| Basic Information | |
|---|---|
| Family ID | F048276 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 148 |
| Average Sequence Length | 45 residues |
| Representative Sequence | TREEIARDHITRAEVRQDLEKIMERFDSGFERLEAKIDALAKKG |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 148 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.32 % |
| % of genes from short scaffolds (< 2000 bps) | 89.86 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (64.189 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (32.432 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.811 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (38.514 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.33% β-sheet: 0.00% Coil/Unstructured: 41.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 148 Family Scaffolds |
|---|---|---|
| PF02945 | Endonuclease_7 | 0.68 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 64.19 % |
| All Organisms | root | All Organisms | 35.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001851|RCM31_10116994 | Not Available | 550 | Open in IMG/M |
| 3300002220|MLSBCLC_10276525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1327 | Open in IMG/M |
| 3300002272|B570J29579_107359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
| 3300002476|metazooDRAFT_10869187 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300002733|codie8draft_1032276 | Not Available | 4300 | Open in IMG/M |
| 3300005527|Ga0068876_10351038 | Not Available | 829 | Open in IMG/M |
| 3300006030|Ga0075470_10123984 | Not Available | 764 | Open in IMG/M |
| 3300006637|Ga0075461_10234833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
| 3300006802|Ga0070749_10003808 | Not Available | 10047 | Open in IMG/M |
| 3300006802|Ga0070749_10029648 | Not Available | 3425 | Open in IMG/M |
| 3300006802|Ga0070749_10115253 | All Organisms → Viruses → Predicted Viral | 1581 | Open in IMG/M |
| 3300006802|Ga0070749_10224228 | Not Available | 1070 | Open in IMG/M |
| 3300006802|Ga0070749_10369452 | Not Available | 795 | Open in IMG/M |
| 3300006802|Ga0070749_10455509 | All Organisms → Viruses | 700 | Open in IMG/M |
| 3300006802|Ga0070749_10559191 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 619 | Open in IMG/M |
| 3300006802|Ga0070749_10654608 | Not Available | 564 | Open in IMG/M |
| 3300006802|Ga0070749_10688840 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 547 | Open in IMG/M |
| 3300006805|Ga0075464_10781388 | Not Available | 593 | Open in IMG/M |
| 3300006810|Ga0070754_10456743 | Not Available | 553 | Open in IMG/M |
| 3300007094|Ga0102532_1141093 | Not Available | 1892 | Open in IMG/M |
| 3300007212|Ga0103958_1066942 | All Organisms → Viruses → Predicted Viral | 1395 | Open in IMG/M |
| 3300007234|Ga0075460_10230539 | Not Available | 622 | Open in IMG/M |
| 3300007234|Ga0075460_10248921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 593 | Open in IMG/M |
| 3300007346|Ga0070753_1153045 | Not Available | 873 | Open in IMG/M |
| 3300007538|Ga0099851_1144156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 890 | Open in IMG/M |
| 3300007538|Ga0099851_1229087 | Not Available | 669 | Open in IMG/M |
| 3300007538|Ga0099851_1283098 | Not Available | 587 | Open in IMG/M |
| 3300007538|Ga0099851_1303476 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300007538|Ga0099851_1313773 | Not Available | 551 | Open in IMG/M |
| 3300007538|Ga0099851_1333970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300007539|Ga0099849_1219080 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 709 | Open in IMG/M |
| 3300007539|Ga0099849_1326246 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
| 3300007540|Ga0099847_1049315 | Not Available | 1328 | Open in IMG/M |
| 3300007541|Ga0099848_1319298 | Not Available | 530 | Open in IMG/M |
