Metagenome / Metatranscriptome Family F047871

Basic Information
Family ID	F047871
Family Type	Metagenome / Metatranscriptome
Number of Sequences	149
Average Sequence Length	36 residues
Representative Sequence	MWGYAEGNATVVGIVVVIIGVAAIGYVARRLWRRGR
Number of Associated Samples	133
Number of Associated Scaffolds	149

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	46.98 %
% of genes near scaffold ends (potentially truncated)	10.74 %
% of genes from short scaffolds (< 2000 bps)	81.21 %
Associated GOLD sequencing projects	127
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.54

Most Common Taxonomy
Group	Bacteria (100.000 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (8.725 % of family members)
Environment Ontology (ENVO)	Unclassified (34.899 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (32.886 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 48.44% β-sheet: 0.00% Coil/Unstructured: 51.56%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 149 Family Scaffolds
PF13672	PP2C_2	53.69
PF14332	DUF4388	7.38
PF00483	NTP_transferase	2.68
PF00132	Hexapep	1.34
PF00226	DnaJ	1.34
PF00072	Response_reg	0.67
PF00248	Aldo_ket_red	0.67
PF01575	MaoC_dehydratas	0.67
PF07729	FCD	0.67
PF03795	YCII	0.67
PF00829	Ribosomal_L21p	0.67
PF04343	DUF488	0.67
PF08308	PEGA	0.67
PF07719	TPR_2	0.67
PF03167	UDG	0.67
PF02082	Rrf2	0.67

COG ID	Name	Functional Category	% Frequency in 149 Family Scaffolds
COG2186	DNA-binding transcriptional regulator, FadR family	Transcription [K]	1.34
COG0261	Ribosomal protein L21	Translation, ribosomal structure and biogenesis [J]	0.67
COG0640	DNA-binding transcriptional regulator, ArsR family	Transcription [K]	0.67
COG0692	Uracil-DNA glycosylase	Replication, recombination and repair [L]	0.67
COG1414	DNA-binding transcriptional regulator, IclR family	Transcription [K]	0.67
COG1573	Uracil-DNA glycosylase	Replication, recombination and repair [L]	0.67
COG1725	DNA-binding transcriptional regulator YhcF, GntR family	Transcription [K]	0.67
COG1802	DNA-binding transcriptional regulator, GntR family	Transcription [K]	0.67
COG1959	DNA-binding transcriptional regulator, IscR family	Transcription [K]	0.67
COG2188	DNA-binding transcriptional regulator, GntR family	Transcription [K]	0.67
COG2350	YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.67
COG2378	Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains	Transcription [K]	0.67
COG2524	Predicted transcriptional regulator, contains C-terminal CBS domains	Transcription [K]	0.67
COG3189	Uncharacterized conserved protein YeaO, DUF488 family	Function unknown [S]	0.67
COG3663	G:T/U-mismatch repair DNA glycosylase	Replication, recombination and repair [L]	0.67

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	100.00 %
Unclassified	root	N/A	0.00 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	100.00 %
Unclassified	root	N/A	0.00 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	100.00 %
Unclassified	root	N/A	0.00 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	95.97 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.67 %
Unclassified	root	N/A	0.00 %

Name	Rank	Taxonomy	Distribution
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	93.29 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.67 %
Unclassified	root	N/A	0.00 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	93.29 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.67 %
Unclassified	root	N/A	0.00 %

Name	Rank	Taxonomy	Distribution
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	40.27 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	16.11 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.67 %
Unclassified	root	N/A	0.00 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	40.27 %
Nannocystineae	suborder	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae	12.08 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.67 %
Unclassified	root	N/A	0.00 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	40.27 %
Kofleriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae	12.08 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.67 %
Unclassified	root	N/A	0.00 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	40.27 %
Haliangium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium	12.08 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.67 %
Unclassified	root	N/A	0.00 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	40.27 %
Haliangium ochraceum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	12.08 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.67 %
Unclassified	root	N/A	0.00 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459005\|F1BAP7Q01BQNMW	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	509	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_100615185	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	872	Open in IMG/M
3300000956\|JGI10216J12902_101248183	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	1379	Open in IMG/M
3300001213\|JGIcombinedJ13530_109142259	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	899	Open in IMG/M
3300005543\|Ga0070672_100304354	All Organisms → cellular organisms → Bacteria	1352	Open in IMG/M
3300005548\|Ga0070665_101950990	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	593	Open in IMG/M
3300005617\|Ga0068859_101673806	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	703	Open in IMG/M
3300005718\|Ga0068866_11259421	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	536	Open in IMG/M
3300005764\|Ga0066903_101904287	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1139	Open in IMG/M
3300005843\|Ga0068860_101974145	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	605	Open in IMG/M
3300005844\|Ga0068862_100311468	All Organisms → cellular organisms → Bacteria	1451	Open in IMG/M
3300006028\|Ga0070717_10007030	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	8331	Open in IMG/M
3300006056\|Ga0075163_11547593	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	641	Open in IMG/M
