| Basic Information | |
|---|---|
| Family ID | F047871 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 149 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MWGYAEGNATVVGIVVVIIGVAAIGYVARRLWRRGR |
| Number of Associated Samples | 133 |
| Number of Associated Scaffolds | 149 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 46.98 % |
| % of genes near scaffold ends (potentially truncated) | 10.74 % |
| % of genes from short scaffolds (< 2000 bps) | 81.21 % |
| Associated GOLD sequencing projects | 127 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (8.725 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.899 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (32.886 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.44% β-sheet: 0.00% Coil/Unstructured: 51.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 149 Family Scaffolds |
|---|---|---|
| PF13672 | PP2C_2 | 53.69 |
| PF14332 | DUF4388 | 7.38 |
| PF00483 | NTP_transferase | 2.68 |
| PF00132 | Hexapep | 1.34 |
| PF00226 | DnaJ | 1.34 |
| PF00072 | Response_reg | 0.67 |
| PF00248 | Aldo_ket_red | 0.67 |
| PF01575 | MaoC_dehydratas | 0.67 |
| PF07729 | FCD | 0.67 |
| PF03795 | YCII | 0.67 |
| PF00829 | Ribosomal_L21p | 0.67 |
| PF04343 | DUF488 | 0.67 |
| PF08308 | PEGA | 0.67 |
| PF07719 | TPR_2 | 0.67 |
| PF03167 | UDG | 0.67 |
| PF02082 | Rrf2 | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 149 Family Scaffolds |
|---|---|---|---|
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 1.34 |
| COG0261 | Ribosomal protein L21 | Translation, ribosomal structure and biogenesis [J] | 0.67 |
| COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 0.67 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.67 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.67 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.67 |
| COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 0.67 |
| COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.67 |
| COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 0.67 |
| COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.67 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.67 |
| COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 0.67 |
| COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 0.67 |
| COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 0.67 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q01BQNMW | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100615185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 872 | Open in IMG/M |
| 3300000956|JGI10216J12902_101248183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 1379 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_109142259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 899 | Open in IMG/M |
| 3300005543|Ga0070672_100304354 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300005548|Ga0070665_101950990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 593 | Open in IMG/M |
| 3300005617|Ga0068859_101673806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 703 | Open in IMG/M |
| 3300005718|Ga0068866_11259421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300005764|Ga0066903_101904287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1139 | Open in IMG/M |
| 3300005843|Ga0068860_101974145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 605 | Open in IMG/M |
| 3300005844|Ga0068862_100311468 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
| 3300006028|Ga0070717_10007030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 8331 | Open in IMG/M |
| 3300006056|Ga0075163_11547593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 641 | Open in IMG/M |
| 3300006057|Ga0075026_100053680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1906 | Open in IMG/M |
| 3300006173|Ga0070716_100362986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1029 | Open in IMG/M |
| 3300006195|Ga0075366_10406597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 838 | Open in IMG/M |
| 3300006224|Ga0079037_100484407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 1185 | Open in IMG/M |
| 3300006237|Ga0097621_100254776 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1538 | Open in IMG/M |
| 3300006358|Ga0068871_101435197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 651 | Open in IMG/M |
| 3300006358|Ga0068871_102197347 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300006854|Ga0075425_100176009 | All Organisms → cellular organisms → Bacteria | 2456 | Open in IMG/M |
| 3300006854|Ga0075425_100182748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 2409 | Open in IMG/M |