| 3300007541|Ga0099848_1343886 | Not Available | 503 | Open in IMG/M |
| 3300007542|Ga0099846_1115560 | Not Available | 982 | Open in IMG/M |
| 3300007542|Ga0099846_1168059 | Not Available | 784 | Open in IMG/M |
| 3300007640|Ga0070751_1214939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 742 | Open in IMG/M |
| 3300007960|Ga0099850_1149941 | Not Available | 939 | Open in IMG/M |
| 3300007960|Ga0099850_1165988 | Not Available | 882 | Open in IMG/M |
| 3300007960|Ga0099850_1300815 | Not Available | 609 | Open in IMG/M |
| 3300008339|Ga0114878_1221132 | Not Available | 616 | Open in IMG/M |
| 3300008953|Ga0104241_1000191 | Not Available | 5039 | Open in IMG/M |
| 3300008962|Ga0104242_1085400 | Not Available | 524 | Open in IMG/M |
| 3300009111|Ga0115026_10773349 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 748 | Open in IMG/M |
| 3300009146|Ga0105091_10660956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
| 3300009168|Ga0105104_10154583 | All Organisms → Viruses → Predicted Viral | 1241 | Open in IMG/M |
| 3300009529|Ga0114919_10613461 | Not Available | 745 | Open in IMG/M |
| 3300010354|Ga0129333_10194469 | Not Available | 1846 | Open in IMG/M |
| 3300010354|Ga0129333_10426278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1171 | Open in IMG/M |
| 3300010354|Ga0129333_10490383 | Not Available | 1078 | Open in IMG/M |
| 3300010354|Ga0129333_11130187 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
| 3300010354|Ga0129333_11261594 | Not Available | 612 | Open in IMG/M |
| 3300010389|Ga0136549_10135964 | All Organisms → Viruses → Predicted Viral | 1118 | Open in IMG/M |
| 3300010389|Ga0136549_10137052 | Not Available | 1112 | Open in IMG/M |
| (restricted) 3300013122|Ga0172374_1135451 | Not Available | 919 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10258552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1052 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10043478 | Not Available | 4009 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10687818 | Not Available | 604 | Open in IMG/M |
| 3300013372|Ga0177922_11259695 | Not Available | 3143 | Open in IMG/M |
| 3300014050|Ga0119952_1040156 | Not Available | 1345 | Open in IMG/M |
| 3300014050|Ga0119952_1057888 | Not Available | 1023 | Open in IMG/M |
| 3300017707|Ga0181363_1000290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14598 | Open in IMG/M |
| 3300017707|Ga0181363_1015756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1512 | Open in IMG/M |
| 3300017747|Ga0181352_1001170 | Not Available | 10456 | Open in IMG/M |
| 3300017747|Ga0181352_1068097 | Not Available | 1009 | Open in IMG/M |
| 3300017747|Ga0181352_1176641 | Not Available | 556 | Open in IMG/M |
| 3300017785|Ga0181355_1200077 | Not Available | 785 | Open in IMG/M |
| 3300017788|Ga0169931_10369625 | Not Available | 1079 | Open in IMG/M |
| 3300019784|Ga0181359_1013564 | Not Available | 2970 | Open in IMG/M |
| 3300020074|Ga0194113_11019970 | Not Available | 551 | Open in IMG/M |
| 3300020221|Ga0194127_10508865 | Not Available | 779 | Open in IMG/M |
| 3300020498|Ga0208050_1005840 | Not Available | 1491 | Open in IMG/M |
| 3300020573|Ga0208485_1082576 | Not Available | 519 | Open in IMG/M |
| 3300021438|Ga0213920_1087681 | Not Available | 601 | Open in IMG/M |
| 3300021961|Ga0222714_10129161 | Not Available | 1548 | Open in IMG/M |
| 3300021962|Ga0222713_10096024 | All Organisms → Viruses → Predicted Viral | 2133 | Open in IMG/M |
| 3300021962|Ga0222713_10129727 | All Organisms → Viruses → Predicted Viral | 1767 | Open in IMG/M |
| 3300021962|Ga0222713_10243291 | Not Available | 1177 | Open in IMG/M |
| 3300021963|Ga0222712_10049852 | Not Available | 3136 | Open in IMG/M |
| 3300022179|Ga0181353_1049818 | Not Available | 1098 | Open in IMG/M |