3300006057\|Ga0075026_100053680	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1906	Open in IMG/M
3300006173\|Ga0070716_100362986	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1029	Open in IMG/M
3300006195\|Ga0075366_10406597	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	838	Open in IMG/M
3300006224\|Ga0079037_100484407	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	1185	Open in IMG/M
3300006237\|Ga0097621_100254776	All Organisms → cellular organisms → Bacteria → Proteobacteria	1538	Open in IMG/M
3300006358\|Ga0068871_101435197	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	651	Open in IMG/M
3300006358\|Ga0068871_102197347	All Organisms → cellular organisms → Bacteria	526	Open in IMG/M
3300006854\|Ga0075425_100176009	All Organisms → cellular organisms → Bacteria	2456	Open in IMG/M
3300006854\|Ga0075425_100182748	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	2409	Open in IMG/M
3300006881\|Ga0068865_100051031	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2861	Open in IMG/M
3300007788\|Ga0099795_10254656	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	758	Open in IMG/M
3300009093\|Ga0105240_12544326	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	529	Open in IMG/M
3300009111\|Ga0115026_10629872	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	818	Open in IMG/M
3300009167\|Ga0113563_10372694	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1512	Open in IMG/M
3300009167\|Ga0113563_10530285	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1290	Open in IMG/M
3300009174\|Ga0105241_10142428	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1953	Open in IMG/M
3300009177\|Ga0105248_13274873	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	515	Open in IMG/M
3300009678\|Ga0105252_10342163	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	676	Open in IMG/M
3300009792\|Ga0126374_10654288	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	783	Open in IMG/M
3300009792\|Ga0126374_10868515	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	696	Open in IMG/M
3300009873\|Ga0131077_10001119	All Organisms → cellular organisms → Bacteria → Proteobacteria	70565	Open in IMG/M
3300010044\|Ga0126310_10651344	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	792	Open in IMG/M
3300010046\|Ga0126384_10791876	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	848	Open in IMG/M
3300010047\|Ga0126382_12145244	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	536	Open in IMG/M
3300010166\|Ga0126306_11257696	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	609	Open in IMG/M
3300010166\|Ga0126306_11654561	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	534	Open in IMG/M
3300010337\|Ga0134062_10099114	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1249	Open in IMG/M
3300010360\|Ga0126372_12978809	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	525	Open in IMG/M
3300010362\|Ga0126377_10847137	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	975	Open in IMG/M
3300010362\|Ga0126377_12198831	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	628	Open in IMG/M
3300010362\|Ga0126377_13484753	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	509	Open in IMG/M
3300010398\|Ga0126383_11167340	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	860	Open in IMG/M
3300010398\|Ga0126383_12013890	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	665	Open in IMG/M
3300010399\|Ga0134127_10187068	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1915	Open in IMG/M
3300010399\|Ga0134127_11583399	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	729	Open in IMG/M
3300010399\|Ga0134127_11820523	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	685	Open in IMG/M
3300010400\|Ga0134122_11537885	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	686	Open in IMG/M
3300010867\|Ga0126347_1017552	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1174	Open in IMG/M
3300011427\|Ga0137448_1085177	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	841	Open in IMG/M
3300011431\|Ga0137438_1006603	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	3238	Open in IMG/M
3300011436\|Ga0137458_1282690	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	506	Open in IMG/M
3300012094\|Ga0136638_10531565	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	561	Open in IMG/M
3300012146\|Ga0137322_1023999	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	850	Open in IMG/M
3300012909\|Ga0157290_10015727	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1568	Open in IMG/M
3300012911\|Ga0157301_10301480	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	585	Open in IMG/M
3300012929\|Ga0137404_12179384	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	518	Open in IMG/M
3300012930\|Ga0137407_11728072	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	596	Open in IMG/M
3300012964\|Ga0153916_10093056	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2837	Open in IMG/M
3300013297\|Ga0157378_10120655	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2416	Open in IMG/M
3300014166\|Ga0134079_10301596	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	712	Open in IMG/M
3300014325\|Ga0163163_12743956	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	549	Open in IMG/M
3300014502\|Ga0182021_11168513	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	927	Open in IMG/M
3300014968\|Ga0157379_12663197	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	501	Open in IMG/M
3300015054\|Ga0137420_1472233	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1861	Open in IMG/M
3300015163\|Ga0167665_1069624	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	628	Open in IMG/M
3300015200\|Ga0173480_10655349	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	652	Open in IMG/M
3300015371\|Ga0132258_13164789	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	1136	Open in IMG/M
3300017993\|Ga0187823_10353410	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	524	Open in IMG/M