| 3300006881|Ga0068865_100051031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2861 | Open in IMG/M |
| 3300007788|Ga0099795_10254656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 758 | Open in IMG/M |
| 3300009093|Ga0105240_12544326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300009111|Ga0115026_10629872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 818 | Open in IMG/M |
| 3300009167|Ga0113563_10372694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1512 | Open in IMG/M |
| 3300009167|Ga0113563_10530285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1290 | Open in IMG/M |
| 3300009174|Ga0105241_10142428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1953 | Open in IMG/M |
| 3300009177|Ga0105248_13274873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300009678|Ga0105252_10342163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 676 | Open in IMG/M |
| 3300009792|Ga0126374_10654288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 783 | Open in IMG/M |
| 3300009792|Ga0126374_10868515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 696 | Open in IMG/M |
| 3300009873|Ga0131077_10001119 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 70565 | Open in IMG/M |
| 3300010044|Ga0126310_10651344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 792 | Open in IMG/M |
| 3300010046|Ga0126384_10791876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 848 | Open in IMG/M |
| 3300010047|Ga0126382_12145244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300010166|Ga0126306_11257696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 609 | Open in IMG/M |
| 3300010166|Ga0126306_11654561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 534 | Open in IMG/M |
| 3300010337|Ga0134062_10099114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1249 | Open in IMG/M |
| 3300010360|Ga0126372_12978809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 525 | Open in IMG/M |
| 3300010362|Ga0126377_10847137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 975 | Open in IMG/M |
| 3300010362|Ga0126377_12198831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 628 | Open in IMG/M |
| 3300010362|Ga0126377_13484753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 509 | Open in IMG/M |
| 3300010398|Ga0126383_11167340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 860 | Open in IMG/M |
| 3300010398|Ga0126383_12013890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 665 | Open in IMG/M |
| 3300010399|Ga0134127_10187068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1915 | Open in IMG/M |
| 3300010399|Ga0134127_11583399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 729 | Open in IMG/M |
| 3300010399|Ga0134127_11820523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 685 | Open in IMG/M |
| 3300010400|Ga0134122_11537885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 686 | Open in IMG/M |
| 3300010867|Ga0126347_1017552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1174 | Open in IMG/M |
| 3300011427|Ga0137448_1085177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 841 | Open in IMG/M |
| 3300011431|Ga0137438_1006603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3238 | Open in IMG/M |
| 3300011436|Ga0137458_1282690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300012094|Ga0136638_10531565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300012146|Ga0137322_1023999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 850 | Open in IMG/M |
| 3300012909|Ga0157290_10015727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1568 | Open in IMG/M |
| 3300012911|Ga0157301_10301480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 585 | Open in IMG/M |
| 3300012929|Ga0137404_12179384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300012930|Ga0137407_11728072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300012964|Ga0153916_10093056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2837 | Open in IMG/M |
| 3300013297|Ga0157378_10120655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2416 | Open in IMG/M |
| 3300014166|Ga0134079_10301596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 712 | Open in IMG/M |
| 3300014325|Ga0163163_12743956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 549 | Open in IMG/M |
| 3300014502|Ga0182021_11168513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 927 | Open in IMG/M |
| 3300014968|Ga0157379_12663197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 501 | Open in IMG/M |
| 3300015054|Ga0137420_1472233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1861 | Open in IMG/M |
| 3300015163|Ga0167665_1069624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 628 | Open in IMG/M |