| 3300022179|Ga0181353_1061031 | Not Available | 974 | Open in IMG/M |
| 3300022179|Ga0181353_1075184 | Not Available | 858 | Open in IMG/M |
| 3300022752|Ga0214917_10097620 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1723 | Open in IMG/M |
| 3300022752|Ga0214917_10136015 | Not Available | 1332 | Open in IMG/M |
| 3300022752|Ga0214917_10166843 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1136 | Open in IMG/M |
| 3300022752|Ga0214917_10304606 | Not Available | 706 | Open in IMG/M |
| 3300022752|Ga0214917_10394633 | Not Available | 572 | Open in IMG/M |
| 3300022752|Ga0214917_10412922 | Not Available | 551 | Open in IMG/M |
| 3300022752|Ga0214917_10424003 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 539 | Open in IMG/M |
| 3300022752|Ga0214917_10462104 | Not Available | 503 | Open in IMG/M |
| 3300023179|Ga0214923_10125223 | Not Available | 1665 | Open in IMG/M |
| 3300023179|Ga0214923_10435730 | Not Available | 661 | Open in IMG/M |
| 3300023179|Ga0214923_10628409 | Not Available | 503 | Open in IMG/M |
| 3300024262|Ga0210003_1216822 | Not Available | 774 | Open in IMG/M |
| 3300024262|Ga0210003_1220743 | Not Available | 764 | Open in IMG/M |
| 3300024289|Ga0255147_1090052 | Not Available | 569 | Open in IMG/M |
| 3300024433|Ga0209986_10403210 | Not Available | 623 | Open in IMG/M |
| 3300025646|Ga0208161_1030105 | All Organisms → Viruses | 1922 | Open in IMG/M |
| 3300025646|Ga0208161_1105466 | Not Available | 769 | Open in IMG/M |
| 3300025646|Ga0208161_1156761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
| 3300025647|Ga0208160_1067742 | Not Available | 979 | Open in IMG/M |
| 3300025655|Ga0208795_1119278 | Not Available | 688 | Open in IMG/M |
| 3300025674|Ga0208162_1161787 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
| 3300025687|Ga0208019_1101638 | Not Available | 881 | Open in IMG/M |
| 3300025687|Ga0208019_1105214 | Not Available | 859 | Open in IMG/M |
| 3300025818|Ga0208542_1200970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
| 3300025889|Ga0208644_1029519 | All Organisms → Viruses | 3306 | Open in IMG/M |
| 3300025889|Ga0208644_1146458 | All Organisms → Viruses → Predicted Viral | 1089 | Open in IMG/M |
| 3300025889|Ga0208644_1202756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 860 | Open in IMG/M |
| 3300025889|Ga0208644_1284731 | Not Available | 664 | Open in IMG/M |
| 3300025896|Ga0208916_10409535 | Not Available | 591 | Open in IMG/M |
| 3300027743|Ga0209593_10072716 | All Organisms → Viruses → Predicted Viral | 1292 | Open in IMG/M |
| 3300027816|Ga0209990_10016686 | Not Available | 4266 | Open in IMG/M |
| 3300027888|Ga0209635_11070014 | Not Available | 550 | Open in IMG/M |
| 3300027917|Ga0209536_102649999 | Not Available | 588 | Open in IMG/M |
| 3300031539|Ga0307380_10280515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1558 | Open in IMG/M |
| 3300031565|Ga0307379_10560719 | All Organisms → Viruses → Predicted Viral | 1055 | Open in IMG/M |
| 3300031565|Ga0307379_11020267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 703 | Open in IMG/M |
| 3300031565|Ga0307379_11433902 | Not Available | 555 | Open in IMG/M |
| 3300031566|Ga0307378_11153779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
| 3300031578|Ga0307376_10188274 | Not Available | 1413 | Open in IMG/M |
| 3300031578|Ga0307376_10290488 | Not Available | 1094 | Open in IMG/M |
| 3300031578|Ga0307376_10413491 | Not Available | 885 | Open in IMG/M |
| 3300031578|Ga0307376_10500734 | Not Available | 785 | Open in IMG/M |
| 3300031578|Ga0307376_10868588 | Not Available | 552 | Open in IMG/M |
| 3300031669|Ga0307375_10339644 | Not Available | 950 | Open in IMG/M |
| 3300031669|Ga0307375_10370222 | Not Available | 897 | Open in IMG/M |