3300018083\|Ga0184628_10254171	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	923	Open in IMG/M
3300018465\|Ga0190269_10334097	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	902	Open in IMG/M
3300018476\|Ga0190274_10592335	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1133	Open in IMG/M
3300018920\|Ga0190273_10716943	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	778	Open in IMG/M
3300018920\|Ga0190273_12016133	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	535	Open in IMG/M
3300019874\|Ga0193744_1000268	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	12881	Open in IMG/M
3300019874\|Ga0193744_1008995	All Organisms → cellular organisms → Bacteria → Proteobacteria	1821	Open in IMG/M
3300021057\|Ga0196981_1036628	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	739	Open in IMG/M
3300021403\|Ga0210397_11149041	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	603	Open in IMG/M
3300021445\|Ga0182009_10035716	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2022	Open in IMG/M
3300022886\|Ga0247746_1011110	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1857	Open in IMG/M
3300022915\|Ga0247790_10000042	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	71433	Open in IMG/M
3300022936\|Ga0247806_10303890	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	651	Open in IMG/M
3300023094\|Ga0247741_1002080	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	11160	Open in IMG/M
3300023095\|Ga0247736_10288134	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	547	Open in IMG/M
3300023211\|Ga0255842_1348146	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	3638	Open in IMG/M
3300024055\|Ga0247794_10020817	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1627	Open in IMG/M
3300025318\|Ga0209519_10569168	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	628	Open in IMG/M
3300025899\|Ga0207642_10098144	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1464	Open in IMG/M
3300025901\|Ga0207688_10801055	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	597	Open in IMG/M
3300025909\|Ga0207705_11116843	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	607	Open in IMG/M
3300025911\|Ga0207654_10872923	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	652	Open in IMG/M
3300025912\|Ga0207707_10566741	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	964	Open in IMG/M
3300025912\|Ga0207707_11368146	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	566	Open in IMG/M
3300025918\|Ga0207662_10063181	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2226	Open in IMG/M
3300025923\|Ga0207681_10708755	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	837	Open in IMG/M
3300025929\|Ga0207664_11957378	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	509	Open in IMG/M
3300025934\|Ga0207686_11248633	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	609	Open in IMG/M
3300025935\|Ga0207709_10486620	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	960	Open in IMG/M
3300025936\|Ga0207670_10071822	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	2395	Open in IMG/M
3300025936\|Ga0207670_10889636	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	745	Open in IMG/M
3300025938\|Ga0207704_10941594	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	728	Open in IMG/M
3300025942\|Ga0207689_10342632	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1242	Open in IMG/M
3300026095\|Ga0207676_10180945	All Organisms → cellular organisms → Bacteria → Proteobacteria	1846	Open in IMG/M
3300026983\|Ga0207856_1003367	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	3312	Open in IMG/M
3300027886\|Ga0209486_10816618	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	611	Open in IMG/M
3300027890\|Ga0209496_10165396	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1024	Open in IMG/M
3300027900\|Ga0209253_10160717	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1814	Open in IMG/M
3300028380\|Ga0268265_12022149	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	583	Open in IMG/M
3300028381\|Ga0268264_12215174	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	557	Open in IMG/M
3300028732\|Ga0302264_1000414	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	11453	Open in IMG/M
3300028870\|Ga0302254_10050877	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1492	Open in IMG/M
3300029989\|Ga0311365_10093703	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2565	Open in IMG/M
3300030294\|Ga0311349_10864842	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	850	Open in IMG/M
3300030613\|Ga0299915_10000027	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	105280	Open in IMG/M
3300031184\|Ga0307499_10137634	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	705	Open in IMG/M
3300031232\|Ga0302323_100102787	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2757	Open in IMG/M
3300031238\|Ga0265332_10039996	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2030	Open in IMG/M
3300031456\|Ga0307513_10030675	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	6103	Open in IMG/M
3300031507\|Ga0307509_10880706	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	560	Open in IMG/M
3300031616\|Ga0307508_10526036	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	779	Open in IMG/M
3300031616\|Ga0307508_10616117	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	688	Open in IMG/M
3300031708\|Ga0310686_110230050	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1164	Open in IMG/M
3300031715\|Ga0307476_10025011	All Organisms → cellular organisms → Bacteria	3918	Open in IMG/M
3300031730\|Ga0307516_10013671	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	8626	Open in IMG/M
3300031730\|Ga0307516_10349081	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1145	Open in IMG/M
3300031731\|Ga0307405_10897836	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	749	Open in IMG/M
3300031912\|Ga0306921_11625918	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	701	Open in IMG/M