| 3300015200|Ga0173480_10655349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 652 | Open in IMG/M |
| 3300015371|Ga0132258_13164789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 1136 | Open in IMG/M |
| 3300017993|Ga0187823_10353410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300018083|Ga0184628_10254171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 923 | Open in IMG/M |
| 3300018465|Ga0190269_10334097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 902 | Open in IMG/M |
| 3300018476|Ga0190274_10592335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1133 | Open in IMG/M |
| 3300018920|Ga0190273_10716943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 778 | Open in IMG/M |
| 3300018920|Ga0190273_12016133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 535 | Open in IMG/M |
| 3300019874|Ga0193744_1000268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 12881 | Open in IMG/M |
| 3300019874|Ga0193744_1008995 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1821 | Open in IMG/M |
| 3300021057|Ga0196981_1036628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 739 | Open in IMG/M |
| 3300021403|Ga0210397_11149041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 603 | Open in IMG/M |
| 3300021445|Ga0182009_10035716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2022 | Open in IMG/M |
| 3300022886|Ga0247746_1011110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1857 | Open in IMG/M |
| 3300022915|Ga0247790_10000042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 71433 | Open in IMG/M |
| 3300022936|Ga0247806_10303890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 651 | Open in IMG/M |
| 3300023094|Ga0247741_1002080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 11160 | Open in IMG/M |
| 3300023095|Ga0247736_10288134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 547 | Open in IMG/M |
| 3300023211|Ga0255842_1348146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 3638 | Open in IMG/M |
| 3300024055|Ga0247794_10020817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1627 | Open in IMG/M |
| 3300025318|Ga0209519_10569168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 628 | Open in IMG/M |
| 3300025899|Ga0207642_10098144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1464 | Open in IMG/M |
| 3300025901|Ga0207688_10801055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 597 | Open in IMG/M |
| 3300025909|Ga0207705_11116843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300025911|Ga0207654_10872923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 652 | Open in IMG/M |
| 3300025912|Ga0207707_10566741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 964 | Open in IMG/M |
| 3300025912|Ga0207707_11368146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300025918|Ga0207662_10063181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2226 | Open in IMG/M |
| 3300025923|Ga0207681_10708755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 837 | Open in IMG/M |
| 3300025929|Ga0207664_11957378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300025934|Ga0207686_11248633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 609 | Open in IMG/M |
| 3300025935|Ga0207709_10486620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 960 | Open in IMG/M |
| 3300025936|Ga0207670_10071822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 2395 | Open in IMG/M |
| 3300025936|Ga0207670_10889636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 745 | Open in IMG/M |
| 3300025938|Ga0207704_10941594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 728 | Open in IMG/M |
| 3300025942|Ga0207689_10342632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1242 | Open in IMG/M |
| 3300026095|Ga0207676_10180945 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1846 | Open in IMG/M |
| 3300026983|Ga0207856_1003367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 3312 | Open in IMG/M |
| 3300027886|Ga0209486_10816618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 611 | Open in IMG/M |
| 3300027890|Ga0209496_10165396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1024 | Open in IMG/M |
| 3300027900|Ga0209253_10160717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1814 | Open in IMG/M |
| 3300028380|Ga0268265_12022149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 583 | Open in IMG/M |
| 3300028381|Ga0268264_12215174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 557 | Open in IMG/M |
| 3300028732|Ga0302264_1000414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 11453 | Open in IMG/M |