| 3300031669|Ga0307375_10767150 | Not Available | 548 | Open in IMG/M |
| 3300031673|Ga0307377_10398089 | Not Available | 1023 | Open in IMG/M |
| 3300031673|Ga0307377_10727477 | Not Available | 694 | Open in IMG/M |
| 3300031673|Ga0307377_10831234 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
| 3300031758|Ga0315907_10197860 | All Organisms → Viruses → Predicted Viral | 1685 | Open in IMG/M |
| 3300031787|Ga0315900_10276284 | Not Available | 1412 | Open in IMG/M |
| 3300031857|Ga0315909_10802912 | Not Available | 594 | Open in IMG/M |
| 3300031951|Ga0315904_10583762 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 966 | Open in IMG/M |
| 3300031951|Ga0315904_10671949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 876 | Open in IMG/M |
| 3300032116|Ga0315903_10730812 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 735 | Open in IMG/M |
| 3300032116|Ga0315903_11216503 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
| 3300033981|Ga0334982_0029212 | Not Available | 3154 | Open in IMG/M |
| 3300034012|Ga0334986_0077425 | All Organisms → Viruses | 2038 | Open in IMG/M |
| 3300034072|Ga0310127_249084 | All Organisms → Viruses | 632 | Open in IMG/M |
| 3300034073|Ga0310130_0089020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 924 | Open in IMG/M |
| 3300034104|Ga0335031_0739113 | Not Available | 559 | Open in IMG/M |
| 3300034118|Ga0335053_0383630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → unclassified Vibrio → Vibrio sp. HI00D65 | 857 | Open in IMG/M |
| 3300034118|Ga0335053_0387820 | Not Available | 851 | Open in IMG/M |
| 3300034200|Ga0335065_0613655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 633 | Open in IMG/M |
| 3300034418|Ga0348337_184777 | Not Available | 540 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 32.43% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 14.86% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 10.81% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 8.11% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.73% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.38% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.38% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.38% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.38% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.70% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.03% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.35% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 1.35% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 1.35% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 1.35% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.68% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.68% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.68% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.68% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.68% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.68% |
| Coal-Bed Methane Well | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Coal-Bed Methane Well | 0.68% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
| 3300002220 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300002272 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns | Environmental | Open in IMG/M |
| 3300002476 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - NOV 2012 | Environmental | Open in IMG/M |
| 3300002733 | Coal-bed methane well microbial communities from Surat Basin, Queensland, Australia, Sample - Codie-8 produced water | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300007094 | Freshwater lake microbial communities from Singapore - a non-axenic Oscillatoriales culture (M13A) | Environmental | Open in IMG/M |