3300031918\|Ga0311367_10263457	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1793	Open in IMG/M
3300031938\|Ga0308175_100000761	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	21443	Open in IMG/M
3300031949\|Ga0214473_10335027	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	1720	Open in IMG/M
3300032002\|Ga0307416_102827631	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	581	Open in IMG/M
3300032126\|Ga0307415_100395313	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1178	Open in IMG/M
3300032144\|Ga0315910_11264153	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	576	Open in IMG/M
3300032180\|Ga0307471_100367222	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1556	Open in IMG/M
3300032205\|Ga0307472_100777442	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	872	Open in IMG/M
3300032955\|Ga0335076_11122580	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	669	Open in IMG/M
3300033408\|Ga0316605_10022747	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	4029	Open in IMG/M
3300033419\|Ga0316601_100806543	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	928	Open in IMG/M
3300033433\|Ga0326726_10961410	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	829	Open in IMG/M
3300033480\|Ga0316620_10030446	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	3414	Open in IMG/M
3300033486\|Ga0316624_10749524	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	864	Open in IMG/M
3300033502\|Ga0326731_1080711	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	751	Open in IMG/M
3300033557\|Ga0316617_102834673	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	505	Open in IMG/M
3300034157\|Ga0370506_035238	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1039	Open in IMG/M
3300034158\|Ga0370507_0241700	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	593	Open in IMG/M
3300034194\|Ga0370499_0078855	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	805	Open in IMG/M
3300034268\|Ga0372943_0003089	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	8310	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	69.80%
Host-Associated	Host-Associated	28.19%
Engineered	Engineered	2.01%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	58.39%
Plants	Host-Associated → Plants	28.19%
Aquatic	Environmental → Aquatic	11.41%
Wastewater	Engineered → Wastewater	2.01%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	51.01%
Rhizosphere	Host-Associated → Plants → Rhizosphere	12.08%
Rhizoplane	Host-Associated → Plants → Rhizoplane	8.72%
Roots	Host-Associated → Plants → Roots	7.38%
Freshwater	Environmental → Aquatic → Freshwater	6.04%
Peat	Environmental → Terrestrial → Peat	5.37%
Sediment	Environmental → Aquatic → Sediment	4.70%
Plant Litter	Environmental → Terrestrial → Plant Litter	2.01%
Activated Sludge	Engineered → Wastewater → Activated Sludge	1.34%
Marine	Environmental → Aquatic → Marine	0.67%
Nutrient Removal	Engineered → Wastewater → Nutrient Removal	0.67%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	36.91%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	8.72%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	8.05%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	6.71%
Loam	Environmental → Terrestrial → Soil → Loam	6.71%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	5.37%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	4.70%
Unclassified	Host-Associated → Plants → Roots → Unclassified	4.03%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	3.36%
Soil	Host-Associated → Plants → Rhizosphere → Soil	3.36%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	2.68%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified	2.01%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.34%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	1.34%
Lentic	Environmental → Aquatic → Freshwater → Lentic	0.67%
Ice	Environmental → Aquatic → Freshwater → Ice	0.67%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.67%
Sand	Environmental → Terrestrial → Soil → Sand	0.67%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.67%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	0.67%
Unclassified	Engineered → Wastewater → Nutrient Removal → Unclassified	0.67%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	26.85%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	8.72%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	8.05%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	6.04%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.37%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	5.37%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	4.70%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	4.03%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	4.03%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	3.36%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	2.68%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.68%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	2.68%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	2.01%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified	2.01%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.34%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.34%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	1.34%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	0.67%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.67%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.67%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	0.67%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.67%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	0.67%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.67%
Desert	Environmental → Terrestrial → Soil → Sand → Desert	0.67%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.67%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	0.67%
