Basic Information | |
---|---|
Family ID | F047671 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 149 |
Average Sequence Length | 43 residues |
Representative Sequence | AALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPNDKAFGSTGK |
Number of Associated Samples | 110 |
Number of Associated Scaffolds | 149 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 4.73 % |
% of genes near scaffold ends (potentially truncated) | 61.07 % |
% of genes from short scaffolds (< 2000 bps) | 85.23 % |
Associated GOLD sequencing projects | 108 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (75.168 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (32.215 % of family members) |
Environment Ontology (ENVO) | Unclassified (66.443 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (50.336 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.28% β-sheet: 0.00% Coil/Unstructured: 59.72% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 149 Family Scaffolds |
---|---|---|
PF05257 | CHAP | 15.44 |
PF04404 | ERF | 2.68 |
PF01844 | HNH | 2.68 |
PF04586 | Peptidase_S78 | 1.34 |
PF07733 | DNA_pol3_alpha | 0.67 |
PF13671 | AAA_33 | 0.67 |
PF13539 | Peptidase_M15_4 | 0.67 |
PF05065 | Phage_capsid | 0.67 |
COG ID | Name | Functional Category | % Frequency in 149 Family Scaffolds |
---|---|---|---|
COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 1.34 |
COG0587 | DNA polymerase III, alpha subunit | Replication, recombination and repair [L] | 0.67 |
COG2176 | DNA polymerase III, alpha subunit (gram-positive type) | Replication, recombination and repair [L] | 0.67 |
COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.67 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 80.54 % |
Unclassified | root | N/A | 19.46 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000124|BS_KBA_SWE12_21mDRAFT_c10178600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
3300002408|B570J29032_109105514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
3300002408|B570J29032_109690248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1063 | Open in IMG/M |
3300003277|JGI25908J49247_10150532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
3300003431|JGI25913J50563_1035257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
3300004282|Ga0066599_100326743 | Not Available | 918 | Open in IMG/M |
3300005662|Ga0078894_11219125 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
3300005805|Ga0079957_1156557 | All Organisms → Viruses → Predicted Viral | 1152 | Open in IMG/M |
3300006484|Ga0070744_10206114 | Not Available | 559 | Open in IMG/M |
3300007304|Ga0102689_1697579 | Not Available | 857 | Open in IMG/M |
3300007640|Ga0070751_1343036 | Not Available | 549 | Open in IMG/M |
3300007972|Ga0105745_1278782 | Not Available | 542 | Open in IMG/M |
3300008055|Ga0108970_11059671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2305 | Open in IMG/M |
3300008108|Ga0114341_10059402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2450 | Open in IMG/M |
3300008111|Ga0114344_1253536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
3300008119|Ga0114354_1019454 | All Organisms → cellular organisms → Bacteria | 3076 | Open in IMG/M |
3300008119|Ga0114354_1100018 | Not Available | 1151 | Open in IMG/M |
3300008119|Ga0114354_1114234 | Not Available | 1052 | Open in IMG/M |
3300008266|Ga0114363_1016115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3383 | Open in IMG/M |
3300008266|Ga0114363_1175645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
3300008339|Ga0114878_1233080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
3300008448|Ga0114876_1035393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2395 | Open in IMG/M |
3300008448|Ga0114876_1081552 | Not Available | 1341 | Open in IMG/M |
3300008450|Ga0114880_1135488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 906 | Open in IMG/M |
3300008450|Ga0114880_1235765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
3300009026|Ga0102829_1186857 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
3300009068|Ga0114973_10274599 | Not Available | 903 | Open in IMG/M |
3300009082|Ga0105099_10240290 | Not Available | 1047 | Open in IMG/M |
3300009082|Ga0105099_10450820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 774 | Open in IMG/M |
3300009085|Ga0105103_10928326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
3300009152|Ga0114980_10274904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 981 | Open in IMG/M |
3300009155|Ga0114968_10002043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15563 | Open in IMG/M |
3300009160|Ga0114981_10364837 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
3300009161|Ga0114966_10303076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 966 | Open in IMG/M |
3300009161|Ga0114966_10666858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