| 3300007212 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Bottom layer) 7 sequencing projects | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008339 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008953 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT4 | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020573 | Freshwater microbial communities from Lake Mendota, WI - 17JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027888 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| RCM31_101169941 | 3300001851 | Marine Plankton | EEIAREHITRAEVERDLEKIMERFDAGIARLELKIDDLRK* |
| MLSBCLC_102765251 | 3300002220 | Hydrocarbon Resource Environments | EMNRISILLNRTREEVARDHITRKEVDDKVDRIVERFDDGFKRLETKIDELARTHRE* |
| B570J29579_1073592 | 3300002272 | Freshwater | LLNKTREEIARDHITRAEVRADLEKIMERFDSGFERLEAKIDALAKKG* |
| metazooDRAFT_108691874 | 3300002476 | Lake | LNRTREEVARDHITRKEVDDKVDRIVERFDQGFKRLETKIDELAKSQRG* |
| codie8draft_10322761 | 3300002733 | Coal-Bed Methane Well | RTREEVARDHITRKEVDDKVERIVERFDDGFKRLEAKIDDLAKNQRGS* |
| Ga0068876_103510385 | 3300005527 | Freshwater Lake | ARDHITRAEVRADLEKIMERFDTGFERLESKIDALAKKG* |
| Ga0075470_101239843 | 3300006030 | Aqueous | REEIARDHITRAEVRADMEKICERFDTGFARLEAKIDALAERK* |
| Ga0075461_102348332 | 3300006637 | Aqueous | ISILLNKTREEVARDHITRAEVRADLDKIREHFDNGFDRLEAKIDALAARRS* |
| Ga0070749_1000380819 | 3300006802 | Aqueous | KGKFDEIQRLGILLNKTREEVARDHITRAEVRADLDKIREHFDSGFERLEKKIDALGARR |
| Ga0070749_100296481 | 3300006802 | Aqueous | ILLNKTREEIARDHITRAEVRADLEKIMERFDSGFERLEAKIDALAKKGQ* |
| Ga0070749_101152531 | 3300006802 | Aqueous | ARDHITRAEVRADLDKIREHFDNGFDRLEAKIDALAARR* |
| Ga0070749_102242283 | 3300006802 | Aqueous | RTREEVARDHITRAEVRADLEKIREHFDNGFDRLEAKIDALAARR* |
| Ga0070749_103694521 | 3300006802 | Aqueous | KTREEVARDHITRAEVRADLDKIREHFDNGFDRLEAKIDALAARR* |
| Ga0070749_104555091 | 3300006802 | Aqueous | NKTREEIARDHITRAEVRADLDKIREHFDNGFDRLEAKIDALAARRS* |
| Ga0070749_105591911 | 3300006802 | Aqueous | NKTREEIARDHITRAEVRADLDKIREHFDNGFDRLEAKIDALAARR* |
| Ga0070749_106546081 | 3300006802 | Aqueous | RDHITRAEVRQDLEKIMERFDTGFERLEAKIDALAKKG* |
| Ga0070749_106888403 | 3300006802 | Aqueous | IQILLNRTREEIARDHITRAEVKQDLERIMERFDSGFERLEAKIDALAKKGT* |
| Ga0075464_107813881 | 3300006805 | Aqueous | ILLNRTREEIARDHITRAEVRADLEKIMERFDSGFERLEAKIDALAKKG* |
| Ga0070754_104567432 | 3300006810 | Aqueous | EEVARDHITRAEVRADLDKIREHFDSGFDRLEKKIDALGARR* |
| Ga0102532_11410931 | 3300007094 | Freshwater Lake | IARDHITRAEVRADLERIMERFDTGFERLEAKIDALAKKGQ* |
| Ga0103958_10669421 | 3300007212 | Freshwater Lake | REEVARDHITRAEVRADLEKIREHFDSGFKRLEDKIDALGRR* |
| Ga0075460_102305391 | 3300007234 | Aqueous | DEIQRLGILLNKTREEVARDHITRAEVRADLDKIREHFDNGFDRLEAKIDALAARR* |
| Ga0075460_102489213 | 3300007234 | Aqueous | RTREEIARDHITRAEVRADLEKIMERFDTGFERLESKIDALAKRG* |
| Ga0070753_11530451 | 3300007346 | Aqueous | ITRAEVRADLDKIREHFDNGFDRLEAKIDALAARR* |
| Ga0099851_11441561 | 3300007538 | Aqueous | GKFDEIQRLGILLNKTREEVARDHITRAEVRADLDKIREHFDSGFDRLEAKIDALSARR* |
| Ga0099851_12290871 | 3300007538 | Aqueous | ARDHITRAEVRADLDKIREHFDSGFERLEKKIDALSARR* |
| Ga0099851_12830981 | 3300007538 | Aqueous | HITRAEVRQDLDKIREHFDSGFERLEKKIDALAARR* |
| Ga0099851_13034761 | 3300007538 | Aqueous | GKFDEIQRLGILLNKTREEVARDHITRAEVRADLDKIREHFDSGFDRLEKKIDALSARR* |
| Ga0099851_13137731 | 3300007538 | Aqueous | HITRAEVRADLEKIREHFDSGFDRLEKKIDALAQRR* |
| Ga0099851_13339701 | 3300007538 | Aqueous | SILLNRTREEVARDHITRAEVRQDLEKIREHFDSGFDRLEKKIDALAQRR* |
| Ga0099849_12190801 | 3300007539 | Aqueous | REEVARDHITRAEVKADLKTIQEHFDRGFKRLEDKIDSLVLERK* |
| Ga0099849_13262461 | 3300007539 | Aqueous | LGILLNKTREEVARDHITRAEVRQDLEKIREHFDSGFKRLEDKIDDLVKRG* |
| Ga0099847_10493154 | 3300007540 | Aqueous | DELQRISILLNKTREEVARDHITRAEVRADLDKIREHFDSGFERLEKKIDALAARR* |
| Ga0099848_13192981 | 3300007541 | Aqueous | ITRAEVRQDLEKIREHFDSGFDRLEKKIDALAQRR* |