Unclassified	Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified	0.67%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	8.72%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	6.71%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	4.03%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	4.03%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	4.03%
Ectomycorrhiza	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza	4.03%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	3.36%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	3.36%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	2.68%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.68%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	2.01%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	2.01%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.01%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.01%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	2.01%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	2.01%
Plant Litter	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter	2.01%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	2.01%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	2.01%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.01%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	1.34%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.34%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.34%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	1.34%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.34%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.34%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.34%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.34%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	1.34%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.34%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.34%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.34%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	0.67%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.67%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.67%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	0.67%
Wetland	Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland	0.67%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.67%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.67%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.67%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.67%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.67%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.67%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.67%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	0.67%
Fen	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen	0.67%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.67%
Soil	Environmental → Terrestrial → Soil → Sand → Desert → Soil	0.67%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.67%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.67%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	0.67%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.67%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.67%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.67%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.67%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.67%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.67%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.67%
Wastewater	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater	0.67%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	0.67%
Wastewater Effluent	Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent	0.67%
Boreal Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil	0.67%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459005	Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm	Environmental	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300001213	Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)	Environmental	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006056	Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNA	Engineered	Open in IMG/M
3300006057	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006195	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Host-Associated	Open in IMG/M
3300006224	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Environmental	Open in IMG/M
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated	Open in IMG/M
3300009111	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1	Environmental	Open in IMG/M
3300009167	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)	Environmental	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009678	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100	Environmental	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300009873	Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant	Engineered	Open in IMG/M
3300010044	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010166	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27	Environmental	Open in IMG/M
3300010337	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010867	Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300011427	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2	Environmental	Open in IMG/M
3300011431	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2	Environmental	Open in IMG/M
3300011436	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2	Environmental	Open in IMG/M
3300012094	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ858 (22.06)	Environmental	Open in IMG/M
3300012146	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT400_2	Environmental	Open in IMG/M
3300012909	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1	Environmental	Open in IMG/M
3300012911	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012964	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014166	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014502	Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015054	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300015163	Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb1b, glacier snout)	Environmental	Open in IMG/M