| 3300028870|Ga0302254_10050877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1492 | Open in IMG/M |
| 3300029989|Ga0311365_10093703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2565 | Open in IMG/M |
| 3300030294|Ga0311349_10864842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 850 | Open in IMG/M |
| 3300030613|Ga0299915_10000027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 105280 | Open in IMG/M |
| 3300031184|Ga0307499_10137634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 705 | Open in IMG/M |
| 3300031232|Ga0302323_100102787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2757 | Open in IMG/M |
| 3300031238|Ga0265332_10039996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2030 | Open in IMG/M |
| 3300031456|Ga0307513_10030675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 6103 | Open in IMG/M |
| 3300031507|Ga0307509_10880706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300031616|Ga0307508_10526036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 779 | Open in IMG/M |
| 3300031616|Ga0307508_10616117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 688 | Open in IMG/M |
| 3300031708|Ga0310686_110230050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1164 | Open in IMG/M |
| 3300031715|Ga0307476_10025011 | All Organisms → cellular organisms → Bacteria | 3918 | Open in IMG/M |
| 3300031730|Ga0307516_10013671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 8626 | Open in IMG/M |
| 3300031730|Ga0307516_10349081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1145 | Open in IMG/M |
| 3300031731|Ga0307405_10897836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 749 | Open in IMG/M |
| 3300031912|Ga0306921_11625918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 701 | Open in IMG/M |
| 3300031918|Ga0311367_10263457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1793 | Open in IMG/M |
| 3300031938|Ga0308175_100000761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 21443 | Open in IMG/M |
| 3300031949|Ga0214473_10335027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 1720 | Open in IMG/M |
| 3300032002|Ga0307416_102827631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 581 | Open in IMG/M |
| 3300032126|Ga0307415_100395313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1178 | Open in IMG/M |
| 3300032144|Ga0315910_11264153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 576 | Open in IMG/M |
| 3300032180|Ga0307471_100367222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1556 | Open in IMG/M |
| 3300032205|Ga0307472_100777442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 872 | Open in IMG/M |
| 3300032955|Ga0335076_11122580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 669 | Open in IMG/M |
| 3300033408|Ga0316605_10022747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 4029 | Open in IMG/M |
| 3300033419|Ga0316601_100806543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 928 | Open in IMG/M |
| 3300033433|Ga0326726_10961410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 829 | Open in IMG/M |
| 3300033480|Ga0316620_10030446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3414 | Open in IMG/M |
| 3300033486|Ga0316624_10749524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 864 | Open in IMG/M |
| 3300033502|Ga0326731_1080711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 751 | Open in IMG/M |
| 3300033557|Ga0316617_102834673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 505 | Open in IMG/M |
| 3300034157|Ga0370506_035238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1039 | Open in IMG/M |
| 3300034158|Ga0370507_0241700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 593 | Open in IMG/M |
| 3300034194|Ga0370499_0078855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 805 | Open in IMG/M |
| 3300034268|Ga0372943_0003089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 8310 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.71% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.03% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 4.03% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.03% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 4.03% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.36% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.36% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.68% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.68% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 2.01% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.01% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.01% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.01% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 