| Ga0099848_13438863 | 3300007541 | Aqueous | VARDHITRAEVRADLDKIREHFDSGFDRLEAKIDALSARR* |
| Ga0099846_11155601 | 3300007542 | Aqueous | EEVARDHITRAEVRADLDKIREHFDSGFERLEKKIDALAARR* |
| Ga0099846_11680591 | 3300007542 | Aqueous | NKTREEVARDHITRAEVRADLDKIREHFDSGFERLEKKIDALAARR* |
| Ga0070751_12149391 | 3300007640 | Aqueous | QRLGILLNKTREEVARDHITRAEVRQDLEKIREHFDSGFKRLEDKIDDLVKRG* |
| Ga0099850_11499411 | 3300007960 | Aqueous | SILLNKTREEVARDHITRAEVRQDLDKIREHFDSGFERLEKKIDALAARR* |
| Ga0099850_11659881 | 3300007960 | Aqueous | KTREEVARDHITRAEVRQDLDKIREHFDSGFERLEKKIDALAARR* |
| Ga0099850_13008151 | 3300007960 | Aqueous | TRAEVRADLDKIREHFDSGFERLEKKIDALAQRR* |
| Ga0114878_12211321 | 3300008339 | Freshwater Lake | RDHITRAEVHRDLEKIAERFEAGIERLESKIDQLRKETQR* |
| Ga0104241_10001914 | 3300008953 | Freshwater | DLITRAEVRQDLEKIMERFDAGFERLEAKIDQLAKKG* |
| Ga0104242_10854002 | 3300008962 | Freshwater | TRAEVRQDLEKIMERFDAGFERLEAKIDQLAKKG* |
| Ga0115026_107733491 | 3300009111 | Wetland | RDHITRAEVRADLDKIREHFDSGFQRLEAKIDSLANQSKG* |
| Ga0105091_106609561 | 3300009146 | Freshwater Sediment | LGILLNKTREEVARDHITRAEVKADLQAIRDHFDDGFRRLEAKIDKIAEQTKG* |
| Ga0105104_101545834 | 3300009168 | Freshwater Sediment | RDHITRAEVKADLQAIRDHFDDGFKRLETKIDKLAEQAKG* |
| Ga0114919_106134612 | 3300009529 | Deep Subsurface | REEVARDHITRAEVRADLDKIREHFDSGFERLEKKIDALAARR* |
| Ga0129333_101944691 | 3300010354 | Freshwater To Marine Saline Gradient | EEIARDHITRAEVRADLEKIMERFDSGFERLEAKIDALAKKG* |
| Ga0129333_104262781 | 3300010354 | Freshwater To Marine Saline Gradient | NRTREEIARDHITRAEVRADMEKIIERFDSGFARLEAKIDALAERK* |
| Ga0129333_104903831 | 3300010354 | Freshwater To Marine Saline Gradient | NRTREEIARDHITRAEVRADLEKIMERFDTGFERLESKIDALAKKGP* |
| Ga0129333_111301874 | 3300010354 | Freshwater To Marine Saline Gradient | LLNRTREEIARDHITRAEVRADLEKIMERFDTGFERLESKIDALAKKG* |
| Ga0129333_112615941 | 3300010354 | Freshwater To Marine Saline Gradient | KTREEIARDHITRAEVRADLEKIMERFDTGFERLEAKIDALVKKG* |
| Ga0136549_101359642 | 3300010389 | Marine Methane Seep Sediment | DHITRAEVRQDLEKIREHFDNGFKRLEDKIDALGKRN* |
| Ga0136549_101370521 | 3300010389 | Marine Methane Seep Sediment | TREEVARDHITRAEVRADLDKIREHFDNGFDRLEAKIDALSARR* |
| (restricted) Ga0172374_11354513 | 3300013122 | Freshwater | NKTREEIARDHITRAEVRQDLEKIMERFDAGFERLEAKIDALAKGKQ* |
| (restricted) Ga0172367_102585522 | 3300013126 | Freshwater | DELQRISILLNKTREEVARDHITRAEVRQDLEKIREHFDNGFKRLEDKIDILTQRN* |
| (restricted) Ga0172373_100434781 | 3300013131 | Freshwater | RDHITRAEVRQDIEKIMERFDTGFERLEAKIDALAKKGQ* |
| (restricted) Ga0172373_106878181 | 3300013131 | Freshwater | LNKTREEIARDHITRAEVRQDIEKIMERFDAGFERLEAKIDALAKKG* |
| Ga0177922_1125969510 | 3300013372 | Freshwater | TRAEVRADLERIMERFDSGFERLEAKIDALAEKGR* |
| Ga0119952_10401563 | 3300014050 | Freshwater | KTREEIARDHITRAEVRQDLEKIMERFDAGFERLEAKIDQLAKGAHK* |
| Ga0119952_10578881 | 3300014050 | Freshwater | ITRAEVRQDLEKIMERFDAGFERLEAKIDQLAKKG* |
| Ga0181363_10002901 | 3300017707 | Freshwater Lake | REEIARDHITRAEVRADLERIMERFDAGIGRLEAKIDALAERK |
| Ga0181363_10157561 | 3300017707 | Freshwater Lake | REEIARDHITRAEVRADLEKIMERFDSGFERLEAKIDALAKGKQ |
| Ga0181352_10011701 | 3300017747 | Freshwater Lake | IARDHITRAEVRADLERIMERFDAGIGRLEAKIDALAERK |
| Ga0181352_10680971 | 3300017747 | Freshwater Lake | IARDHITRAEVRADMEKIIERFDSGFARLEAKIDALAERK |
| Ga0181352_11766411 | 3300017747 | Freshwater Lake | HITRAEVRQDLEKIMERFDAGFERLEAKIDQLAKKA |
| Ga0181355_12000771 | 3300017785 | Freshwater Lake | ITRAEVRADMEKICERFDSGFARLEAKIDALAERK |
| Ga0169931_103696251 | 3300017788 | Freshwater | NKTREEIARDHITRAEVRADLERIMERFDAGFERLESKIDALAKKG |
| Ga0181359_10135649 | 3300019784 | Freshwater Lake | REIARDHITRAEVRADLERIMERFDAGFERLEAKIDQLAKKG |
| Ga0194113_110199701 | 3300020074 | Freshwater Lake | REEVARDHITRTEVREDLEKIREHFDSGFARLETKIDDLVKSQRR |