3300015200	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300017993	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3	Environmental	Open in IMG/M
3300018083	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1	Environmental	Open in IMG/M
3300018465	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300018920	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS	Environmental	Open in IMG/M
3300019874	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a1	Environmental	Open in IMG/M
3300021057	Soil microbial communities from Anza Borrego desert, Southern California, United States - S3_20-13C	Environmental	Open in IMG/M
3300021403	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O	Environmental	Open in IMG/M
3300021445	Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG	Environmental	Open in IMG/M
3300022886	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5	Environmental	Open in IMG/M
3300022915	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4	Environmental	Open in IMG/M
3300022936	Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L059-202B-1	Environmental	Open in IMG/M
3300023094	Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L213-509R-2	Environmental	Open in IMG/M
3300023095	Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L193-509B-2	Environmental	Open in IMG/M
3300023211	Activated sludge enriched bacterial communities from WWTP in Fort Collins, Colorado, USA ? CA	Engineered	Open in IMG/M
3300024055	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6	Environmental	Open in IMG/M
3300025318	Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)	Host-Associated	Open in IMG/M
3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026983	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 21 (SPAdes)	Environmental	Open in IMG/M
3300027886	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)	Environmental	Open in IMG/M
3300027890	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)	Environmental	Open in IMG/M
3300027900	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)	Environmental	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028732	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_4	Environmental	Open in IMG/M
3300028870	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4	Environmental	Open in IMG/M
3300029989	III_Fen_N1 coassembly	Environmental	Open in IMG/M
3300030294	II_Fen_E3 coassembly	Environmental	Open in IMG/M
3300030613	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227	Environmental	Open in IMG/M
3300031184	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S	Environmental	Open in IMG/M
3300031232	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3	Environmental	Open in IMG/M
3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Host-Associated	Open in IMG/M
3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Host-Associated	Open in IMG/M
3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Host-Associated	Open in IMG/M
3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Host-Associated	Open in IMG/M
3300031708	FICUS49499 Metagenome Czech Republic combined assembly	Environmental	Open in IMG/M
3300031715	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05	Environmental	Open in IMG/M
3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Host-Associated	Open in IMG/M
3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Host-Associated	Open in IMG/M
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental	Open in IMG/M
3300031918	III_Fen_N3 coassembly	Environmental	Open in IMG/M
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental	Open in IMG/M
3300031949	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197	Environmental	Open in IMG/M
3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Host-Associated	Open in IMG/M
3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Host-Associated	Open in IMG/M
3300032144	Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032955	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5	Environmental	Open in IMG/M
3300033408	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT	Environmental	Open in IMG/M
3300033419	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300033480	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B	Environmental	Open in IMG/M
3300033486	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A	Environmental	Open in IMG/M
3300033502	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF9FY SIP fraction	Environmental	Open in IMG/M
3300033557	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B	Environmental	Open in IMG/M
3300034157	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_18	Environmental	Open in IMG/M
3300034158	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_18	Environmental	Open in IMG/M
3300034194	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_17	Environmental	Open in IMG/M
3300034268	Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.54
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.54
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F047871

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
E41_11286920	2170459005	Grass Soil	VATVATAWWGYAVGNPTVVGIVVAVIAVAAVAFVARRLWRR
INPhiseqgaiiFebDRAFT_1006151852	3300000364	Soil	MWGYAEGNPTMVGIVVVLIGAAALGYVARRLWRRGR*
JGI10216J12902_1012481832	3300000956	Soil	MWGYAEGNKTVVAIVVLIIAIAAIAFIARKFWRRR*
JGIcombinedJ13530_1091422592	3300001213	Wetland	MWGYAEGNATLVGIVVVIVAVAAVGYVGKRLLGRGR*
Ga0070672_1003043542	3300005543	Miscanthus Rhizosphere	MWGYAEGNATVVGIVVVLVGAAAVAYVARRLWRRGR*
Ga0070665_1019509901	3300005548	Switchgrass Rhizosphere	MWGYAEGNATVVGIVVVIIGIAAIGYVARRLWRRGR*
Ga0068859_1016738061	3300005617	Switchgrass Rhizosphere	MWGYAEGNVTVVGIVVAIIGVAAIAYVARRLWRRGR*
Ga0068866_112594212	3300005718	Miscanthus Rhizosphere	MWGYAQGNATIVGIVVVIIGAAAIGYVVRRLWRRGR*