2.01% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.01% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 2.01% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 2.01% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.01% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.01% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.34% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.34% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.34% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.34% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.34% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.34% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.34% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.34% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.67% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.67% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.67% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.67% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.67% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.67% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.67% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.67% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.67% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.67% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.67% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.67% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.67% |
| Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.67% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.67% |
| Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 0.67% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006056 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNA | Engineered | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006195 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Host-Associated | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011427 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2 | Environmental | Open in IMG/M |
| 3300011431 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2 | Environmental | Open in IMG/M |
| 3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
| 3300012094 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ858 (22.06) | Environmental | Open in IMG/M |
| 3300012146 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT400_2 | Environmental | Open in IMG/M |
| 3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015163 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb1b, glacier snout) | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019874 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a1 | Environmental | Open in IMG/M |
| 3300021057 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3_20-13C | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022886 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5 | Environmental | Open in IMG/M |
| 3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
| 3300022936 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L059-202B-1 | Environmental | Open in IMG/M |
| 3300023094 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L213-509R-2 | Environmental | Open in IMG/M |
| 3300023095 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L193-509B-2 | Environmental | Open in IMG/M |
| 3300023211 | Activated sludge enriched bacterial communities from WWTP in Fort Collins, Colorado, USA ? CA | Engineered | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026983 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 21 (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028732 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300028870 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4 | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030613 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Host-Associated | Open in IMG/M |
| 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Host-Associated | Open in IMG/M |
| 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Host-Associated | Open in IMG/M |
| 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033502 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF9FY SIP fraction | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300034157 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_18 | Environmental | Open in IMG/M |
| 3300034158 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_18 | Environmental | Open in IMG/M |
| 3300034194 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_17 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_11286920 | 2170459005 | Grass Soil | VATVATAWWGYAVGNPTVVGIVVAVIAVAAVAFVARRLWRR |
