM site, GS313-3LG-ETM-15m | Environmental | Open in IMG/M |
3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
3300001347 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 | Environmental | Open in IMG/M |
3300001348 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 | Environmental | Open in IMG/M |
3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
3300001353 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 | Environmental | Open in IMG/M |
3300003580 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA | Environmental | Open in IMG/M |
3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
3300005747 | Seawater microbial communities from Vineyard Sound, MA, USA - control T14 | Environmental | Open in IMG/M |
3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
3300009003 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 | Environmental | Open in IMG/M |
3300009054 | Estuarine microbial communities from the Columbia River estuary - metaG S.737 | Environmental | Open in IMG/M |
3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
3300009130 | Combined Assembly of Gp0139511, Gp0139512 | Environmental | Open in IMG/M |
3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
3300009440 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 | Environmental | Open in IMG/M |
3300009443 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 | Environmental | Open in IMG/M |
3300009447 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 | Environmental | Open in IMG/M |
3300009449 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 | Environmental | Open in IMG/M |
3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
3300022306 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_24 | Environmental | Open in IMG/M |
3300022913 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_2_MG | Environmental | Open in IMG/M |
3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
3300022938 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_13_MG | Environmental | Open in IMG/M |
3300023112 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MG | Environmental | Open in IMG/M |
3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
3300023271 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_1_MG | Environmental | Open in IMG/M |
3300023276 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MG | Environmental | Open in IMG/M |
3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
3300024180 | Seawater microbial communities from Monterey Bay, California, United States - 82D | Environmental | Open in IMG/M |
3300024191 | Seawater microbial communities from Monterey Bay, California, United States - 45D | Environmental | Open in IMG/M |