Ga0066903_1019042872	3300005764	Tropical Forest Soil	MWGYAEGNKTLVAIVVVAVVVAAVAFVARRLWRRRR*
Ga0068860_1019741452	3300005843	Switchgrass Rhizosphere	MWGYAEGNATLVGIVVVIIAAAAIGYVARRLWRRGR*
Ga0068862_1003114682	3300005844	Switchgrass Rhizosphere	MWGYAEGNTTMVGIIVVLIGGAAIGYVARRLWRRGP*
Ga0070717_100070309	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MWGYAEGNATVVGIVVVIIGAAAVGYVARRLWRRGR*
Ga0075163_115475932	3300006056	Wastewater Effluent	MWGYAEGNQTLVTIVVVIVVIAALGYVGRRLWKRER*
Ga0075026_1000536803	3300006057	Watersheds	MWGYAEGNQTLVTIVVVIVVAAALAYVVRRFIKKGR*
Ga0070716_1003629862	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MWGYAEGNATVVGIVVVIIGAAAIGYVVRRLWRRGR*
Ga0075366_104065972	3300006195	Populus Endosphere	MWGYAEGNATVVGIVVVIIAGAAIGYVARRLWRRGR*
Ga0079037_1004844072	3300006224	Freshwater Wetlands	MWGYAEGDATLVGIVVVIVAIAAVAYVGRALWRRR*
Ga0097621_1002547762	3300006237	Miscanthus Rhizosphere	MWGYAEANKTMVAIVVGLVVAAAVAYVARRWWRR*
Ga0068871_1014351972	3300006358	Miscanthus Rhizosphere	MWGYAEGNPTAVGFVVVIVTIAAIAFVARRLWRKGR*
Ga0068871_1021973472	3300006358	Miscanthus Rhizosphere	LSGMWGYAEGNKTLVAIVVVVVVAAAIAFVARRLWRRGR*
Ga0075425_1001760092	3300006854	Populus Rhizosphere	MWGYAEGNVTVVGIVVVIIGVAAIAYVARRLWRRGR*
Ga0075425_1001827484	3300006854	Populus Rhizosphere	MWGYAEGNTTVVAVVVALIVIAAIAYVTRKLWRRRGR*
Ga0068865_1000510312	3300006881	Miscanthus Rhizosphere	MWGYAEANPTLVGLVVVVVAIAAIAFVTRRLLRRGR*
Ga0099795_102546562	3300007788	Vadose Zone Soil	MWGYAQGNATIVGVVVVIIGAAAIGYVVRRLWRGGR*
Ga0105240_125443262	3300009093	Corn Rhizosphere	MWGYAEGNTTMVGIVVVLIGAAAIGYVARRLWRRGR*
Ga0115026_106298722	3300009111	Wetland	MWGYAEGNATLVGIVVVVVVVAAATYVGRQLWRGRR*
Ga0113563_103726943	3300009167	Freshwater Wetlands	MWGYAEGNKTVVAIVVVVIAVAALAYVARRFWRR*
Ga0113563_105302852	3300009167	Freshwater Wetlands	MWGYAEGNKTLVAVVVVLIAIAAIAYVARRLLGKR*
Ga0105241_101424282	3300009174	Corn Rhizosphere	MWGYAQGNATVVGIVVVIIGLAAVGYVGRRLWRGR*
Ga0105248_132748732	3300009177	Switchgrass Rhizosphere	MWGYAQGNATIVGIVVVIIGAAAIGYVARRLWRRGR*
Ga0105252_103421631	3300009678	Soil	MWGYAEGNKTVVAIAVVLVAVAALAFLGRKFWRRGR*
Ga0126374_106542882	3300009792	Tropical Forest Soil	MWGYAQGNATIVGIVVVIIGAAAIGYVVRRLWRKGR*
Ga0126374_108685152	3300009792	Tropical Forest Soil	ESMWGYAQGNATIVGIIVVIVGAAAIGYVVRRLWRRGR*
Ga0131077_1000111952	3300009873	Wastewater	MWGYAEGNETLVAIVVIVVLVAAIAYLARRYVNRGQ*
Ga0126310_106513442	3300010044	Serpentine Soil	MWGYAEGNATVIGIVVVLIGVAAIGYVVRRLWRLWRRGR*
Ga0126384_107918762	3300010046	Tropical Forest Soil	MWGYAEGNATVVGIVVVIVGAAAIGYVVRRLWRRGR*
Ga0126382_121452442	3300010047	Tropical Forest Soil	MWGYAEGNATIVGIVVVIIGAAAIGYVVRRLLRRGR*
Ga0126306_112576962	3300010166	Serpentine Soil	MWGYAEGNKTVVAIVVVAVLIAAIAYITRNFWRRR*
Ga0126306_116545612	3300010166	Serpentine Soil	MWGYAEGNKTVVAIVVLIVAVAAIAFIARKFWRRR*
Ga0134062_100991142	3300010337	Grasslands Soil	MWGYAEGNATIVAIVVVIIGAAAIGYVARRLWRRGR*
Ga0126372_129788092	3300010360	Tropical Forest Soil	MWGYAEGNATVVGIVVVIIGVAAIGYVARRLWRRGR*
Ga0126377_108471372	3300010362	Tropical Forest Soil	MWGYAEGNTTVVAVVVAIIAIAAIVYVTRGLWRRRGR*
Ga0126377_121988311	3300010362	Tropical Forest Soil	PTDRPSILWSMWGYAEGNATIVGIVVVVIAIAAIGYVVRRLWRRGR*
Ga0126377_134847532	3300010362	Tropical Forest Soil	MWGYAEGNKTLVAIVVVVVVAAAIAFVARRLWRRRR*
Ga0126383_111673401	3300010398	Tropical Forest Soil	MWGYAEGNATVVGIVVVIIAAAAIGYIARRLWRRGR*
Ga0126383_120138902	3300010398	Tropical Forest Soil	MWGYAQGNATIVGIVVVIIGVAAIGYVVRRLWRRGR*
Ga0134127_101870681	3300010399	Terrestrial Soil	MWGYAEGNVTVVGIVVVIIGVAAVAYIARRLWRRGR*
Ga0134127_115833992	3300010399	Terrestrial Soil	MWGYAEGNATIVGIVVVVIGIAAIGYVVRRLWRRGR*
Ga0134127_118205232	3300010399	Terrestrial Soil	MHGLGVGWWGYAEGNPILVGIVVAIIVIAAIAYVARRLWRR
Ga0134122_115378851	3300010400	Terrestrial Soil	MWGYAQGNATVVGIVVVVIGAAAVIYVARRLWRRGR*
Ga0126347_10175522	3300010867	Boreal Forest Soil	MWGYAEGNATVVGIVVALIGGAAVAYVARRLWRRGS*
Ga0137448_10851772	3300011427	Soil	MWGYAEGNPTVVGIVVVIIGAAAIGYVARRLWRRGR*
Ga0137438_10066034	3300011431	Soil	MWGYAEGNPTIVGIVVVIIGLAAVGYVVRRLWRRGR*
Ga0137458_12826902	3300011436	Soil	WGYAEGNKTVVAIVVVLVAVAALAFLGRKFWRRGR*
Ga0136638_105315652	3300012094	Polar Desert Sand	MWGYAEGNATLVGIVVVVIALAAIGYVVMGVLRRGR*
Ga0137322_10239992	3300012146	Soil	MWGYAEGNKTVVAIVVVLVAVAALAFLGRKFWRRGR*
Ga0157290_100157273	3300012909	Soil	MWGYAEGNKTVVAIVVALVVVAALAFLARKLWRRGR*
Ga0157301_103014802	3300012911	Soil	MWGYAEGNKTVVAVVVALVAIAAVAFFARKLWRRG
Ga0137404_121793842	3300012929	Vadose Zone Soil	MWGYAEGNATVVGIVVVTVGIAAIAYVARRLLGRGK*
Ga0137407_117280722	3300012930	Vadose Zone Soil	MWGYAEGNATAVGIVVAIIGAAAIGYVIRRLWRRGR*
Ga0153916_100930562	3300012964	Freshwater Wetlands	MWGYAEGNATLVGIVVVVIVVAAAAYVGRQLWRGRR*
Ga0157378_101206552	3300013297	Miscanthus Rhizosphere	MWGYAEGNATVVGIVVVLIAAAAIGYVVRRLWRRGG*
Ga0134079_103015961	3300014166	Grasslands Soil	MWGYAEGNETLVTIVVIVVVVAALAYLARRFVNRG
Ga0163163_127439561	3300014325	Switchgrass Rhizosphere	MWGYAEGNTTMVGIIVVLIGGAAVGYVARRLWRRGP*
Ga0182021_111685131	3300014502	Fen	MWGYAEGNPTLVGIVVILITGAAIGYVARRLWKRGR*
Ga0157379_126631972	3300014968	Switchgrass Rhizosphere	MWGYAEGNATIVGIVVVIIGAAAIGYVVRQLWRRSR*
Ga0137420_14722332	3300015054	Vadose Zone Soil	MWGYAEGNATVVGIVVAIIATAAIGYVVRRLWRRGR*
Ga0167665_10696242	3300015163	Glacier Forefield Soil	VWGYAEGNQTLVTIVVVIVVIAALGYVARRLIKRGR*
Ga0173480_106553492	3300015200	Soil	MWGYAEGNKTAVAIVVVIVVIAAIAYLANRFWKGRR*
Ga0132258_131647892	3300015371	Arabidopsis Rhizosphere	MWGYAEGNETLVAIVVILVVVAAVAYLGRRFLRRGR*
Ga0187823_103534102	3300017993	Freshwater Sediment	MWGYAQGNATIVGIVVVIIGAAAIGYVVRRLWRRGR
Ga0184628_102541712	3300018083	Groundwater Sediment	MWGYAEGNATVVGIVVVVIGVAAIGYVVRRLWRRGR
Ga0190269_103340972	3300018465	Soil	MWGYAEGNETLVAIVVIVVLVAAVAYLARRFVNRGR
Ga0190274_105923352	3300018476	Soil	MWGYAEGNKTVVAIVVVIIVIAALAYIGNRFWKGRR
Ga0190273_107169432	3300018920	Soil	MWGYAEGNKTMVAVVVVIIVVAAIAYLARRFWRGR
Ga0190273_120161331	3300018920	Soil	MWGYAEGNGTLVGIVVVLVAIAAIAYVARRILRRRG
Ga0193744_10002683	3300019874	Soil	MWGYAEGNATVVGIVVVIIAAAAIGYVVRRLWRRGR