| INPhiseqgaiiFebDRAFT_1006151852 | 3300000364 | Soil | MWGYAEGNPTMVGIVVVLIGAAALGYVARRLWRRGR* |
| JGI10216J12902_1012481832 | 3300000956 | Soil | MWGYAEGNKTVVAIVVLIIAIAAIAFIARKFWRRR* |
| JGIcombinedJ13530_1091422592 | 3300001213 | Wetland | MWGYAEGNATLVGIVVVIVAVAAVGYVGKRLLGRGR* |
| Ga0070672_1003043542 | 3300005543 | Miscanthus Rhizosphere | MWGYAEGNATVVGIVVVLVGAAAVAYVARRLWRRGR* |
| Ga0070665_1019509901 | 3300005548 | Switchgrass Rhizosphere | MWGYAEGNATVVGIVVVIIGIAAIGYVARRLWRRGR* |
| Ga0068859_1016738061 | 3300005617 | Switchgrass Rhizosphere | MWGYAEGNVTVVGIVVAIIGVAAIAYVARRLWRRGR* |
| Ga0068866_112594212 | 3300005718 | Miscanthus Rhizosphere | MWGYAQGNATIVGIVVVIIGAAAIGYVVRRLWRRGR* |
| Ga0066903_1019042872 | 3300005764 | Tropical Forest Soil | MWGYAEGNKTLVAIVVVAVVVAAVAFVARRLWRRRR* |
| Ga0068860_1019741452 | 3300005843 | Switchgrass Rhizosphere | MWGYAEGNATLVGIVVVIIAAAAIGYVARRLWRRGR* |
| Ga0068862_1003114682 | 3300005844 | Switchgrass Rhizosphere | MWGYAEGNTTMVGIIVVLIGGAAIGYVARRLWRRGP* |
| Ga0070717_100070309 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MWGYAEGNATVVGIVVVIIGAAAVGYVARRLWRRGR* |
| Ga0075163_115475932 | 3300006056 | Wastewater Effluent | MWGYAEGNQTLVTIVVVIVVIAALGYVGRRLWKRER* |
| Ga0075026_1000536803 | 3300006057 | Watersheds | MWGYAEGNQTLVTIVVVIVVAAALAYVVRRFIKKGR* |
| Ga0070716_1003629862 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MWGYAEGNATVVGIVVVIIGAAAIGYVVRRLWRRGR* |
| Ga0075366_104065972 | 3300006195 | Populus Endosphere | MWGYAEGNATVVGIVVVIIAGAAIGYVARRLWRRGR* |
| Ga0079037_1004844072 | 3300006224 | Freshwater Wetlands | MWGYAEGDATLVGIVVVIVAIAAVAYVGRALWRRR* |
| Ga0097621_1002547762 | 3300006237 | Miscanthus Rhizosphere | MWGYAEANKTMVAIVVGLVVAAAVAYVARRWWRR* |
| Ga0068871_1014351972 | 3300006358 | Miscanthus Rhizosphere | MWGYAEGNPTAVGFVVVIVTIAAIAFVARRLWRKGR* |
| Ga0068871_1021973472 | 3300006358 | Miscanthus Rhizosphere | LSGMWGYAEGNKTLVAIVVVVVVAAAIAFVARRLWRRGR* |
| Ga0075425_1001760092 | 3300006854 | Populus Rhizosphere | MWGYAEGNVTVVGIVVVIIGVAAIAYVARRLWRRGR* |
| Ga0075425_1001827484 | 3300006854 | Populus Rhizosphere | MWGYAEGNTTVVAVVVALIVIAAIAYVTRKLWRRRGR* |
| Ga0068865_1000510312 | 3300006881 | Miscanthus Rhizosphere | MWGYAEANPTLVGLVVVVVAIAAIAFVTRRLLRRGR* |
| Ga0099795_102546562 | 3300007788 | Vadose Zone Soil | MWGYAQGNATIVGVVVVIIGAAAIGYVVRRLWRGGR* |
| Ga0105240_125443262 | 3300009093 | Corn Rhizosphere | MWGYAEGNTTMVGIVVVLIGAAAIGYVARRLWRRGR* |
| Ga0115026_106298722 | 3300009111 | Wetland | MWGYAEGNATLVGIVVVVVVVAAATYVGRQLWRGRR* |
| Ga0113563_103726943 | 3300009167 | Freshwater Wetlands | MWGYAEGNKTVVAIVVVVIAVAALAYVARRFWRR* |
| Ga0113563_105302852 | 3300009167 | Freshwater Wetlands | MWGYAEGNKTLVAVVVVLIAIAAIAYVARRLLGKR* |
| Ga0105241_101424282 | 3300009174 | Corn Rhizosphere | MWGYAQGNATVVGIVVVIIGLAAVGYVGRRLWRGR* |
| Ga0105248_132748732 | 3300009177 | Switchgrass Rhizosphere | MWGYAQGNATIVGIVVVIIGAAAIGYVARRLWRRGR* |
| Ga0105252_103421631 | 3300009678 | Soil | MWGYAEGNKTVVAIAVVLVAVAALAFLGRKFWRRGR* |
| Ga0126374_106542882 | 3300009792 | Tropical Forest Soil | MWGYAQGNATIVGIVVVIIGAAAIGYVVRRLWRKGR* |
| Ga0126374_108685152 | 3300009792 | Tropical Forest Soil | ESMWGYAQGNATIVGIIVVIVGAAAIGYVVRRLWRRGR* |
| Ga0131077_1000111952 | 3300009873 | Wastewater | MWGYAEGNETLVAIVVIVVLVAAIAYLARRYVNRGQ* |
| Ga0126310_106513442 | 3300010044 | Serpentine Soil | MWGYAEGNATVIGIVVVLIGVAAIGYVVRRLWRLWRRGR* |
| Ga0126384_107918762 | 3300010046 | Tropical Forest Soil | MWGYAEGNATVVGIVVVIVGAAAIGYVVRRLWRRGR* |
| Ga0126382_121452442 | 3300010047 | Tropical Forest Soil | MWGYAEGNATIVGIVVVIIGAAAIGYVVRRLLRRGR* |
| Ga0126306_112576962 | 3300010166 | Serpentine Soil | MWGYAEGNKTVVAIVVVAVLIAAIAYITRNFWRRR* |
| Ga0126306_116545612 | 3300010166 | Serpentine Soil | MWGYAEGNKTVVAIVVLIVAVAAIAFIARKFWRRR* |
| Ga0134062_100991142 | 3300010337 | Grasslands Soil | MWGYAEGNATIVAIVVVIIGAAAIGYVARRLWRRGR* |
| Ga0126372_129788092 | 3300010360 | Tropical Forest Soil | MWGYAEGNATVVGIVVVIIGVAAIGYVARRLWRRGR* |
| Ga0126377_108471372 | 3300010362 | Tropical Forest Soil | MWGYAEGNTTVVAVVVAIIAIAAIVYVTRGLWRRRGR* |
| Ga0126377_121988311 | 3300010362 | Tropical Forest Soil | PTDRPSILWSMWGYAEGNATIVGIVVVVIAIAAIGYVVRRLWRRGR* |
| Ga0126377_134847532 | 3300010362 | Tropical Forest Soil | MWGYAEGNKTLVAIVVVVVVAAAIAFVARRLWRRRR* |
| Ga0126383_111673401 | 3300010398 | Tropical Forest Soil | MWGYAEGNATVVGIVVVIIAAAAIGYIARRLWRRGR* |
| Ga0126383_120138902 | 3300010398 | Tropical Forest Soil | MWGYAQGNATIVGIVVVIIGVAAIGYVVRRLWRRGR* |
| Ga0134127_101870681 | 3300010399 | Terrestrial Soil | MWGYAEGNVTVVGIVVVIIGVAAVAYIARRLWRRGR* |
| Ga0134127_115833992 | 3300010399 | Terrestrial Soil | MWGYAEGNATIVGIVVVVIGIAAIGYVVRRLWRRGR* |
| Ga0134127_118205232 | 3300010399 | Terrestrial Soil | MHGLGVGWWGYAEGNPILVGIVVAIIVIAAIAYVARRLWRR |
| Ga0134122_115378851 | 3300010400 | Terrestrial Soil | MWGYAQGNATVVGIVVVVIGAAAVIYVARRLWRRGR* |
| Ga0126347_10175522 | 3300010867 | Boreal Forest Soil | MWGYAEGNATVVGIVVALIGGAAVAYVARRLWRRGS* |
| Ga0137448_10851772 | 3300011427 | Soil | MWGYAEGNPTVVGIVVVIIGAAAIGYVARRLWRRGR* |
| Ga0137438_10066034 | 3300011431 | Soil | MWGYAEGNPTIVGIVVVIIGLAAVGYVVRRLWRRGR* |
| Ga0137458_12826902 | 3300011436 | Soil | WGYAEGNKTVVAIVVVLVAVAALAFLGRKFWRRGR* |
| Ga0136638_105315652 | 3300012094 | Polar Desert Sand | MWGYAEGNATLVGIVVVVIALAAIGYVVMGVLRRGR* |
| Ga0137322_10239992 | 3300012146 | Soil | MWGYAEGNKTVVAIVVVLVAVAALAFLGRKFWRRGR* |
| Ga0157290_100157273 | 3300012909 | Soil | MWGYAEGNKTVVAIVVALVVVAALAFLARKLWRRGR* |
| Ga0157301_103014802 | 3300012911 | Soil | MWGYAEGNKTVVAVVVALVAIAAVAFFARKLWRRG |
| Ga0137404_121793842 | 3300012929 | Vadose Zone Soil | MWGYAEGNATVVGIVVVTVGIAAIAYVARRLLGRGK* |
| Ga0137407_117280722 | 3300012930 | Vadose Zone Soil | MWGYAEGNATAVGIVVAIIGAAAIGYVIRRLWRRGR* |
| Ga0153916_100930562 | 3300012964 | Freshwater Wetlands | MWGYAEGNATLVGIVVVVIVVAAAAYVGRQLWRGRR* |
| Ga0157378_101206552 | 3300013297 | Miscanthus Rhizosphere | MWGYAEGNATVVGIVVVLIAAAAIGYVVRRLWRRGG* |
| Ga0134079_103015961 | 3300014166 | Grasslands Soil | MWGYAEGNETLVTIVVIVVVVAALAYLARRFVNRG |
| Ga0163163_127439561 | 3300014325 | Switchgrass Rhizosphere | MWGYAEGNTTMVGIIVVLIGGAAVGYVARRLWRRGP* |
| Ga0182021_111685131 | 3300014502 | Fen | MWGYAEGNPTLVGIVVILITGAAIGYVARRLWKRGR* |
| Ga0157379_126631972 | 3300014968 | Switchgrass Rhizosphere | MWGYAEGNATIVGIVVVIIGAAAIGYVVRQLWRRSR* |
| Ga0137420_14722332 | 3300015054 | Vadose Zone Soil | MWGYAEGNATVVGIVVAIIATAAIGYVVRRLWRRGR* |
| Ga0167665_10696242 | 3300015163 | Glacier Forefield Soil | VWGYAEGNQTLVTIVVVIVVIAALGYVARRLIKRGR* |
| Ga0173480_106553492 | 3300015200 | Soil | MWGYAEGNKTAVAIVVVIVVIAAIAYLANRFWKGRR* |
| Ga0132258_131647892 | 3300015371 | Arabidopsis Rhizosphere | MWGYAEGNETLVAIVVILVVVAAVAYLGRRFLRRGR* |
| Ga0187823_103534102 | 3300017993 | Freshwater Sediment | MWGYAQGNATIVGIVVVIIGAAAIGYVVRRLWRRGR |
| Ga0184628_102541712 | 3300018083 | Groundwater Sediment | MWGYAEGNATVVGIVVVVIGVAAIGYVVRRLWRRGR |
| Ga0190269_103340972 | 3300018465 | Soil | MWGYAEGNETLVAIVVIVVLVAAVAYLARRFVNRGR |
| Ga0190274_105923352 | 3300018476 | Soil | MWGYAEGNKTVVAIVVVIIVIAALAYIGNRFWKGRR |
| Ga0190273_107169432 | 3300018920 | Soil | MWGYAEGNKTMVAVVVVIIVVAAIAYLARRFWRGR |
| Ga0190273_120161331 | 3300018920 | Soil | MWGYAEGNGTLVGIVVVLVAIAAIAYVARRILRRRG |
| Ga0193744_10002683 | 3300019874 | Soil | MWGYAEGNATVVGIVVVIIAAAAIGYVVRRLWRRGR |
| Ga0193744_10089952 | 3300019874 | Soil | MWGYAEGNATVVGIVVVIIGVAAIGYVARRLWRRGP |
| Ga0196981_10366281 | 3300021057 | Soil | MWGYAEGNETLVAIVVIAVLVGALVYLANRFANRGR |
| Ga0210397_111490412 | 3300021403 | Soil | MWGYAEGNPTAVGLVVVIVSIAAVVFVGRRLWRRGR |
| Ga0182009_100357163 | 3300021445 | Soil | MWGYAQGNATIVGIVVVIIGAAAIGYVVRRLVRRGR |
| Ga0247746_10111102 | 3300022886 | Soil | MWGYAEGNKTVVAIVVAIVAVAAVAFLARKLWRRGR |
| Ga0247790_1000004229 | 3300022915 | Soil | MWGYAEGNKTVVAIVVALVVVAAVAFFARKLWRRGR |
| Ga0247806_103038902 | 3300022936 | Plant Litter | MWGYAEGNATLVGIVVVVIALAAIAYVAMRVFGRGR |
| Ga0247741_10020802 | 3300023094 | Plant Litter | MWGYAEGNRTLVTIVVVIVVIAALGYVGRRIWKRGR |
| Ga0247736_102881342 | 3300023095 | Plant Litter | MWGYAEGNATLVGIVVVVITIAAIAYVALRVLRRRG |
| Ga0255842_13481466 | 3300023211 | Activated Sludge | MWGYAEGNQTLVTIVVVIVVIAALSYVGRRLWKRER |
| Ga0247794_100208172 | 3300024055 | Soil | MWGYAQGNATIVGIVVVIIGAAAIGYVARRLWRRGR |
| Ga0209519_105691681 | 3300025318 | Soil | MWGYAEGNETALTIVVVLIVLAALAYVFRRYLGGR |
| Ga0207642_100981442 | 3300025899 | Miscanthus Rhizosphere | MWGYAEGNATVVGIVVVLVGAAAVAYVARRLWRRGR |
| Ga0207688_108010551 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MWGYAEGNVTVVGIVVVIIGVAAIAYVARRLWRRGR |
| Ga0207705_111168432 | 3300025909 | Corn Rhizosphere | MWGYAEGNATVVGIVVVIIGIAAIGYVARRLWRRGR |
| Ga0207654_108729232 | 3300025911 | Corn Rhizosphere | MWGYAQGNATVVGIVVVIIGLAAVGYVGRRLWRGR |
| Ga0207707_105667412 | 3300025912 | Corn Rhizosphere | MWGYAEGNATIVGIVVAIIGAAAIGYVVRRLWRRSR |
| Ga0207707_113681461 | 3300025912 | Corn Rhizosphere | PAGLPSFWESMWGYAQGNATIVGIVVVIIAVAAIGYVARRLWRRGR |
| Ga0207662_100631814 | 3300025918 | Switchgrass Rhizosphere | MWGYAEGNATLVGIVVVIIAAAAIGYVARRLWRRGR |
| Ga0207681_107087551 | 3300025923 | Switchgrass Rhizosphere | MWGYAEGNKTVVAIVVAIVAIAAVAFLARKLWRRG |
| Ga0207664_119573782 | 3300025929 | Agricultural Soil | MHPDRAVALWGYAEANPTLVGIVVVIVALAAVAYVARRLWRR |
| Ga0207686_112486331 | 3300025934 | Miscanthus Rhizosphere | FSKESAMWGYAEGNATVVGIVVVLVGAAAVAYVARRLWRRGR |
| Ga0207709_104866201 | 3300025935 | Miscanthus Rhizosphere | SAMWGYAEGNATVVGIVVVLVGAAAVAYVARRLWRRGR |
| Ga0207670_100718224 | 3300025936 | Switchgrass Rhizosphere | MWGYAEGNTTVVAVVVALIVIAAIAYVTRRLWRRRGR |
| Ga0207670_108896362 | 3300025936 | Switchgrass Rhizosphere | MWGYAEGNKTVVAIVVAIVAIAAVAFLARKLWRRGR |
| Ga0207704_109415942 | 3300025938 | Miscanthus Rhizosphere | MWGYAEANPTLVGLVVVVVAIAAIAFVTRRLLRRGR |
| Ga0207689_103426322 | 3300025942 | Miscanthus Rhizosphere | MWGYAEGNATVVGIVVAIIAAAAIGYVVRRLVRRGR |
| Ga0207676_101809453 | 3300026095 | Switchgrass Rhizosphere | MWGYAEGNATVVGIVVVIIAGAAIGYVVRRLWRRGR |
| Ga0207856_10033672 | 3300026983 | Tropical Forest Soil | MWGYAETNKTAVAIVVVLVLVAALAFLGRKLWRRGR |
| Ga0209486_108166182 | 3300027886 | Agricultural Soil | MWGYAEGNTTAVAVVVIVVAIAAVAYLTRKLWRRGP |
| Ga0209496_101653962 | 3300027890 | Wetland | MWGYAEGDATLVGIVVVIVAIAAVAYVGRALWRRR |
| Ga0209253_101607172 | 3300027900 | Freshwater Lake Sediment | MWGYAEGNQTLVTIVVVIVVIAAVGYVARRLLGKGR |
| Ga0268265_120221492 | 3300028380 | Switchgrass Rhizosphere | MWGYAEGNKTVVAIVVAVVAIAAVAFLARKLWRRGR |
| Ga0268264_122151741 | 3300028381 | Switchgrass Rhizosphere | ESMWGYAEGNATVVGIVVVIIGIAAIGYVARRLWRRGR |
| Ga0302264_10004142 | 3300028732 | Fen | MWGYAEGNATVVGIVVVLVAVAAIGYVARRLWRRGS |
| Ga0302254_100508773 | 3300028870 | Fen | MWGYAEGNATVVGIVVVLIAAAAIGYVVRRLWRRGG |
| Ga0311365_100937034 | 3300029989 | Fen | MWGYAEGNATVVGVVVVVIAAAALGYVIRRLWRRGG |
| Ga0311349_108648422 | 3300030294 | Fen | MWGYAEGNPTLVGIVVIIIAVAAVGYVARRLWKRER |
| Ga0299915_1000002724 | 3300030613 | Soil | MWGYAEGNETALLIVVVIVAIAALAYVFRRYLGGK |
| Ga0307499_101376342 | 3300031184 | Soil | MWGYAEGNKTVVAIVVALVAIAAVAFLARKLWTRRR |
| Ga0302323_1001027874 | 3300031232 | Fen | MWGYAEGNATVLGIVVVVIAAAAVGYVTRRLWRRGP |
| Ga0265332_100399961 | 3300031238 | Rhizosphere | MWGYAQGNATVVGIVVVIIGAAAIGYVARRLWRRGR |
| Ga0307513_100306756 | 3300031456 | Ectomycorrhiza | MWGYAEGNATAVGIVAAIIALAAVAFVARRLWRRGR |
| Ga0307509_108807061 | 3300031507 | Ectomycorrhiza | MWGYAEGNATVVGIVVAVIAAAAIGYVARRLWRRGR |
| Ga0307508_105260362 | 3300031616 | Ectomycorrhiza | MWGYAEGNATVVGIVVAIIAAAAIAYVARRLWRRGR |
| Ga0307508_106161172 | 3300031616 | Ectomycorrhiza | MWGYAEGNATVVGIVVVLICVAAVAYVGRRFWRRGG |
| Ga0310686_1102300502 | 3300031708 | Soil | VALWSYAEGNSTVLAIVVLVIAMTALAYVARRLWRK |
| Ga0307476_100250112 | 3300031715 | Hardwood Forest Soil | MWGYAQGNATIVGIVVVIIAAAAIGYVVRRLWRRGR |
| Ga0307516_100136716 | 3300031730 | Ectomycorrhiza | MWGYAEGNATVVGIVVVLIAVAALGYVVRRLWRRGS |
| Ga0307516_103490812 | 3300031730 | Ectomycorrhiza | MWGYAEGNATVVGVVVVVIAAAAVGYVIRRLWRRGG |
| Ga0307405_108978362 | 3300031731 | Rhizosphere | MWGYAEGNRTVVAIVVAIVAIAAVAFLAGKLWRRRR |
| Ga0306921_116259182 | 3300031912 | Soil | MWGYAQGNATMLGIVVAIIGVAAVAYVGRRLWRGR |
| Ga0311367_102634572 | 3300031918 | Fen | MWGYAEGNPTLVGIVVIIIAVAAVAYVARRLWKRER |
| Ga0308175_10000076112 | 3300031938 | Soil | MWGYAEGNTTMVGIVVALIGGAAIGYLARRLWRRGR |
| Ga0214473_103350272 | 3300031949 | Soil | MWGYAEGNKTVVAIVVVLVAVAALAFLGRKFWRRGR |
| Ga0307416_1028276312 | 3300032002 | Rhizosphere | MWGYAEGNETALTIVVTVIVVAAIAYVFRRYLGGR |
| Ga0307415_1003953132 | 3300032126 | Rhizosphere | MWGYAEGNKTVVAIVVAIIAVAAVAFLARKLWRRGR |
| Ga0315910_112641531 | 3300032144 | Soil | MWGYAEGNQTAITIVVGVIVVAAIAYVLRRYLGGK |
| Ga0307471_1003672223 | 3300032180 | Hardwood Forest Soil | MWGYAQGNATIVGIVVVFIGGAAVAYVVRRLWRRGR |
| Ga0307472_1007774422 | 3300032205 | Hardwood Forest Soil | GPSILGRMWGYAEGNTTMVGIVVVLIGGAAIGYVVRRLWRRGR |
| Ga0335076_111225801 | 3300032955 | Soil | MWGYAEGNPFVVGCVVFILTVAAIAWVGRRWLRRG |
| Ga0316605_100227475 | 3300033408 | Soil | MWGYAEGNKTLVAVVVVLIAIAAIAYVARRLLGKR |
| Ga0316601_1008065432 | 3300033419 | Soil | MWGYAEANKTVVAIVVALVAVAALAFVVRKLWRRER |
| Ga0326726_109614102 | 3300033433 | Peat Soil | MWGYAEGNQTLVGIVVAIVLIAALAYVVRRFVRRGR |
| Ga0316620_100304464 | 3300033480 | Soil | MWGYAEGNATLVGIVVVVVVVAAATYVGRQLWRGRR |
| Ga0316624_107495242 | 3300033486 | Soil | MHGLGVGWWGYAEGNPTLVGIVVAIVVIAAIAYVARRLWRR |
| Ga0326731_10807112 | 3300033502 | Peat Soil | MWGYAEGNATLVGIVVVVVVVAAAAYVGRQLWRGRR |
| Ga0316617_1028346732 | 3300033557 | Soil | MWGYAEGNATLIGIVVAIVALAAIGYVARRLWRRGG |
| Ga0370506_035238_316_426 | 3300034157 | Untreated Peat Soil | MWGYAEGNQTLVAIVVVIVVIAALGYVGRRLWKKGR |
| Ga0370507_0241700_372_491 | 3300034158 | Untreated Peat Soil | MWGYAEGNATLVGIVVFIVAVAAIGYVGMRVFRRGRRGP |
| Ga0370499_0078855_237_347 | 3300034194 | Untreated Peat Soil | MWGYAEGDATLVGIVVAIVLIAAVAYVGRALWRRRQ |
| Ga0372943_0003089_6460_6570 | 3300034268 | Soil | MWGYAEGNTTIVGIVVVVIVAAALGYVARRLWRRGR |
| ⦗Top⦘ |