3300024321 | Seawater microbial communities from Monterey Bay, California, United States - 31D | Environmental | Open in IMG/M |
3300024328 | Seawater microbial communities from Monterey Bay, California, United States - 44D | Environmental | Open in IMG/M |
3300024329 | Seawater microbial communities from Monterey Bay, California, United States - 39D | Environmental | Open in IMG/M |
3300024334 | Seawater microbial communities from Monterey Bay, California, United States - 89D | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
3300024529 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21 | Environmental | Open in IMG/M |
3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025577 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 (SPAdes) | Environmental | Open in IMG/M |
3300025594 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 (SPAdes) | Environmental | Open in IMG/M |
3300025621 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes) | Environmental | Open in IMG/M |
3300025637 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 (SPAdes) | Environmental | Open in IMG/M |
3300025641 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 (SPAdes) | Environmental | Open in IMG/M |
3300025704 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes) | Environmental | Open in IMG/M |
3300025876 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes) | Environmental | Open in IMG/M |
3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
3300025881 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes) | Environmental | Open in IMG/M |
3300026479 | Seawater microbial communities from Monterey Bay, California, United States - 26D | Environmental | Open in IMG/M |
3300026483 | Seawater microbial communities from Monterey Bay, California, United States - 23D | Environmental | Open in IMG/M |
3300027751 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes) | Environmental | Open in IMG/M |
3300027757 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes) | Environmental | Open in IMG/M |
3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
3300028008 | Seawater microbial communities from Monterey Bay, California, United States - 1D_r | Environmental | Open in IMG/M |
3300028396 | Seawater microbial communities from Monterey Bay, California, United States - 55D | Environmental | Open in IMG/M |
3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
none_03542772 | 2236876004 | Marine Estuarine | MNVYIDNLKLTDQQVIAIRAAIKARYTPARVRALNAKLKATEGK |
none_1045791 | 2236876005 | Marine Estuarine | MTVYIDNLHLTAKQLRELRAAIKARYTPERVKALNARLKAAEGK |
DelMOSum2010_100542363 | 3300000101 | Marine | MTVYIDNLNLTAKQLRELRAAIKASYTPEKVKALNAKIKAAXGK* |
DelMOSum2010_100655301 | 3300000101 | Marine | MTVYIDNLHLTAKQLRELRAAIKERYTPEKVKALNGRIKAAEGK* |