| Ga0194127_105088652 | 3300020221 | Freshwater Lake | NKTREEIARDCITRAEVRADLERIMERFDAGFERLEAKIDALVKKG |
| Ga0208050_10058401 | 3300020498 | Freshwater | IARDHITRAEVRADLEKIMERFDSGFERLEAKIDALAKKG |
| Ga0208485_10825762 | 3300020573 | Freshwater | HITRAEVHRDMEKIMERFDAGINRLEAKIDELGKRN |
| Ga0213920_10876812 | 3300021438 | Freshwater | REEVARDHITRAEVRADLQAIRDHFDDGFARLESKIDQLRERG |
| Ga0222714_101291611 | 3300021961 | Estuarine Water | REEIARDLITRAEVRQDLEKIMERFDAGFERLEAKIDQLAKKG |
| Ga0222713_100960248 | 3300021962 | Estuarine Water | EIARDHITRAEVRADLEKIMERFDTGFERLEAKIDALAKKG |
| Ga0222713_101297275 | 3300021962 | Estuarine Water | IARDHITRAEVRADLEKIMERFDTGFERLEAKIDALAKKG |
| Ga0222713_102432913 | 3300021962 | Estuarine Water | LNRTREEIAREYITRAEVKQDFEKIMERFDSGFTRLEAKIDALAKGKQ |
| Ga0222712_100498521 | 3300021963 | Estuarine Water | ITRAEVRADMEKICERFDTGFARLEAKIDALAERK |
| Ga0181353_10498183 | 3300022179 | Freshwater Lake | DHITRAEVRADLERIMERFDAGFERLEAKIDQLAKKG |
| Ga0181353_10610311 | 3300022179 | Freshwater Lake | IARDHITRAEVRADMEKIIERFDTGFARLEAKIDALAERK |
| Ga0181353_10751841 | 3300022179 | Freshwater Lake | TRAEVRADLERIMERFDAGFERLEAKIDQLAKAKQ |
| Ga0214917_100976204 | 3300022752 | Freshwater | QILLNKTREEIARDHITRAEVRADLEKIMERFDSGFERLEAKIDALAKGSHK |
| Ga0214917_101360155 | 3300022752 | Freshwater | LNRTREEIARDHITRAEVRADLEKIMERFDSGFERLEAKIDALAKKG |
| Ga0214917_101668435 | 3300022752 | Freshwater | LLNKTREEIARDLITRAEVRQDLEKIMERFDAGFERLEAKIDQLAKKGQ |
| Ga0214917_103046061 | 3300022752 | Freshwater | NKTREEIARDLITRAEVRQDLEKIMERFDAGFERLEAKIDQLAKKG |
| Ga0214917_103946331 | 3300022752 | Freshwater | REEIARDHITRAEVRQDLEKIMERFDAGFERLEAKIDQLAKKG |
| Ga0214917_104129221 | 3300022752 | Freshwater | EIARDHITRAEVRQDLEKIMERFDAGFERLEAKIDQLAKKG |
| Ga0214917_104240033 | 3300022752 | Freshwater | LLNKTREEIARDLITRAEVRQDLEKIMERFDAGFERLEAKIDQLAKKG |
| Ga0214917_104621042 | 3300022752 | Freshwater | TREEIARDHITRAEVRQDLEKIMERFDSGFERLEAKIDALAKKG |
| Ga0214923_101252231 | 3300023179 | Freshwater | RDHITRAEVRADLEKIMERFDAGFERLESKIDALAKKG |
| Ga0214923_104357301 | 3300023179 | Freshwater | LNKTREEIARDHITRAEVRQDLEKIMERFDAGFERLEAKIDQLAKGAHK |
| Ga0214923_106284091 | 3300023179 | Freshwater | REEIARDLITRAEVRQDLEKIMERFDAGFERLEAKIDQLAKKGQ |
| Ga0210003_12168221 | 3300024262 | Deep Subsurface | LQRISILLNKTREEMARDHITRAEVRQDLDKIREHFDSGFDRLEKKIDALAARR |
| Ga0210003_12207431 | 3300024262 | Deep Subsurface | TREKVARDHITRSEVRQDLDKIREYFDSGFKRLEEKIDALGQRR |
| Ga0255147_10900521 | 3300024289 | Freshwater | EVAREHITRAEVRADLDKIREHFDDGFKRLEAKIDLLAQRS |
| Ga0209986_104032103 | 3300024433 | Deep Subsurface | LLNKTREEMARDHITRAEVRQDLDKIREHFDSGFERLEKKIDALAARR |
| Ga0208161_10301051 | 3300025646 | Aqueous | LLNKTREEVARDHITRAEVRQDLDKIREHFDSGFERLEKKIDALAARR |
| Ga0208161_11054661 | 3300025646 | Aqueous | RDHITRAEVRADLEKIREHFDSGFDRLEKKIDALAQRR |
| Ga0208161_11567613 | 3300025646 | Aqueous | KFDEIQRLGILLNKTREEVARDHITRAEVRADLDKIREHFDSGFDRLEAKIDALSARR |
| Ga0208160_10677424 | 3300025647 | Aqueous | RDHITRAEVRQDLDKIREHFDSGFERLEKKIDALAARR |
| Ga0208795_11192783 | 3300025655 | Aqueous | ARDHITRAEVRQDLDKIREHFDSGFERLEKKIDALAARR |
| Ga0208162_11617871 | 3300025674 | Aqueous | LKGKFDELQRISILLNKTREEVARDHITRAEVRADLDKIREHFDSGFERLEKKIDALAAR |
| Ga0208019_11016383 | 3300025687 | Aqueous | SILLNKTREEVARDHITRAEVRQDLDKIREHFDSGFERLEKKIDALAARR |
| Ga0208019_11052141 | 3300025687 | Aqueous | HITRAEVRQDLDKIREHFDSGFERLEKKIDALAARR |
| Ga0208542_12009702 | 3300025818 | Aqueous | LKGKFDEIQRLGILLNKTREEVARDHITRAEVRADLDKIREHFDNGFDRLEAKIDALAAR |
| Ga0208644_10295191 | 3300025889 | Aqueous | RDHITRAEVRQDLEKIREHFDSGFKRLEDKIDDLVKRG |
| Ga0208644_11464581 | 3300025889 | Aqueous | LKGKFDEIQRLGILLNKTREEVARDHITRAEVRADLDKIREHFDSGFERLEKKIDALGAR |
| Ga0208644_12027565 | 3300025889 | Aqueous | ILLNKTREEIARDHITRAEVRADLEKIMERFDSGFERLEAKIDALAKKG |
| Ga0208644_12847311 | 3300025889 | Aqueous | RTREEIARDHITRAEVRADLEKIMERFDSGFERLEAKIDALAKKG |
| Ga0208916_104095353 | 3300025896 | Aqueous | LLNRTREEIARDHITRAEVRADLEKIMERFDSGFERLEAKIDALAKKG |
| Ga0209593_100727164 | 3300027743 | Freshwater Sediment | EVQRLGILLNKTREEVARDHITRAEVKADLQAIRDHFDDGFKRLETKIDKLAEQAKG |
| Ga0209990_100166861 | 3300027816 | Freshwater Lake | NILLNKTREEVARDHITRAEVHRDMEKIMERFDAGIGRLETKIDELRREQKGRP |
| Ga0209635_110700143 | 3300027888 | Marine Sediment | VAREHITRKEVDDKVDRIFERFDSGFKRLEAKIDYLAKTQRN |
| Ga0209536_1026499993 | 3300027917 | Marine Sediment | NKTREEVARDHITRAEVRADLDKIREHFDNGFDRLEAKIDALSARR |
| Ga0307380_102805154 | 3300031539 | Soil | SILLNRTREEVARDHITRSEVRQDLDKIREHFDSGFKRLEEKIDALGQRR |
| Ga0307379_105607191 | 3300031565 | Soil | LQRISILLNKTREEVARDHITRAEVRADLDKIREHFDSGFERLEKKIDALAARR |
| Ga0307379_110202673 | 3300031565 | Soil | ISILLNRTREEVARDHITRSEVRQDLDKIREYFDSGFKRLEEKIDALGQRR |
| Ga0307379_114339021 | 3300031565 | Soil | LNRTREEVAREHITRSEVRQDLDKIREYFDSGFKRLEEKIDALGQRR |
| Ga0307378_111537791 | 3300031566 | Soil | QRISILLNKTREEVARDHITRAEVRADLDKIREHFDSGFERLEKKIDALAARR |
| Ga0307376_101882744 | 3300031578 | Soil | HITRAEVRQDLDKIREHFDNGFKRLEDKIDALGKRS |
| Ga0307376_102904884 | 3300031578 | Soil | LNKTREEVARDHITRAEVRADLDKIREHFDSGFERLEKKIDALSARR |
| Ga0307376_104134913 | 3300031578 | Soil | EVAREHITRSEVRQDLDKIREYFDSGFKRLEEKIDALGQRR |
| Ga0307376_105007343 | 3300031578 | Soil | REEVARDHITRAEVRADLDKIREHFDSGFERLEKKIDALAARR |
| Ga0307376_108685881 | 3300031578 | Soil | ARDHITRAEVRADLDKIREHFDSGFDRLEKKIDALAARR |
| Ga0307375_103396441 | 3300031669 | Soil | DELQRISILLNKTREEMARDHITRAEVRADLDKIREHFDSGFERLEKKIDALAARR |
| Ga0307375_103702221 | 3300031669 | Soil | ITRAEVRADLDKIREHFDSGFERLEKKIDALAARR |
| Ga0307375_107671501 | 3300031669 | Soil | NKTREEVARDHITRAEVRADLDKIREHFDSGFDRLEKKIDALAARR |
| Ga0307377_103980891 | 3300031673 | Soil | HITRAEVRADLDKIREHFDSGFDRLEKKIDALAARR |
| Ga0307377_107274771 | 3300031673 | Soil | LNKTREEVARDHITRAEVRADLDKIREHFDSGFERLEKKIDALAARR |
| Ga0307377_108312341 | 3300031673 | Soil | QRISILLNRTREEVARDHITRSEVRQDLDKIREHFDSGFKRLEEKIDALGQRR |
| Ga0315907_101978604 | 3300031758 | Freshwater | NKTREEVARDHITRAEVHRDMEKIMERFDAGIGRLETKIDELRREQKGRP |
| Ga0315900_102762846 | 3300031787 | Freshwater | ITRAEVRADLEKIMERFDSGFERLEAKIDALAKKG |
| Ga0315909_108029122 | 3300031857 | Freshwater | EVAREHITRAEVRQDLDKIREHFDDGFRRLEAKLDALAQRG |
| Ga0315904_105837623 | 3300031951 | Freshwater | ILLNKTREEIARDHITRAEVRADLERIMERFDAGIGRLEAKIDALAERK |
| Ga0315904_106719491 | 3300031951 | Freshwater | IQILLNRTREEIARDHITRAEVRADLEKIMERFDTGFERLESKIDALAKKG |
| Ga0315903_107308121 | 3300032116 | Freshwater | EIARDHITRAEVRADLEKIMERFDTGFERLESKIDALAKKGQ |
| Ga0315903_112165033 | 3300032116 | Freshwater | QILLNRTREEIARDHITRAEVRADLEKIMERFDSGFERLEAKIDALAKKG |
| Ga0334982_0029212_3009_3152 | 3300033981 | Freshwater | NRTREEIARDHITRAEVRADLEKIMERFDSGFERLEAKIDALAKGKQ |
| Ga0334986_0077425_1_132 | 3300034012 | Freshwater | EIARDHITRAEVRADLERIMERFDSGFERLEAKIDALAEKGRQ |
| Ga0310127_249084_1_129 | 3300034072 | Fracking Water | EEVARDHITRAEVRQDLEKIREHFDSGFERLEKKIDALAQRG |
| Ga0310130_0089020_4_147 | 3300034073 | Fracking Water | LNRTREEVARDHITRAEVRQDLEKIREHFDSGFDRLEKKIDSLAQRR |
| Ga0335031_0739113_410_553 | 3300034104 | Freshwater | LNKTREEVARDHITRAEVHRDMEKIMERFDAGINRLEAKIDELGKRN |
| Ga0335053_0383630_2_127 | 3300034118 | Freshwater | IARDHITRAEVRADLERIMERFDSGFERLEAKIDALAEKGR |
| Ga0335053_0387820_714_851 | 3300034118 | Freshwater | TREEIARDHITRAEVRADLEKIMERFDSGFERLEAKIDALAKGKQ |
| Ga0335065_0613655_1_147 | 3300034200 | Freshwater | LLNKTREEIARDHITRAEVRADMEKIIERFDTGFARLEAKIDALAERK |
| Ga0348337_184777_389_535 | 3300034418 | Aqueous | LLNKTREEVARDHITRAEVRQDLEKIREHFDSGFKRLEDKIDDLVKRG |
| ⦗Top⦘ |