Ga0193744_10089952	3300019874	Soil	MWGYAEGNATVVGIVVVIIGVAAIGYVARRLWRRGP
Ga0196981_10366281	3300021057	Soil	MWGYAEGNETLVAIVVIAVLVGALVYLANRFANRGR
Ga0210397_111490412	3300021403	Soil	MWGYAEGNPTAVGLVVVIVSIAAVVFVGRRLWRRGR
Ga0182009_100357163	3300021445	Soil	MWGYAQGNATIVGIVVVIIGAAAIGYVVRRLVRRGR
Ga0247746_10111102	3300022886	Soil	MWGYAEGNKTVVAIVVAIVAVAAVAFLARKLWRRGR
Ga0247790_1000004229	3300022915	Soil	MWGYAEGNKTVVAIVVALVVVAAVAFFARKLWRRGR
Ga0247806_103038902	3300022936	Plant Litter	MWGYAEGNATLVGIVVVVIALAAIAYVAMRVFGRGR
Ga0247741_10020802	3300023094	Plant Litter	MWGYAEGNRTLVTIVVVIVVIAALGYVGRRIWKRGR
Ga0247736_102881342	3300023095	Plant Litter	MWGYAEGNATLVGIVVVVITIAAIAYVALRVLRRRG
Ga0255842_13481466	3300023211	Activated Sludge	MWGYAEGNQTLVTIVVVIVVIAALSYVGRRLWKRER
Ga0247794_100208172	3300024055	Soil	MWGYAQGNATIVGIVVVIIGAAAIGYVARRLWRRGR
Ga0209519_105691681	3300025318	Soil	MWGYAEGNETALTIVVVLIVLAALAYVFRRYLGGR
Ga0207642_100981442	3300025899	Miscanthus Rhizosphere	MWGYAEGNATVVGIVVVLVGAAAVAYVARRLWRRGR
Ga0207688_108010551	3300025901	Corn, Switchgrass And Miscanthus Rhizosphere	MWGYAEGNVTVVGIVVVIIGVAAIAYVARRLWRRGR
Ga0207705_111168432	3300025909	Corn Rhizosphere	MWGYAEGNATVVGIVVVIIGIAAIGYVARRLWRRGR
Ga0207654_108729232	3300025911	Corn Rhizosphere	MWGYAQGNATVVGIVVVIIGLAAVGYVGRRLWRGR
Ga0207707_105667412	3300025912	Corn Rhizosphere	MWGYAEGNATIVGIVVAIIGAAAIGYVVRRLWRRSR
Ga0207707_113681461	3300025912	Corn Rhizosphere	PAGLPSFWESMWGYAQGNATIVGIVVVIIAVAAIGYVARRLWRRGR
Ga0207662_100631814	3300025918	Switchgrass Rhizosphere	MWGYAEGNATLVGIVVVIIAAAAIGYVARRLWRRGR
Ga0207681_107087551	3300025923	Switchgrass Rhizosphere	MWGYAEGNKTVVAIVVAIVAIAAVAFLARKLWRRG
Ga0207664_119573782	3300025929	Agricultural Soil	MHPDRAVALWGYAEANPTLVGIVVVIVALAAVAYVARRLWRR
Ga0207686_112486331	3300025934	Miscanthus Rhizosphere	FSKESAMWGYAEGNATVVGIVVVLVGAAAVAYVARRLWRRGR
Ga0207709_104866201	3300025935	Miscanthus Rhizosphere	SAMWGYAEGNATVVGIVVVLVGAAAVAYVARRLWRRGR
Ga0207670_100718224	3300025936	Switchgrass Rhizosphere	MWGYAEGNTTVVAVVVALIVIAAIAYVTRRLWRRRGR
Ga0207670_108896362	3300025936	Switchgrass Rhizosphere	MWGYAEGNKTVVAIVVAIVAIAAVAFLARKLWRRGR
Ga0207704_109415942	3300025938	Miscanthus Rhizosphere	MWGYAEANPTLVGLVVVVVAIAAIAFVTRRLLRRGR
Ga0207689_103426322	3300025942	Miscanthus Rhizosphere	MWGYAEGNATVVGIVVAIIAAAAIGYVVRRLVRRGR
Ga0207676_101809453	3300026095	Switchgrass Rhizosphere	MWGYAEGNATVVGIVVVIIAGAAIGYVVRRLWRRGR
Ga0207856_10033672	3300026983	Tropical Forest Soil	MWGYAETNKTAVAIVVVLVLVAALAFLGRKLWRRGR
Ga0209486_108166182	3300027886	Agricultural Soil	MWGYAEGNTTAVAVVVIVVAIAAVAYLTRKLWRRGP
Ga0209496_101653962	3300027890	Wetland	MWGYAEGDATLVGIVVVIVAIAAVAYVGRALWRRR
Ga0209253_101607172	3300027900	Freshwater Lake Sediment	MWGYAEGNQTLVTIVVVIVVIAAVGYVARRLLGKGR
Ga0268265_120221492	3300028380	Switchgrass Rhizosphere	MWGYAEGNKTVVAIVVAVVAIAAVAFLARKLWRRGR
Ga0268264_122151741	3300028381	Switchgrass Rhizosphere	ESMWGYAEGNATVVGIVVVIIGIAAIGYVARRLWRRGR
Ga0302264_10004142	3300028732	Fen	MWGYAEGNATVVGIVVVLVAVAAIGYVARRLWRRGS
Ga0302254_100508773	3300028870	Fen	MWGYAEGNATVVGIVVVLIAAAAIGYVVRRLWRRGG
Ga0311365_100937034	3300029989	Fen	MWGYAEGNATVVGVVVVVIAAAALGYVIRRLWRRGG
Ga0311349_108648422	3300030294	Fen	MWGYAEGNPTLVGIVVIIIAVAAVGYVARRLWKRER
Ga0299915_1000002724	3300030613	Soil	MWGYAEGNETALLIVVVIVAIAALAYVFRRYLGGK
Ga0307499_101376342	3300031184	Soil	MWGYAEGNKTVVAIVVALVAIAAVAFLARKLWTRRR
Ga0302323_1001027874	3300031232	Fen	MWGYAEGNATVLGIVVVVIAAAAVGYVTRRLWRRGP
Ga0265332_100399961	3300031238	Rhizosphere	MWGYAQGNATVVGIVVVIIGAAAIGYVARRLWRRGR
Ga0307513_100306756	3300031456	Ectomycorrhiza	MWGYAEGNATAVGIVAAIIALAAVAFVARRLWRRGR
Ga0307509_108807061	3300031507	Ectomycorrhiza	MWGYAEGNATVVGIVVAVIAAAAIGYVARRLWRRGR
Ga0307508_105260362	3300031616	Ectomycorrhiza	MWGYAEGNATVVGIVVAIIAAAAIAYVARRLWRRGR
Ga0307508_106161172	3300031616	Ectomycorrhiza	MWGYAEGNATVVGIVVVLICVAAVAYVGRRFWRRGG
Ga0310686_1102300502	3300031708	Soil	VALWSYAEGNSTVLAIVVLVIAMTALAYVARRLWRK
Ga0307476_100250112	3300031715	Hardwood Forest Soil	MWGYAQGNATIVGIVVVIIAAAAIGYVVRRLWRRGR
Ga0307516_100136716	3300031730	Ectomycorrhiza	MWGYAEGNATVVGIVVVLIAVAALGYVVRRLWRRGS
Ga0307516_103490812	3300031730	Ectomycorrhiza	MWGYAEGNATVVGVVVVVIAAAAVGYVIRRLWRRGG
Ga0307405_108978362	3300031731	Rhizosphere	MWGYAEGNRTVVAIVVAIVAIAAVAFLAGKLWRRRR
Ga0306921_116259182	3300031912	Soil	MWGYAQGNATMLGIVVAIIGVAAVAYVGRRLWRGR
Ga0311367_102634572	3300031918	Fen	MWGYAEGNPTLVGIVVIIIAVAAVAYVARRLWKRER
Ga0308175_10000076112	3300031938	Soil	MWGYAEGNTTMVGIVVALIGGAAIGYLARRLWRRGR
Ga0214473_103350272	3300031949	Soil	MWGYAEGNKTVVAIVVVLVAVAALAFLGRKFWRRGR
Ga0307416_1028276312	3300032002	Rhizosphere	MWGYAEGNETALTIVVTVIVVAAIAYVFRRYLGGR
Ga0307415_1003953132	3300032126	Rhizosphere	MWGYAEGNKTVVAIVVAIIAVAAVAFLARKLWRRGR
Ga0315910_112641531	3300032144	Soil	MWGYAEGNQTAITIVVGVIVVAAIAYVLRRYLGGK
Ga0307471_1003672223	3300032180	Hardwood Forest Soil	MWGYAQGNATIVGIVVVFIGGAAVAYVVRRLWRRGR
Ga0307472_1007774422	3300032205	Hardwood Forest Soil	GPSILGRMWGYAEGNTTMVGIVVVLIGGAAIGYVVRRLWRRGR
Ga0335076_111225801	3300032955	Soil	MWGYAEGNPFVVGCVVFILTVAAIAWVGRRWLRRG
Ga0316605_100227475	3300033408	Soil	MWGYAEGNKTLVAVVVVLIAIAAIAYVARRLLGKR
Ga0316601_1008065432	3300033419	Soil	MWGYAEANKTVVAIVVALVAVAALAFVVRKLWRRER
Ga0326726_109614102	3300033433	Peat Soil	MWGYAEGNQTLVGIVVAIVLIAALAYVVRRFVRRGR
Ga0316620_100304464	3300033480	Soil	MWGYAEGNATLVGIVVVVVVVAAATYVGRQLWRGRR
Ga0316624_107495242	3300033486	Soil	MHGLGVGWWGYAEGNPTLVGIVVAIVVIAAIAYVARRLWRR
Ga0326731_10807112	3300033502	Peat Soil	MWGYAEGNATLVGIVVVVVVVAAAAYVGRQLWRGRR
Ga0316617_1028346732	3300033557	Soil	MWGYAEGNATLIGIVVAIVALAAIGYVARRLWRRGG
Ga0370506_035238_316_426	3300034157	Untreated Peat Soil	MWGYAEGNQTLVAIVVVIVVIAALGYVGRRLWKKGR
Ga0370507_0241700_372_491	3300034158	Untreated Peat Soil	MWGYAEGNATLVGIVVFIVAVAAIGYVGMRVFRRGRRGP
Ga0370499_0078855_237_347	3300034194	Untreated Peat Soil	MWGYAEGDATLVGIVVAIVLIAAVAYVGRALWRRRQ
Ga0372943_0003089_6460_6570	3300034268	Soil	MWGYAEGNTTIVGIVVVVIVAAALGYVARRLWRRGR

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign