| Basic Information | |
|---|---|
| Family ID | F047717 |
| Family Type | Metagenome |
| Number of Sequences | 149 |
| Average Sequence Length | 40 residues |
| Representative Sequence | LVVPGLVIKGNATALVVRAFAATANVVMIGGYVNRITA |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 149 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.32 % |
| % of genes from short scaffolds (< 2000 bps) | 90.60 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.376 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (25.503 % of family members) |
| Environment Ontology (ENVO) | Unclassified (59.060 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (57.047 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 9.09% Coil/Unstructured: 90.91% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 149 Family Scaffolds |
|---|---|---|
| PF07691 | PA14 | 2.01 |
| PF13385 | Laminin_G_3 | 1.34 |
| PF00041 | fn3 | 0.67 |
| PF07484 | Collar | 0.67 |
| PF03237 | Terminase_6N | 0.67 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.38 % |
| All Organisms | root | All Organisms | 43.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002120|C687J26616_10053699 | Not Available | 1390 | Open in IMG/M |
| 3300002733|codie8draft_1032841 | Not Available | 2361 | Open in IMG/M |
| 3300005581|Ga0049081_10107854 | Not Available | 1036 | Open in IMG/M |
| 3300005581|Ga0049081_10153264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 842 | Open in IMG/M |
| 3300005581|Ga0049081_10333794 | Not Available | 517 | Open in IMG/M |
| 3300005805|Ga0079957_1164415 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1111 | Open in IMG/M |
| 3300005805|Ga0079957_1169707 | All Organisms → Viruses → Predicted Viral | 1086 | Open in IMG/M |
| 3300005805|Ga0079957_1345883 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300005943|Ga0073926_10086206 | Not Available | 632 | Open in IMG/M |
| 3300006340|Ga0068503_10367676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 626 | Open in IMG/M |
| 3300006637|Ga0075461_10055608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1279 | Open in IMG/M |
| 3300006738|Ga0098035_1043000 | Not Available | 1674 | Open in IMG/M |
| 3300006802|Ga0070749_10059780 | All Organisms → Viruses → Predicted Viral | 2302 | Open in IMG/M |
| 3300006802|Ga0070749_10241265 | Not Available | 1026 | Open in IMG/M |
| 3300007234|Ga0075460_10296810 | Not Available | 531 | Open in IMG/M |
| 3300007541|Ga0099848_1027100 | All Organisms → cellular organisms → Bacteria | 2408 | Open in IMG/M |
| 3300007541|Ga0099848_1047049 | All Organisms → Viruses → Predicted Viral | 1748 | Open in IMG/M |
| 3300007541|Ga0099848_1081234 | All Organisms → Viruses → Predicted Viral | 1263 | Open in IMG/M |
| 3300007541|Ga0099848_1163102 | Not Available | 818 | Open in IMG/M |
| 3300007541|Ga0099848_1175383 | Not Available | 781 | Open in IMG/M |
| 3300007541|Ga0099848_1234506 | Not Available | 647 | Open in IMG/M |
| 3300007541|Ga0099848_1295413 | Not Available | 557 | Open in IMG/M |
| 3300007542|Ga0099846_1073966 | Not Available | 1271 | Open in IMG/M |
| 3300007542|Ga0099846_1096877 | Not Available | 1088 | Open in IMG/M |
| 3300007963|Ga0110931_1174548 | Not Available | 644 | Open in IMG/M |
| 3300008216|Ga0114898_1066961 | All Organisms → Viruses → Predicted Viral | 1115 | Open in IMG/M |
| 3300009056|Ga0102860_1193708 | Not Available | 581 | Open in IMG/M |
| 3300009079|Ga0102814_10156908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1244 | Open in IMG/M |
| 3300009160|Ga0114981_10449736 | Not Available | 691 | Open in IMG/M |
| 3300009160|Ga0114981_10532783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
| 3300010155|Ga0098047_10287399 | Not Available | 622 | Open in IMG/M |
| 3300010354|Ga0129333_10388788 | All Organisms → Viruses → Predicted Viral | 1236 | Open in IMG/M |
| 3300010354|Ga0129333_10498073 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1068 | Open in IMG/M |
| 3300010354|Ga0129333_10554345 | All Organisms → Viruses → Predicted Viral | 1002 | Open in IMG/M |
| 3300010354|Ga0129333_10555305 | Not Available | 1001 | Open in IMG/M |
| 3300010354|Ga0129333_10739990 | Not Available | 842 | Open in IMG/M |
| 3300010368|Ga0129324_10032729 | All Organisms → Viruses → Predicted Viral | 2473 | Open in IMG/M |
| 3300012013|Ga0153805_1030590 | Not Available | 916 | Open in IMG/M |
| 3300013005|Ga0164292_10316050 | Not Available | 1064 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10535747 | Not Available | 638 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10341110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 951 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10087959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2693 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10235095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ctDWo9 | 1355 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10244660 | All Organisms → Viruses → Predicted Viral | 1318 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10249935 | All Organisms → Viruses → Predicted Viral | 1299 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10348405 | Not Available | 1033 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10349386 | All Organisms → Viruses → Predicted Viral | 1031 | Open in IMG/M |
| (restricted) 3300013137|Ga0172375_10818490 | Not Available | 572 | Open in IMG/M |
| 3300013372|Ga0177922_10136493 | Not Available | 833 | Open in IMG/M |
| 3300013372|Ga0177922_10224067 | Not Available | 634 | Open in IMG/M |
| 3300013372|Ga0177922_10727359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
| 3300013372|Ga0177922_11191523 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED97 | 1828 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10023182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5592 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10171014 | All Organisms → Viruses → Predicted Viral | 1418 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10231466 | Not Available | 1148 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10492672 | Not Available | 687 | Open in IMG/M |
| 3300017701|Ga0181364_1022266 | Not Available | 1041 | Open in IMG/M |
| 3300017723|Ga0181362_1007412 | All Organisms → Viruses → Predicted Viral | 2350 | Open in IMG/M |
| 3300017723|Ga0181362_1048209 | Not Available | 889 | Open in IMG/M |
| 3300017723|Ga0181362_1079974 | Not Available | 660 | Open in IMG/M |
| 3300017736|Ga0181365_1019388 | All Organisms → Viruses → Predicted Viral | 1712 | Open in IMG/M |
| 3300017736|Ga0181365_1022400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1591 | Open in IMG/M |
| 3300017736|Ga0181365_1029272 | All Organisms → Viruses → Predicted Viral | 1389 | Open in IMG/M |
| 3300017736|Ga0181365_1063394 | Not Available | 915 | Open in IMG/M |
| 3300017761|Ga0181356_1058169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1319 | Open in IMG/M |
| 3300017761|Ga0181356_1071028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1169 | Open in IMG/M |
| 3300017761|Ga0181356_1083270 | Not Available | 1060 | Open in IMG/M |
| 3300017761|Ga0181356_1085268 | All Organisms → Viruses → Predicted Viral | 1044 | Open in IMG/M |
| 3300017761|Ga0181356_1237651 | Not Available | 524 | Open in IMG/M |
| 3300017766|Ga0181343_1024211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1860 | Open in IMG/M |
| 3300017774|Ga0181358_1089415 | All Organisms → Viruses → Predicted Viral | 1116 | Open in IMG/M |
| 3300017774|Ga0181358_1094077 | Not Available | 1080 | Open in IMG/M |
| 3300017774|Ga0181358_1165335 | Not Available | 745 | Open in IMG/M |
| 3300017774|Ga0181358_1177666 | Not Available | 710 | Open in IMG/M |
| 3300017777|Ga0181357_1069322 | Not Available | 1358 | Open in IMG/M |
| 3300017777|Ga0181357_1079943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1251 | Open in IMG/M |
| 3300017777|Ga0181357_1093630 | All Organisms → Viruses → Predicted Viral | 1142 | Open in IMG/M |
| 3300017777|Ga0181357_1222603 | Not Available | 665 | Open in IMG/M |
| 3300017777|Ga0181357_1223467 | Not Available | 663 | Open in IMG/M |
| 3300017780|Ga0181346_1043178 | All Organisms → Viruses → Predicted Viral | 1841 | Open in IMG/M |
| 3300017780|Ga0181346_1113959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1040 | Open in IMG/M |
| 3300017780|Ga0181346_1237490 | Not Available | 642 | Open in IMG/M |
| 3300017784|Ga0181348_1030499 | All Organisms → Viruses → Predicted Viral | 2269 | Open in IMG/M |
| 3300017785|Ga0181355_1110938 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1129 | Open in IMG/M |
| 3300017785|Ga0181355_1153695 | Not Available | 927 | Open in IMG/M |
| 3300017785|Ga0181355_1359058 | Not Available | 534 | Open in IMG/M |
| 3300017788|Ga0169931_10242276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1483 | Open in IMG/M |
| 3300019784|Ga0181359_1034933 | All Organisms → Viruses → Predicted Viral | 1946 | Open in IMG/M |
| 3300019784|Ga0181359_1051182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1593 | Open in IMG/M |
| 3300019784|Ga0181359_1082595 | All Organisms → Viruses → Predicted Viral | 1202 | Open in IMG/M |
| 3300020074|Ga0194113_10450115 | Not Available | 935 | Open in IMG/M |
| 3300020074|Ga0194113_11060284 | Not Available | 537 | Open in IMG/M |
| 3300020193|Ga0194131_10195311 | Not Available | 958 | Open in IMG/M |
| 3300020193|Ga0194131_10251638 | Not Available | 813 | Open in IMG/M |
| 3300020198|Ga0194120_10551007 | Not Available | 510 | Open in IMG/M |
| 3300020205|Ga0211731_10944488 | Not Available | 923 | Open in IMG/M |
| 3300020220|Ga0194119_10808028 | Not Available | 554 | Open in IMG/M |
| 3300020222|Ga0194125_10353979 | Not Available | 947 | Open in IMG/M |
| 3300020415|Ga0211553_10282365 | Not Available | 672 | Open in IMG/M |
| 3300020603|Ga0194126_10582188 | Not Available | 673 | Open in IMG/M |
| 3300021091|Ga0194133_10446685 | Not Available | 695 | Open in IMG/M |
| 3300021962|Ga0222713_10850229 | Not Available | 505 | Open in IMG/M |
| 3300021963|Ga0222712_10728603 | Not Available | 555 | Open in IMG/M |
| 3300022190|Ga0181354_1084972 | Not Available | 1041 | Open in IMG/M |
| 3300022198|Ga0196905_1015187 | All Organisms → Viruses → Predicted Viral | 2480 | Open in IMG/M |
| 3300022198|Ga0196905_1097426 | Not Available | 787 | Open in IMG/M |
| 3300022200|Ga0196901_1072012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1248 | Open in IMG/M |
| 3300022200|Ga0196901_1131322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 848 | Open in IMG/M |
| 3300022200|Ga0196901_1202222 | Not Available | 637 | Open in IMG/M |
| 3300022407|Ga0181351_1049168 | All Organisms → Viruses → Predicted Viral | 1764 | Open in IMG/M |
| 3300022407|Ga0181351_1091235 | All Organisms → Viruses → Predicted Viral | 1195 | Open in IMG/M |
| 3300022407|Ga0181351_1191140 | Not Available | 694 | Open in IMG/M |
| 3300022752|Ga0214917_10411733 | Not Available | 553 | Open in IMG/M |
| 3300025069|Ga0207887_1080439 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD7-C12 | 530 | Open in IMG/M |
| 3300025646|Ga0208161_1105217 | Not Available | 770 | Open in IMG/M |
| 3300025646|Ga0208161_1144378 | Not Available | 601 | Open in IMG/M |
| 3300025655|Ga0208795_1005665 | All Organisms → Viruses → Predicted Viral | 4750 | Open in IMG/M |
| 3300025655|Ga0208795_1166630 | Not Available | 538 | Open in IMG/M |
| 3300025732|Ga0208784_1008107 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3640 | Open in IMG/M |
| 3300025771|Ga0208427_1238094 | Not Available | 564 | Open in IMG/M |
| 3300025872|Ga0208783_10183814 | Not Available | 872 | Open in IMG/M |
| 3300027142|Ga0255065_1052870 | Not Available | 721 | Open in IMG/M |
| 3300027160|Ga0255198_1032795 | Not Available | 959 | Open in IMG/M |
| 3300027659|Ga0208975_1077841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 984 | Open in IMG/M |
| 3300027736|Ga0209190_1258856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
| 3300027785|Ga0209246_10048340 | All Organisms → Viruses → Predicted Viral | 1638 | Open in IMG/M |
| 3300027963|Ga0209400_1188287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 865 | Open in IMG/M |
| 3300031701|Ga0302120_10070930 | All Organisms → Viruses → Predicted Viral | 1448 | Open in IMG/M |
| 3300031758|Ga0315907_10610995 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 844 | Open in IMG/M |
| 3300031787|Ga0315900_10479107 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ctDWo9 | 951 | Open in IMG/M |
| 3300031787|Ga0315900_10575260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 831 | Open in IMG/M |
| 3300032050|Ga0315906_11365953 | Not Available | 500 | Open in IMG/M |
| 3300032116|Ga0315903_10358455 | All Organisms → Viruses → Predicted Viral | 1205 | Open in IMG/M |
| 3300032116|Ga0315903_10941193 | Not Available | 612 | Open in IMG/M |
| 3300032278|Ga0310345_12418115 | Not Available | 507 | Open in IMG/M |
| 3300033981|Ga0334982_0201116 | Not Available | 984 | Open in IMG/M |
| 3300033993|Ga0334994_0205950 | Not Available | 1060 | Open in IMG/M |
| 3300033996|Ga0334979_0601776 | Not Available | 583 | Open in IMG/M |
| 3300034019|Ga0334998_0663283 | Not Available | 560 | Open in IMG/M |
| 3300034103|Ga0335030_0749959 | Not Available | 579 | Open in IMG/M |
| 3300034119|Ga0335054_0591988 | Not Available | 608 | Open in IMG/M |
| 3300034119|Ga0335054_0748311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
| 3300034121|Ga0335058_0752164 | Not Available | 534 | Open in IMG/M |
| 3300034272|Ga0335049_0772316 | Not Available | 572 | Open in IMG/M |
| 3300034279|Ga0335052_0246640 | Not Available | 1008 | Open in IMG/M |
| 3300034280|Ga0334997_0614784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 669 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 25.50% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 19.46% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 16.78% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.04% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.03% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 4.03% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.36% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 3.36% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.68% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.68% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 2.01% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.34% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.34% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.34% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.67% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.67% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.67% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 0.67% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.67% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.67% |
| Coal-Bed Methane Well | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Coal-Bed Methane Well | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002120 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 | Environmental | Open in IMG/M |
| 3300002733 | Coal-bed methane well microbial communities from Surat Basin, Queensland, Australia, Sample - Codie-8 produced water | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005943 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 | Environmental | Open in IMG/M |
| 3300006340 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770m | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007722 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly) | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008216 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020193 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m | Environmental | Open in IMG/M |
| 3300020198 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020222 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m | Environmental | Open in IMG/M |
| 3300020415 | Marine microbial communities from Tara Oceans - TARA_B100001146 (ERX555973-ERR599166) | Environmental | Open in IMG/M |
| 3300020603 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150m | Environmental | Open in IMG/M |
| 3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300025069 | Marine viral communities from the Pacific Ocean - LP-38 (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027142 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300027160 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Law_RepC_8h | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031701 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Bottom | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
| 3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C687J26616_100536991 | 3300002120 | Soil | YLIIPGLPLQNARQVRAFAATASIIVLHGYVNRIA* |
| codie8draft_10328414 | 3300002733 | Coal-Bed Methane Well | PAESGLTLVAPGLLIKGAGTALVVRAFAATTNVITIHGYVNRVS* |
| Ga0049081_101078541 | 3300005581 | Freshwater Lentic | AGLVIKGNATPLVVRAFCATANVVNIAGFVNRITA* |
| Ga0049081_101532643 | 3300005581 | Freshwater Lentic | IPGLLLKGNATPLVVKAFAGTANVICINGFVNQITV* |
| Ga0049081_103337941 | 3300005581 | Freshwater Lentic | LVTVIAGLLLNGGLTVKAFAGTASVITIHGFVNQIA* |
| Ga0079957_11644154 | 3300005805 | Lake | LISPGLVLKGNATPLVVKAFAATTNVVAVYGYVNRVS* |
| Ga0079957_11697073 | 3300005805 | Lake | PGLVMKGNATPLVVKAFAATTNVVAVYGYVNRIS* |
| Ga0079957_13458832 | 3300005805 | Lake | VLIAPGLIIKGNATPLLVRAFAATANVITIHGYVNRIA* |
| Ga0073926_100862062 | 3300005943 | Sand | GLYLVVPGLVIQGNATAKVVRAFAATASQISIFGYVNRITA* |
| Ga0068503_103676762 | 3300006340 | Marine | EQTITTEGGLTLVAPGLLIKGNSTALIVRAFAATTNLITIHGYVNQITA* |
| Ga0075461_100556081 | 3300006637 | Aqueous | VPGLIIKGNATPLVIAAFAATTSAINIFGYVNRITA* |
| Ga0098035_10430001 | 3300006738 | Marine | GLLIKGNASPLIVKAFAGTTNVITLHGYVNQITA* |
| Ga0070749_100597805 | 3300006802 | Aqueous | GLVTVAPGLLLKGNATPLVIRAFAATADVITIHGFVNQISA* |
| Ga0070749_102412652 | 3300006802 | Aqueous | VTVIPGLLIKGNATALTVRAFAATANVVCIHGFVNQITV* |
| Ga0075460_102968101 | 3300007234 | Aqueous | PEAGLVTVVPGLLIKGNATPLVVKAAAATADVITIHGFVNQISA* |
| Ga0099848_10271001 | 3300007541 | Aqueous | GLVLIAPGLLIKGNASSALVVKAFAATADVITIHGYVNRITA* |
| Ga0099848_10470491 | 3300007541 | Aqueous | NGLYLIAPGLLIKGNASAALVVKAFAATADVITIHGYVNRITA* |
| Ga0099848_10812341 | 3300007541 | Aqueous | LVVPGFVVQGNASALVVKAFCATADVVMIGGYVNEIA* |
| Ga0099848_11631021 | 3300007541 | Aqueous | VTVIPGLLIKGNATALTVRAFAATADVICIHGFVNQITV* |
| Ga0099848_11753832 | 3300007541 | Aqueous | IPGLLIKGNATALTVKAFAATANVICIHGFVNQITV* |
| Ga0099848_12345062 | 3300007541 | Aqueous | VVPGLVLQGNATALVVKAFAATANVVIIHGYVNEIA* |
| Ga0099848_12954132 | 3300007541 | Aqueous | FTVPAEAGLYLIVPALLIQGNATPLVVRTFAATADVIVIHGYINRIS* |
| Ga0099846_10739663 | 3300007542 | Aqueous | LVLIAPGLLIKGNATQLIVKAFAATADVITIHGYVNRIEA* |
| Ga0099846_10968771 | 3300007542 | Aqueous | GLVLVAPGLLIKGNASAALVVKAFCATADVVTIHGYVNQITV* |
| Ga0105051_107056483 | 3300007722 | Freshwater | LIVPGFPLTGSVVVRAFAGTANVIAIHGYINRITA* |
| Ga0110931_11745482 | 3300007963 | Marine | IIVGNGSPKVIAAFAATTSAIQLFGYANRIDVSP* |
| Ga0114898_10669611 | 3300008216 | Deep Ocean | PGLLIKGNASTALIVKAFAGTADLITIHGFVNQIAA* |
| Ga0102860_11937081 | 3300009056 | Estuarine | YLIAAGLLIKGNATPLVVRAFAATTSAINIFGYVNKIA* |
| Ga0102814_101569081 | 3300009079 | Estuarine | ENGLYLIVSGLLLKGNATALTVRAFAATSNVIVLHGYVNRIAV* |
| Ga0114981_104497362 | 3300009160 | Freshwater Lake | VAGLILQGNASAKVVRAFAATASKISIFGYVNRITA* |
| Ga0114981_105327832 | 3300009160 | Freshwater Lake | YLIVPGLVLQGNATPKVVKAFAATANVIVIHGYVNRITA* |
| Ga0098047_102873991 | 3300010155 | Marine | EVTVTAESGLMLVAPGLLIKGNGTPLVVRAWASVADDIIIHGYVNQITA* |
| Ga0129333_103887881 | 3300010354 | Freshwater To Marine Saline Gradient | TVVPGLVIKGNATPLVVRAFAATADVVVIHGFVNQITA* |
| Ga0129333_104980731 | 3300010354 | Freshwater To Marine Saline Gradient | GLLLQGNATAKVVRAFAATANVICIHGFVNRITV* |
| Ga0129333_105543452 | 3300010354 | Freshwater To Marine Saline Gradient | GLILKGNATALVVRAFAATANVITISGYVNRITA* |
| Ga0129333_105553053 | 3300010354 | Freshwater To Marine Saline Gradient | SGLLLVVPGLVIKGNATALVVRAFAASANVVMIGGYVNRITA* |
| Ga0129333_107399903 | 3300010354 | Freshwater To Marine Saline Gradient | LILVVPGLVIKGNATALVVRAFAATTNVVMIGGYVNRITA* |
| Ga0129324_100327296 | 3300010368 | Freshwater To Marine Saline Gradient | VVAGNLIKGNATPLVVRAFAATANVIVVHGYVNRITA* |
| Ga0153805_10305901 | 3300012013 | Surface Ice | LSIAAESGLVLVSPGLVIKGNATPLLVRAFAATANVINIAGYVNRITV* |
| Ga0164292_103160501 | 3300013005 | Freshwater | VLVVPGLPIKGNASALVVRAFCATANVVMIHGWVNTIS* |
| (restricted) Ga0172367_105357471 | 3300013126 | Freshwater | TAESGLVLVVPGLVLQGNATALVVRAFAATANVISIAGYVNEITV* |
| (restricted) Ga0172373_103411103 | 3300013131 | Freshwater | VLVVPGLVLQGNATALVVRAFAATANVISIAGYVNEITV* |
| (restricted) Ga0172373_105345552 | 3300013131 | Freshwater | GLFLIVPGLVLKGNATPLTVKASAGTTNVISLVGYVNRITA* |
| (restricted) Ga0172372_100879591 | 3300013132 | Freshwater | AESGFVLVVAGLVLQGNATALVVRAFAATANVINIAGYVNEITV* |
| (restricted) Ga0172372_102350953 | 3300013132 | Freshwater | LLVVPGLVIKGNATALIVRAFAASANVVMIGGYVNRITA* |
| (restricted) Ga0172372_102446603 | 3300013132 | Freshwater | TTQSGLILVVAGLVIQGNASAKVVRAFAATANQISLFGYVNRITA* |
| (restricted) Ga0172372_102499353 | 3300013132 | Freshwater | LLLVVPGLVIKGNATALVVRAFAATANVVMIGGYVNRITA* |
| (restricted) Ga0172372_103484051 | 3300013132 | Freshwater | VIPGFLLQGNATAKVVRAFAATANVILIHGFVNRITV* |
| (restricted) Ga0172372_103493861 | 3300013132 | Freshwater | VPGLVLQGNATALVVRAFAATANVISIAGYVNEITV* |
| (restricted) Ga0172375_108184901 | 3300013137 | Freshwater | GLVTVAPGLLIKGNASAALVVRAFAGTANVITIHGFVNQITV* |
| Ga0177922_101364933 | 3300013372 | Freshwater | EFTVTAESGLFLIVPGLVLQGNATALIVRAFCATANVVSIGGYVNEIS* |
| Ga0177922_102240672 | 3300013372 | Freshwater | VLVCAGLVIQGNATAKVVRAFAGTASKIEIFGYVNRITA* |
| Ga0177922_107273591 | 3300013372 | Freshwater | TVKAENGLYLIIPGLVLKGNATALTVKAFAGTADVILLTGYVNVIA* |
| Ga0177922_111915234 | 3300013372 | Freshwater | YLIVPGLVLKGNSSAALVVRAFAATTNVISIAGYVNRITA* |
| (restricted) Ga0172376_1002318213 | 3300014720 | Freshwater | VPGLVIKGNATALVVRAFAATANVVMIGGYVNRITA* |
| (restricted) Ga0172376_101710141 | 3300014720 | Freshwater | VVPGLVIKGNATALIVRAFAASANVVMIGGYVNRITA* |
| (restricted) Ga0172376_102314661 | 3300014720 | Freshwater | GLVLQGNATALVVRAFAATANVISIAGYVNEITV* |
| (restricted) Ga0172376_104926722 | 3300014720 | Freshwater | GLVIQGNASAKVVRAFAATANQISLFGYVNRITA* |
| (restricted) Ga0172376_105076091 | 3300014720 | Freshwater | VTVVPGFLLQGHATPKVVRAFAGTANVICIHGFVNRITA* |
| Ga0181364_10222661 | 3300017701 | Freshwater Lake | GLYLLVPGLPLQGNATALVVKAFAATANVVIIHGFVNEIA |
| Ga0181362_10074124 | 3300017723 | Freshwater Lake | ELTIAAESGLVLVVPGLLIKGNATALVVRAFAATTSAINIFGYVNKIA |
| Ga0181362_10482091 | 3300017723 | Freshwater Lake | EYTVKAENGLYLVVPGLVLQGNATALTIAAFAATTSAINIFGYVNEIA |
| Ga0181362_10799742 | 3300017723 | Freshwater Lake | EFTVPAESGLYLITAGLVIKGNATPLLVRAFCATANVVMIAGFVNRIAV |
| Ga0181365_10193881 | 3300017736 | Freshwater Lake | ENGLYLVVPGLVLQGNATALTIAAFAATTSAINIFGYVNEIA |
| Ga0181365_10224004 | 3300017736 | Freshwater Lake | CAGLVIQGNATAKVVRAFAGTASKIEIFGFVNRITA |
| Ga0181365_10292721 | 3300017736 | Freshwater Lake | SGLYLLVPGLPLQGNATALVVKAFAATANVVIIHGFVNEIA |
| Ga0181365_10633941 | 3300017736 | Freshwater Lake | VPAESGLYLITAGLVIKGNATPLVVRAFCASANVVMIAGFVNRIAV |
| Ga0181356_10581693 | 3300017761 | Freshwater Lake | VTAESGLFLIVPGLVLQGNATALIVRAFCATANVVSVGGYVNEIS |
| Ga0181356_10710281 | 3300017761 | Freshwater Lake | YTVKAENGLYLVVPGLVLQGNATALTIAAFAATTSAINIFGYVNEIA |
| Ga0181356_10832702 | 3300017761 | Freshwater Lake | VTTQDGLVLVCAGLVVQGNATAKVVRAFAATASQISIFGYVNRITA |
| Ga0181356_10852684 | 3300017761 | Freshwater Lake | VTTQDGLVLVCAGLVVQGNATAKVVRAFAATASQISIFGYVNRIA |
| Ga0181356_12376511 | 3300017761 | Freshwater Lake | IVPGLVIKGNATPLIVRAFCATASVVNIAGFVNRIAV |
| Ga0181343_10242111 | 3300017766 | Freshwater Lake | AGLLIKGNASALVVRAFAATTNVICISGYVNRITA |
| Ga0181358_10894152 | 3300017774 | Freshwater Lake | VPGLVLQGNATALTIAAFAATTSAINIFGYVNEIA |
| Ga0181358_10940772 | 3300017774 | Freshwater Lake | GLFLIVPGLVLQGNATALNVRAFCATANVVSVGGYVNEIS |
| Ga0181358_11653352 | 3300017774 | Freshwater Lake | AEDGLYVVVAGLVIKGNATPLVVRAFCATANVVMIAGYVNRITA |
| Ga0181358_11776661 | 3300017774 | Freshwater Lake | AEDGLYVVVAGLVIKGNATPLVVRAFCASANVVMIAGYVNRITA |
| Ga0181357_10693221 | 3300017777 | Freshwater Lake | ITAGLVIKGNATPLVVRAFCATANVVMIAGFVNRITA |
| Ga0181357_10799434 | 3300017777 | Freshwater Lake | VTVIPGLLLKGNATALVVKAFAGTANVICLHGYVNQITV |
| Ga0181357_10936301 | 3300017777 | Freshwater Lake | LVLVCAGLVVQGNATQKVIRAFAGTASKIEIFGFVNRIA |
| Ga0181357_12226032 | 3300017777 | Freshwater Lake | VIPGLLLKGNATALVVKAFAATANVICIHGFVNQITV |
| Ga0181357_12234671 | 3300017777 | Freshwater Lake | IVPGLLIKGNASALTVKAFAATTNVIVVHGYVNVIA |
| Ga0181346_10431784 | 3300017780 | Freshwater Lake | SGLVLVCAGLVIQGNATAKVVRAFAGTASKIEIFGFVNRITA |
| Ga0181346_11139591 | 3300017780 | Freshwater Lake | GDIIEYTVKAENGLYLVIPGLVLQGNATALTIAAFAATTSAINIFGYVNEIA |
| Ga0181346_12374902 | 3300017780 | Freshwater Lake | YLLVPGLPLQGNATALVVKAFAATANVVIIHGFVNEIV |
| Ga0181348_10304994 | 3300017784 | Freshwater Lake | RAENGLYLVVPGLVLQGNATALTIAAFAATTSAINIFGYVNEIA |
| Ga0181355_11109381 | 3300017785 | Freshwater Lake | TAGGDIIEYTVKAENGSYLVVPGLVLQGNATALTIAAFAATTSAINIFGYVNEIA |
| Ga0181355_11536952 | 3300017785 | Freshwater Lake | AGGDIMELTIAAESGLVLVVPGLLTKGNATALVVRAFAATTSAINIFGYVNKIA |
| Ga0181355_13590582 | 3300017785 | Freshwater Lake | LYLIVAGLVIKGNATPLVVRAFCATASVVNIAGFVNRIAV |
| Ga0169931_102422761 | 3300017788 | Freshwater | ESGLVLVVPGLVLQGNATALVVRAFAATANVISIAGYVNEITV |
| Ga0181359_10349334 | 3300019784 | Freshwater Lake | MELTIAAESGLVLVVPGLILKGVATALEVRAFAATTSAINIFGYVNKIVA |
| Ga0181359_10511821 | 3300019784 | Freshwater Lake | EYTVKAENGLYLVIPGLVLQGNATALTIAAFAATTSAINIFGYVNEIA |
| Ga0181359_10825953 | 3300019784 | Freshwater Lake | ICAGLVIQGNATAKVVRAFAATASQVSLFGYVNRITA |
| Ga0194113_104501153 | 3300020074 | Freshwater Lake | LVVPGLVVQGNATAKVVRAFAATASQISIFGYVNRITV |
| Ga0194113_110602842 | 3300020074 | Freshwater Lake | EAGLVTVAPGLIIKGAASALIIKASAATANVITIHGFVNRITV |
| Ga0194131_101953112 | 3300020193 | Freshwater Lake | LVLVVPGLVIKGNSTALVVRAFAATANVINIAGYVNRITA |
| Ga0194131_102516382 | 3300020193 | Freshwater Lake | TVIPGLPLQGNATAKVVRAFAATADVILIHGFVNRITA |
| Ga0194120_105510072 | 3300020198 | Freshwater Lake | LTVTAESGLVLVVPGLVLQGNATALVVRAFAATANVISIAGYVNEITV |
| Ga0211731_109444882 | 3300020205 | Freshwater | ESGLVLVVPGLLIKGNATALVVRAFAATTSAINIFGYVNKIA |
| Ga0194119_108080281 | 3300020220 | Freshwater Lake | TVTAESGLVLVVPGLVLQGNATALVVRAFAATANVISIAGYVNEITV |
| Ga0194125_103539791 | 3300020222 | Freshwater Lake | AAASGLVLMVPGLVIQGNATPKIVRAFAATASKISIFGYVNRITV |
| Ga0211553_102823651 | 3300020415 | Marine | VLLAPGLLIQGNSTPLIVRAFAATANVITIHGYINQIA |
| Ga0194126_105821881 | 3300020603 | Freshwater Lake | ASGLVLMVPGLVIQGNATPKIVRAFAATASKISIFGYVNRITV |
| Ga0194133_104466851 | 3300021091 | Freshwater Lake | LVVPGLVIKGNATALVVRAFAATANVVMIGGYVNRITA |
| Ga0222713_108502291 | 3300021962 | Estuarine Water | VSPGLVLKGNATPLTVKAFAATTNVVTIHGYVNRIS |
| Ga0222712_107286032 | 3300021963 | Estuarine Water | IVPGLVIKGNATALVVRAFAATANVVNIAGYVNRITA |
| Ga0181354_10849722 | 3300022190 | Freshwater Lake | TVIPGLLIKGNATALVVKAFAATANVICIHGFVNQITV |
| Ga0196905_10151871 | 3300022198 | Aqueous | VVPGLVIKGNATPLVVRAFAATADVVVIHGFVNQITA |
| Ga0196905_10974262 | 3300022198 | Aqueous | GLVTVIPGLLIKGNATALVVRAFAATANVICIHGFVNQITV |
| Ga0196901_10720121 | 3300022200 | Aqueous | PGLLLQGNATAKVVRAFAGTADVICIHGYVNRITV |
| Ga0196901_11313221 | 3300022200 | Aqueous | VTVLPEAGLVTVIPGLLLQGNATAKVVRAFAGTADVICIHGYVNRITV |
| Ga0196901_12022222 | 3300022200 | Aqueous | LVTVIPGLLIKGNATALTVKAFAATTNVICIHGFVNQITV |
| Ga0181351_10491684 | 3300022407 | Freshwater Lake | GLVTVIPGLPLQGNATALVVKAFAATASVVVIHGFVNEIA |
| Ga0181351_10912351 | 3300022407 | Freshwater Lake | LVTIIPGLPIQGNATAKVVRAFAATADVVVLYGFVNRITV |
| Ga0181351_11911401 | 3300022407 | Freshwater Lake | IAGLVIKGNATPLLVRAFAATANVINIAGYVNRITA |
| Ga0214917_104117332 | 3300022752 | Freshwater | VPGLVIKGNASAALVVRAFAGTTNVINIAGYVNRITA |
| Ga0207887_10804392 | 3300025069 | Marine | PGLVLKGNASTALEVRAFAATTSAIQLFGYVNQITA |
| Ga0208161_11052172 | 3300025646 | Aqueous | DDLIELTIAAESGLVLVSPGLVIKGNATPLVIRAFAATADVINIFGYVNQITA |
| Ga0208161_11443782 | 3300025646 | Aqueous | VPGLVLQGNATALVVKAFAATANVVIIHGYVNEIA |
| Ga0208795_10056651 | 3300025655 | Aqueous | GLVLIAPGLLIKGNATQLIVKAFAATADVITIHGYVNRIEA |
| Ga0208795_11666301 | 3300025655 | Aqueous | TVVPGLVIKGNATPLVVRAFAATADVVVVHGFVNQITA |
| Ga0208784_10081071 | 3300025732 | Aqueous | LIVPGLLLKGNATALTVKAFAATTNVIAIHGFVNQIA |
| Ga0208427_12380942 | 3300025771 | Aqueous | TIAPGLLIKGNATPLVVKAFAATADVITIHGFVNQITV |
| Ga0208783_101838141 | 3300025872 | Aqueous | VAPGLLIKGNATALVVRAFAATANVITIHGFVNQITA |
| Ga0255065_10528702 | 3300027142 | Freshwater | VPGLIIKGNATALEVRAFAATTSAINIFGYVNKIA |
| Ga0255198_10327951 | 3300027160 | Freshwater | LIVPGLVLQGNATALVVKAFAATANVVIIHGYVNEIA |
| Ga0208975_10778411 | 3300027659 | Freshwater Lentic | PGLLLQGNATAKVVRAFAGTANVIMIHGFVNRITV |
| Ga0209190_12588561 | 3300027736 | Freshwater Lake | NGLYLVVPGLVIQGNATAKVVRAFAATASQISIFGYINRITA |
| Ga0209246_100483404 | 3300027785 | Freshwater Lake | VVPGLVLQGNATALTIAAFAATTSAINIFGYVNEIA |
| Ga0209400_11882872 | 3300027963 | Freshwater Lake | TVKAENGLYLIVPGLLLQGNATAKVVKAFAATTNVIVIHGYVNRIA |
| Ga0302120_100709301 | 3300031701 | Marine | LVAPGLLIKGNSTALIVRAFAATTNLITIHGYVNQITA |
| Ga0315907_106109952 | 3300031758 | Freshwater | LPEAGLVTIVPGLVLQGNATARVVRAFAPTADVIVVYGFVNRISV |
| Ga0315900_104791072 | 3300031787 | Freshwater | IVPGFPIKGNATPLVVRAYAATTNVITIHGFVNRIEA |
| Ga0315900_105752601 | 3300031787 | Freshwater | LIAPGLLIKGNATPLVVRAFAATTNVISIHGYVNTIT |
| Ga0315906_113659531 | 3300032050 | Freshwater | PGLVLKGNATALVIRAFAATANVVTISGYVNRITA |
| Ga0315903_103584551 | 3300032116 | Freshwater | VPGFPIKGNATPLVVRAYAATTNVITIHGFVNRIEA |
| Ga0315903_109411932 | 3300032116 | Freshwater | LVLVVPGLVVTGSVVVRAFCATANVVNIVGFVNRIS |
| Ga0310345_124181152 | 3300032278 | Seawater | IPTEAGLVLVVPGLIIKGNASTALEVRAFAATTSAIQLFGYVNQIAA |
| Ga0334982_0201116_3_122 | 3300033981 | Freshwater | LVLVVPGLPIKGNASALVVRAFCATANVVMIHGWVNTIS |
| Ga0334994_0205950_939_1055 | 3300033993 | Freshwater | VLVVPGLPIKGNASALVVRAFCATANVVMIHGWVNTIS |
| Ga0334979_0601776_1_111 | 3300033996 | Freshwater | VVPGLPIKGNASALVVRAFCATANVVMIHGWVNTIS |
| Ga0334998_0663283_3_128 | 3300034019 | Freshwater | GLILVVAGLIIVGNATPLVVRAFAASANVVMIGGYVNRITV |
| Ga0335030_0749959_455_577 | 3300034103 | Freshwater | LYLIVPGLILKGNATALVVRAFAATANVITISGYVNRITA |
| Ga0335054_0591988_478_606 | 3300034119 | Freshwater | NGLYLIVPGLILKGNTTPLVIAAFAATTSAINIFGYVNRITA |
| Ga0335054_0748311_1_111 | 3300034119 | Freshwater | IPGLIIKGNTTPLVVAAFAATTSAINIFGYVNRITG |
| Ga0335058_0752164_402_533 | 3300034121 | Freshwater | AENGLYLIVPGLVLQGNATALIVRAFCATANVVSIAGYVNEIA |
| Ga0335049_0772316_464_571 | 3300034272 | Freshwater | PGLIIKGNATPLVVAAFAATTSAINIFGYVNRITA |
| Ga0335052_0246640_875_1006 | 3300034279 | Freshwater | PEAGLVLVVPGLPIKGNASALVVRAFCATANVVMIHGWVNTIS |
| Ga0334997_0614784_3_110 | 3300034280 | Freshwater | PGLLLQGNATAKVVKAFAATTNVIVIHGYVNRITA |
| ⦗Top⦘ |