DelMOSum2010_100698914 | 3300000101 | Marine | MHISQLKVNMNVYIDNLNLTAKQVEALRVAIKARYTPEKVKALNARIKAAEGK* |
DelMOSum2010_100981565 | 3300000101 | Marine | MNVYIDNLNLTAKQVEALRAAIKERYTPEKVKALNARIKATKGK* |
DelMOSum2010_100996893 | 3300000101 | Marine | MTVYIDNLNLTAKQXRELRAAIKERYTPEKVKALNARIKAAEGK* |
DelMOSum2010_101142671 | 3300000101 | Marine | MTVYIDNLNLTAKQVRELRAAIKERYTPEKVKALN |
DelMOSum2010_101357661 | 3300000101 | Marine | MNVYIDNLNLTAKQVEALRVAIKARYTPARVKALNARIRAVKGK* |
DelMOSum2010_102857251 | 3300000101 | Marine | MTVYIDNLNLTAKQVRELRAAIKARYTPARVKALNARIKAAEGK* |
DelMOSpr2010_100346122 | 3300000116 | Marine | MTVYIDNLNLTAKQLCELRAAIKERYTSEKVKALNARIKAAEGK* |
DelMOWin2010_101674643 | 3300000117 | Marine | LGEDSMTVYIENLKLTAKQVEALRVAIKARYTPARVRALNAKIRAVEGK* |
DelMOWin2010_102497271 | 3300000117 | Marine | MTVYIENLKLTAKQVEALRVAIKTRYTPARVKVLNAKIRAAEGK* |
JGI20156J14371_100793624 | 3300001347 | Pelagic Marine | MKVIIEGLNLSNKQLIELRAAIKARYTPEKVKALNARLKATEGK* |
JGI20156J14371_100817433 | 3300001347 | Pelagic Marine | MNVIIEGLNLSNKQLIALRAAIKARYTPEKVKALNARLKATEGK* |
JGI20154J14316_101411552 | 3300001348 | Pelagic Marine | MNVHIDNLNLTAKQVEALRVSIKARYTPARVKALNAKIRAAKGK* |
JGI20157J14317_100794541 | 3300001352 | Pelagic Marine | MNVLIEGLNLSNGQLIKLRAAIKARYTPEKVKALNARLKATEGK* |
JGI20159J14440_101927311 | 3300001353 | Pelagic Marine | MNVIIEGLNLSNKQLIELRAAIKARYTPEKVKALNAR |
JGI26260J51721_10681972 | 3300003580 | Marine | MNVIIDNLNLSPKQVNALRAAMKARYTPERVRALNARLKTAEGK* |
Ga0066224_10569591 | 3300004457 | Marine | MTVYIDNLNLTAKQLRELRAAIKERYTPEKVKSLNARIKAAEGK* |
Ga0066223_10670011 | 3300004461 | Marine | MNVYINNLNLTAKQVEALRVAIKARYTPARVKALNAKIRAAKGK* |
Ga0066223_11546854 | 3300004461 | Marine | MTVYIDNLNLTAKQLRERRAAIKERYTPEKVKSLNARIKAAEGK* |
Ga0076924_13133072 | 3300005747 | Marine | MNVYINDLNLTAKQVEALRVAIKERYTPEKVKSLNARIKA |
Ga0075466_10103004 | 3300006029 | Aqueous | MNVIIEGLNLSNRQVNTLRAAIKARYTPEKVKALNARLKATEGK* |
Ga0075466_10147813 | 3300006029 | Aqueous | MNVIIEGLNLSSRQLIELRAAIKARYTPEKVKALNARLKATEGK* |
Ga0075466_10480832 | 3300006029 | Aqueous | MTVYIDGLSLTPKQIDALRVAIKTRYTPARVKVLNAKIRAAEGK* |
Ga0075467_102016452 | 3300006803 | Aqueous | MTVYIDGLSLTPKQIDALRIAIKTRYTPARVKAFNAKIRAAEGK* |
Ga0075467_103956932 | 3300006803 | Aqueous | MTVYIENLKLTAKQVEALRVAIKARYTPARVRALNAKIRAVEGK* |
Ga0070748_10424374 | 3300006920 | Aqueous | MNVIIEGLNLSNRQLIELRAAIKARYTPEKVKALNARLKATEGK* |
Ga0070748_13631611 | 3300006920 | Aqueous | MTVYIENLNLTAKQIDALRVNIKARYTPEKVKALNAKIRAAEGK* |
Ga0099849_11411482 | 3300007539 | Aqueous | MTVYINNLNLTAKQVEALRVAIKARYTPEKVKALNARIKATKGK* |
Ga0099847_10704901 | 3300007540 | Aqueous | MTVYIDNLNLTAKQLRELRAAIKERYTPEKVKALNARIKANKGK* |
Ga0099847_11539661 | 3300007540 | Aqueous | MTVYIENLKLTAKQVEALRVAIKARYTPARVRALNAKIRAV |
Ga0099847_11961642 | 3300007540 | Aqueous | MTVYIDNLNLTAKQLRELRAAIKERYTPERVKALNARIKAAEGK* |
Ga0102813_10993752 | 3300009003 | Estuarine | MNVIIDNINLSPKQVKAVRAAIKARYTPERVKALNARLKAAEGK* |
Ga0102813_11695581 | 3300009003 | Estuarine | NLSPKQVNALRAAIKARYTPEKVKALNARLKAAEGK* |
Ga0102826_11713511 | 3300009054 | Estuarine | MNVIIEGLNLSPKQVNALRAAIKARYTPEKVKTLNARLKATEGK* |
Ga0102860_12466141 | 3300009056 | Estuarine | MNVTIDNLHLTAKQLRELRAAIKARYTPEKVKALNARLKATEGK* |
Ga0115566_103255872 | 3300009071 | Pelagic Marine | MNVIIEGLNLSNRQLIKLRAAIKARYTPEKVKALNARLKATEGK* |
Ga0115549_11272501 | 3300009074 | Pelagic Marine | MNVIIEGLNLSNKQLIELRAAIKARYTPEKVKALNARLKATEGK* |
Ga0115550_10306836 | 3300009076 | Pelagic Marine | MTVYIDNLNLTAKQVEALRVAIKARYTPARVRALNARIKATKGK* |
Ga0115550_12222042 | 3300009076 | Pelagic Marine | MNVIIEGLNLSNKQLIDLRAAIKARYTPEKVKALNARLKATEGK* |
Ga0102814_100305486 | 3300009079 | Estuarine | MTVYIDNLNLTAKQLRELRAAIKARYTPEKVKALNARLKATEGK* |
Ga0102814_100594015 | 3300009079 | Estuarine | MNVIIDNLNLSPKQVNALRAAIKARYTPEKVKALNARLKATEGK* |
Ga0102814_103254831 | 3300009079 | Estuarine | MNVTIDNLNLSPKQVNALRAAIKARYTPERVKALNARLKAAEGK* |
Ga0102812_103313491 | 3300009086 | Estuarine | MNVIIDNLNLTAKQLRELRAAIKARYTPEKVKALNARLKAAE |
Ga0118729_10345083 | 3300009130 | Marine | MNVYIDNLNLTPKQINALRVAIKARYTPARVKVLNTKIRAAEGK* |
Ga0118729_11221863 | 3300009130 | Marine | MNVYIDNINLTPKQIDALRVAIKARYTPARVKALNAKIRAAEGK* |
Ga0115548_11340812 | 3300009423 | Pelagic Marine | MNVIIEGLNLSNGQLIELRAAIKARYTPEKVKALNARLKATEGK* |
Ga0115547_11834572 | 3300009426 | Pelagic Marine | MNVIIEGLNLSNKQLIELRAAIKARYTPEKVKALNARL |
Ga0115546_10668212 | 3300009435 | Pelagic Marine | MNVIIEGLNLSNKQLIELRAAIKARYTPEKVKALNARLK |
Ga0115561_12615851 | 3300009440 | Pelagic Marine | MNVIIEGLNLSNRQLIELRAAIKARYTPEKVKALNAR |
Ga0115557_12753542 | 3300009443 | Pelagic Marine | MNVIIEGLNLSNKQLIKLRAAIKARYTPEKVKALNARLKATEGK* |
Ga0115557_13683972 | 3300009443 | Pelagic Marine | MNVIIEGLNLSNKQLIKLRAAIKARYTPEKVKALN |
Ga0115560_13517882 | 3300009447 | Pelagic Marine | MNVIIEGLNLSNKQLIALRAAIKARYTPEKVRTLNAR |
Ga0115558_14224531 | 3300009449 | Pelagic Marine | IIEGLNLSNKQLIALRAAIKARYTPEKVKALNARLKATEGK* |
Ga0115558_14287392 | 3300009449 | Pelagic Marine | MNVIIEGLNLSNKQLIALRAAIKARYTPEKVKALNARLKATE |
Ga0115570_101538301 | 3300009496 | Pelagic Marine | MNVIIEGLNLSNRQLIELRAAIRARYTPEKVKALNARLKATEGK* |
Ga0115572_100842352 | 3300009507 | Pelagic Marine | MNVLIEGLNLSNKQLIDLRAAIKARYTPEKVKALNARLKATEGK* |
Ga0115572_103107271 | 3300009507 | Pelagic Marine | MNVIIEGLNLSNRQLIKLRAAIKARYTPEKVKALNARLK |
Ga0115572_107162831 | 3300009507 | Pelagic Marine | ITINKGKNMNVIIEGLNLSNKQLIDLRAAIKARYTPEKVKALNARLKATEGK* |
Ga0115567_100649384 | 3300009508 | Pelagic Marine | MNVIIEGLNLSNKQLIELRAAIRARYTPEKVKALNARLKATEGK* |
Ga0129324_102022681 | 3300010368 | Freshwater To Marine Saline Gradient | MTVYIENLKLTAKQVEALRVAIKTRYTPARVKVLNAKIRA |
Ga0114922_107359212 | 3300011118 | Deep Subsurface | MTVYIDNLNLTAKQLRELRVAIKERYTPEKVKALNARIKANKGK* |
Ga0151677_10509552 | 3300011258 | Marine | MTVYIDNLNLTAKQVRELRAAIKARYTPEKVKALNARIKAAEGK* |
Ga0180120_102594052 | 3300017697 | Freshwater To Marine Saline Gradient | MTVYIENLNLTAKQIDALRVNIKARYTPEKVKALNAKIRAAEGK |
Ga0181390_10163753 | 3300017719 | Seawater | MNVYIDNLNLTAKQVRELRAAIKARYTPERVKTLNARLKAAEGK |
Ga0181390_10727602 | 3300017719 | Seawater | MNVIIDNLNLTAKQLRELRAAIKARYTPEKVKALNAKIRAAEGK |
Ga0181424_100261688 | 3300017786 | Seawater | MNVYIDNLKLTPEQVNTIRAAIKARCTPAKVEALNVRIKATEGK |
Ga0181424_103610281 | 3300017786 | Seawater | MTVCIDNLNLTAKQVEALRVAIKERYTPERVKALNARIKATKGK |
Ga0181553_106851491 | 3300018416 | Salt Marsh | KGKKMNVIIEGLNLSNRQVNTLRAAIKARYTPEKVKALNARLKATEGK |
Ga0181558_100461414 | 3300018417 | Salt Marsh | MNVIIEGLNLSNRQVNTLRAAIKARYTPEKVKALNARLKATGGK |
Ga0206125_100153334 | 3300020165 | Seawater | MNVIIEGLNLSNKQLIDLRAAIKARYTPEKVKALNARLKATEGK |
Ga0206131_100776443 | 3300020185 | Seawater | MNVIIEGLNLSNGQLIKLRAAIKARYTPEKVKALNARLKATEGK |
Ga0206130_100631703 | 3300020187 | Seawater | MNVIIEGLNLSNRQLIELRAAIKARYTPEKVKALNARLKATEGK |
Ga0206130_101828402 | 3300020187 | Seawater | MNVIIEGLNLSNRQLIKLRAAIKARYTPEKVKALNARLKATEGK |
Ga0211677_100367522 | 3300020385 | Marine | MNVYINNLKLSPKQVNAIRAAIKARYTPARVKALNAKLKATEGR |
Ga0211677_102069981 | 3300020385 | Marine | MNVYIDNLKLTDKQVIAIRAAIKARYTPTRVKALNAKLKATEGK |
Ga0213868_101300902 | 3300021389 | Seawater | MNAIIEGLNLSPRQLIELRAAIKARYTPEKVKALNARLKATEGK |
Ga0222717_1000048733 | 3300021957 | Estuarine Water | MNVIIEGLNLSNKQLIALRAAIKARYTPEKVKALNARLKATEGK |
Ga0222717_100201713 | 3300021957 | Estuarine Water | MNVYIDNLNLTAKQVRELRAAIKARYTPEKVKALNARIKATKGK |
Ga0222717_100925872 | 3300021957 | Estuarine Water | MNVIIDNINLSPKQVKAVRAAIKARYTPERVKALNARLKAAEGK |
Ga0222717_101593802 | 3300021957 | Estuarine Water | MNVIIEGLNLSPKQVNALRAAIKARYTPEKVRALNARLKATEGK |
Ga0222717_102734301 | 3300021957 | Estuarine Water | MNVTIDNLNLSPKQVNALRAAIKARYTPERVKALNARLKAAEGK |
Ga0222717_103121052 | 3300021957 | Estuarine Water | MNVIIEGLNLSPKQVNALRAAIKARYTPEKVKALNARLKAAEGK |
Ga0222715_103144471 | 3300021960 | Estuarine Water | MNVIIEGLNLSPKQVNALRAAIKARYTPEKVKALNARLKATE |
Ga0212023_10191122 | 3300022061 | Aqueous | MTVYIENLKLTAKQVEALRVAIKARYTPARVRALNAKIRAVEGK |
Ga0196889_10646711 | 3300022072 | Aqueous | MNVIIEGLNLSSRQLIELRAAIKARYTPEKVKALNARLKATEGK |
Ga0224509_100845322 | 3300022306 | Sediment | MNVYIDNLKLTPEQVNTIRAAIKARCTPAKVEALNARIKATEGK |
(restricted) Ga0233404_100493973 | 3300022913 | Seawater | MNVIIDNLNLSPKQVNALRAAMKARYTPERVKALNTRLKAAEGK |
(restricted) Ga0233404_100588092 | 3300022913 | Seawater | MNVIIEGLNLSTKQVNALRAAIKARYTPEKVKALNARLKATEGK |
Ga0255773_100534952 | 3300022925 | Salt Marsh | MNVIIEGLNLSNRQVNTLRAAIKARYTPEKVKALNARLKATEGK |
(restricted) Ga0233409_102841981 | 3300022938 | Seawater | MNVIIKGLNLSPRQVNALRAAIKARYTPERVKALNARLKAAEGK |
(restricted) Ga0233411_100089563 | 3300023112 | Seawater | MNVIIDNLNLSPKQVHELRAAIKARYTPERVKALNARLKAAEGK |
(restricted) Ga0233411_100201133 | 3300023112 | Seawater | MTVYIDNLHLTAKQLRELRAAIKARYTPERVKALNARLKALEGK |
(restricted) Ga0233411_100588982 | 3300023112 | Seawater | MNVIIEGLNLSTKQVNELRAAIKARYTPEKVKALNARLKAAEGK |
(restricted) Ga0233411_100768902 | 3300023112 | Seawater | MNVIIKGLNLSPKQVNALRAAMKARYTPERVKALNARLKAAEGK |
(restricted) Ga0233412_100188894 | 3300023210 | Seawater | MTVYIDNLHLTAKQLRELRAAIKARYTPEKVKALNARLKAAEGK |
(restricted) Ga0233412_100713572 | 3300023210 | Seawater | MNVIIEGLNLSPKQVNALRAAIKARYTPERVKALNARLKITEGK |
(restricted) Ga0233403_100848052 | 3300023271 | Seawater | MNVIIEGLNLSPKQVNELRAAIKARYTPEQVKALSARLKAA |
(restricted) Ga0233403_101649792 | 3300023271 | Seawater | MNVIIEGLNLSPKQVNALRAAIKARYTPERVKALNARLKAAEGK |
(restricted) Ga0233410_100980972 | 3300023276 | Seawater | MNVIIEGLNLSPNQVNALRAAIKARYTPERVKALNARLKAAEGK |
(restricted) Ga0255039_100848172 | 3300024062 | Seawater | MNVIIEGLNLSPKQVNELRAAIKARYTPEKVKALNARLKATEGK |
(restricted) Ga0255039_101380002 | 3300024062 | Seawater | MNVIIDNLNLSPKQVNALRAAMKARYTPEKVKALNARLKAAEGK |
(restricted) Ga0255039_103166612 | 3300024062 | Seawater | MNVTIDNLHLTAKQLNALRAAIKARYTSEKVKALNARLKAAEGK |
Ga0228668_10105986 | 3300024180 | Seawater | MNVYIDNLKLTPEQVNTIRAAIKARYTPAKVEALNVRIKATEGK |
Ga0228636_10064092 | 3300024191 | Seawater | MNVYIGNLNLTPKQIDALRVAIKARYTPARVKALNAKIRAAEGK |
Ga0228626_10079756 | 3300024321 | Seawater | MNVYIDRLKLTDQQVIALRVAIKARYTPARVKALNAKIRAAEGK |
Ga0228635_10133033 | 3300024328 | Seawater | MNVYIDNINLTPKQIDALRVAIKARYTPARVRALNAKIRAAEGK |
Ga0228631_10562931 | 3300024329 | Seawater | MNVYIGNLNLTPKQIDALRVAIKARYTPARVKALNAK |
Ga0228631_10749543 | 3300024329 | Seawater | YIDNINLTPKQIDALRVAIKARYTPARVKALNAKIRAAEGK |
Ga0228671_10133362 | 3300024334 | Seawater | MNVYIDNINLTPKQIDALRVAIKARYTPARVKALNAKIRAAEGK |
Ga0244775_100716163 | 3300024346 | Estuarine | MTVYIDNLNLTAKQLRELRAAIKARYTPEKVKALNARLKATEGK |
(restricted) Ga0255048_102069521 | 3300024518 | Seawater | MNVIIDNLNLTAKQLRELRAAIKARYTPEKVKALNARLKATEGK |
(restricted) Ga0255047_101341681 | 3300024520 | Seawater | NMNVIIDNLNLSPKQVNALRAAIKARYTPEKVKALNARLKATEGK |
(restricted) Ga0255047_102960991 | 3300024520 | Seawater | MNVTIDNLHLTAKQLNALRAAIKARYTPEKVKALNARLKATEGK |
(restricted) Ga0255044_103300811 | 3300024529 | Seawater | MNVTIDNLHLTAKQLRELRAAIKARYTPEKVKTLNARLKAAEGK |
Ga0208303_100075213 | 3300025543 | Aqueous | MTVYINNLNLTAKQVEALRVAIKARYTPEKVKALNARIKATKGK |
Ga0208303_10534923 | 3300025543 | Aqueous | MTVYIDNLNLTAKQLRELRAAIKERYTPERVKALNARIKAAEGK |
Ga0209304_10554062 | 3300025577 | Pelagic Marine | MNVIIEGLNLSNGQLIELRAAIKARYTPEKVKALNARLKATEGK |
Ga0209304_10559301 | 3300025577 | Pelagic Marine | MNVIIEGLNLSNKQLIELRAAIKARYTPEKVKALNARLKATEGK |
Ga0209094_10492571 | 3300025594 | Pelagic Marine | MNVIIEGLNLSNRQLIELRAAIKARYTPEKVKALNARL |
Ga0209504_10240803 | 3300025621 | Pelagic Marine | MNVHIDNLNLTAKQVEALRVSIKARYTPARVKALNAKIRAAKGK |
Ga0209504_10248492 | 3300025621 | Pelagic Marine | MTVYIDNLNLTAKQVEALRVAIKARYTPARVRALNARIKATKGK |
Ga0209197_11896702 | 3300025637 | Pelagic Marine | MNVIIEGLNLSNRQLIELRAAIKARYTPEKVKALN |
Ga0209833_10180493 | 3300025641 | Pelagic Marine | MNVLIEGLNLSNGQLIKLRAAIKARYTPEKVKALNARLKATEGK |
Ga0209833_11187871 | 3300025641 | Pelagic Marine | MKVIIEGLNLSNKQLIELRAAIKARYTPEKVKALNARLKATEGK |
Ga0209833_11522661 | 3300025641 | Pelagic Marine | MNVIIEGLNLSNRQLIELRAAIKARYTPEKVKALNARLKAT |
Ga0209602_11506593 | 3300025704 | Pelagic Marine | MNVIIEGLNLSNRQLIELRAAIKARYTPEKVKALNARLK |
Ga0209223_101120561 | 3300025876 | Pelagic Marine | MNVIIKGLNLSNRQLIELRAAIKARYTPEKVKALNARLKATEGK |
Ga0209534_104863101 | 3300025880 | Pelagic Marine | LEGLNLSNKQLIDLRAAIKARYTPEKVKTLNARLKATEGK |
Ga0209309_100692141 | 3300025881 | Pelagic Marine | MNVIIEGLNLSNKQLIELRAAIRARYTPEKVKALNARLKATEGK |
Ga0228622_10307891 | 3300026479 | Seawater | MNVYIDNINLTPKQIDALRVAIKARYTPARVKALNAKIRA |
Ga0228620_10267741 | 3300026483 | Seawater | MNVYIDNINLTPKQIDALRVAIKARYTPARVKALNAKIRAAEG |
Ga0208304_101546472 | 3300027751 | Estuarine | MNVIIEGLNLSPKQVNALRAAIKARYTPEKVKTLNARLKATEGK |
Ga0208671_101609692 | 3300027757 | Estuarine | MNVIIDNINLSPKQVKAVRAAIKARYTPEKVKALNARLKATEGK |
(restricted) Ga0233415_1000074115 | 3300027861 | Seawater | MNVIIKGLNLSTKQVNALRAAIKARYTPERVKALNARLKAAEGK |
(restricted) Ga0233415_100589202 | 3300027861 | Seawater | MNVIIEGLNLSPKQVNALRAAIKARYTPEKVKALNARLKATEGK |
(restricted) Ga0233415_102141313 | 3300027861 | Seawater | MNVIIEGLNLSTKQVNELRAAIKARYTPERVKALNARLKATEGK |
(restricted) Ga0233415_103428232 | 3300027861 | Seawater | MNVIIDNLNLTAKQLRELRAAIKARYTPEKVKALNARLKAAEGK |
(restricted) Ga0233413_100158405 | 3300027996 | Seawater | MNVYIDNLKLTDQQVIAIRAAIKARCTPAKVRALNAKLKATEGK |
(restricted) Ga0233413_102450852 | 3300027996 | Seawater | MNVTIDNLHLTAKQLRELRAAIKARYTPEKVKALNARLKAAEGK |
(restricted) Ga0233413_102551471 | 3300027996 | Seawater | MNVIIDNLNLSPKQVNALRAAIKARYTPERVKALNARLKATEGK |
Ga0228674_10337302 | 3300028008 | Seawater | MNVYIGNLNLTAKQVQALRVAIKARYTPARVKALNAKIRAAEGK |
Ga0228643_11327971 | 3300028396 | Seawater | MNVYIDNLKLTPEQVNTIRAAIKARYTPAKVEALNVRIKATE |
Ga0307488_102037172 | 3300031519 | Sackhole Brine | MTVYIDNLKLTAKQLRELRAAIKERYTPEKVKALNARIKATEGK |
Ga0316202_100237325 | 3300032277 | Microbial Mat | MNVYIDNLNLTAKQVEALRVAIKARYTPEKVKALNARIKATESK |
⦗Top⦘ |