3300009164|Ga0114975_10650289 | Not Available | 559 | Open in IMG/M |
3300009165|Ga0105102_10461761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
3300009165|Ga0105102_10559871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
3300009168|Ga0105104_10824456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
3300009170|Ga0105096_10764135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
3300009183|Ga0114974_10008696 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7427 | Open in IMG/M |
3300010354|Ga0129333_11173378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
3300010885|Ga0133913_13146357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1093 | Open in IMG/M |
3300011010|Ga0139557_1017878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1319 | Open in IMG/M |
3300011010|Ga0139557_1078336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
3300011011|Ga0139556_1025597 | Not Available | 859 | Open in IMG/M |
3300011336|Ga0153703_1405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14955 | Open in IMG/M |
3300011339|Ga0153700_10806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15020 | Open in IMG/M |
3300012663|Ga0157203_1030284 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 760 | Open in IMG/M |
3300012666|Ga0157498_1053210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
3300012724|Ga0157611_1111706 | Not Available | 601 | Open in IMG/M |
3300012731|Ga0157616_1334191 | All Organisms → Viruses → Predicted Viral | 2521 | Open in IMG/M |
3300013004|Ga0164293_10010435 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7799 | Open in IMG/M |
3300013004|Ga0164293_10224679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1341 | Open in IMG/M |
3300013004|Ga0164293_10621405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
3300013004|Ga0164293_10870289 | Not Available | 568 | Open in IMG/M |
3300013004|Ga0164293_10900577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C455 | 556 | Open in IMG/M |
3300013005|Ga0164292_10192495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1458 | Open in IMG/M |
3300013005|Ga0164292_10195803 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1442 | Open in IMG/M |
3300013005|Ga0164292_10479954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 817 | Open in IMG/M |
3300013295|Ga0170791_13065477 | Not Available | 577 | Open in IMG/M |
3300013372|Ga0177922_10864387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 931 | Open in IMG/M |
3300014811|Ga0119960_1088859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
3300017707|Ga0181363_1050109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 749 | Open in IMG/M |
3300017723|Ga0181362_1070855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 708 | Open in IMG/M |
3300017736|Ga0181365_1082855 | Not Available | 785 | Open in IMG/M |
3300017766|Ga0181343_1057030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1140 | Open in IMG/M |
3300017777|Ga0181357_1170887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 791 | Open in IMG/M |
3300017777|Ga0181357_1187634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
3300017777|Ga0181357_1319959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300017784|Ga0181348_1107112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1086 | Open in IMG/M |
3300017784|Ga0181348_1218714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 673 | Open in IMG/M |
3300017784|Ga0181348_1259792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
3300017785|Ga0181355_1380728 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
3300019784|Ga0181359_1121129 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 935 | Open in IMG/M |
3300019784|Ga0181359_1212333 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
3300020048|Ga0207193_1325794 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1072 | Open in IMG/M |
3300020160|Ga0211733_10108359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
3300020162|Ga0211735_10619062 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 922 | Open in IMG/M |
3300020162|Ga0211735_11312002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 919 | Open in IMG/M |
3300020573|Ga0208485_1013801 | Not Available | 1757 | Open in IMG/M |
3300021963|Ga0222712_10271645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1075 | Open in IMG/M |
3300021963|Ga0222712_10718931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
3300024346|Ga0244775_10067440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3075 | Open in IMG/M |
3300024514|Ga0255177_1057322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
3300025080|Ga0209103_1034823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
3300025848|Ga0208005_1048016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1323 | Open in IMG/M |
3300025889|Ga0208644_1135086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1155 | Open in IMG/M |
3300025889|Ga0208644_1395494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
3300027212|Ga0208554_1003978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2368 | Open in IMG/M |
3300027621|Ga0208951_1081889 | Not Available | 900 | Open in IMG/M |
3300027697|Ga0209033_1020369 | All Organisms → Viruses → Predicted Viral | 2706 | Open in IMG/M |
3300027732|Ga0209442_1232432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
3300027734|Ga0209087_1349178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
3300027764|Ga0209134_10261440 | Not Available | 592 | Open in IMG/M |
3300027798|Ga0209353_10151531 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1033 | Open in IMG/M |
3300027808|Ga0209354_10416130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
3300027900|Ga0209253_10765333 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 690 | Open in IMG/M |
3300027983|Ga0209284_10097964 | Not Available | 1561 | Open in IMG/M |
3300031566|Ga0307378_10647016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 918 | Open in IMG/M |
3300031787|Ga0315900_10323910 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1261 | Open in IMG/M |
3300031787|Ga0315900_11097989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
3300031857|Ga0315909_10017093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7411 | Open in IMG/M |
3300031857|Ga0315909_10521055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 815 | Open in IMG/M |
3300031963|Ga0315901_10645470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 795 | Open in IMG/M |
3300032092|Ga0315905_10101993 | Not Available | 2893 | Open in IMG/M |
3300032116|Ga0315903_10841085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
3300032116|Ga0315903_10986694 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
3300032177|Ga0315276_12044769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
3300032401|Ga0315275_10795361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1049 | Open in IMG/M |
3300033816|Ga0334980_0159761 | Not Available | 918 | Open in IMG/M |
3300033981|Ga0334982_0325320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
3300033993|Ga0334994_0025560 | All Organisms → Viruses → Predicted Viral | 3875 | Open in IMG/M |
3300033993|Ga0334994_0108453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1619 | Open in IMG/M |
3300033993|Ga0334994_0148735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1319 | Open in IMG/M |
3300033993|Ga0334994_0216031 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1026 | Open in IMG/M |
3300033993|Ga0334994_0385617 | Not Available | 682 | Open in IMG/M |
3300033994|Ga0334996_0031152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3407 | Open in IMG/M |
3300033994|Ga0334996_0245396 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 924 | Open in IMG/M |
3300033996|Ga0334979_0143618 | Not Available | 1449 | Open in IMG/M |
3300033996|Ga0334979_0179266 | All Organisms → Viruses → Predicted Viral | 1262 | Open in IMG/M |
3300033996|Ga0334979_0208743 | Not Available | 1148 | Open in IMG/M |
3300034012|Ga0334986_0209846 | Not Available | 1083 | Open in IMG/M |
3300034013|Ga0334991_0267953 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
3300034020|Ga0335002_0657542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
3300034050|Ga0335023_0026229 | All Organisms → Viruses → Predicted Viral | 3415 | Open in IMG/M |
3300034060|Ga0334983_0715704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
3300034061|Ga0334987_0047097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3610 | Open in IMG/M |
3300034062|Ga0334995_0423638 | Not Available | 825 | Open in IMG/M |
3300034062|Ga0334995_0705419 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
3300034063|Ga0335000_0453389 | Not Available | 750 | Open in IMG/M |
3300034092|Ga0335010_0357724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 814 | Open in IMG/M |
3300034093|Ga0335012_0300727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 814 | Open in IMG/M |
3300034095|Ga0335022_0583507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
3300034101|Ga0335027_0089097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2380 | Open in IMG/M |
3300034101|Ga0335027_0520449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 741 | Open in IMG/M |
3300034104|Ga0335031_0344808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 954 | Open in IMG/M |
3300034104|Ga0335031_0851244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
3300034105|Ga0335035_0530868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
3300034107|Ga0335037_0065805 | All Organisms → Viruses → Predicted Viral | 1957 | Open in IMG/M |
3300034167|Ga0335017_0533933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
3300034272|Ga0335049_0751210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
3300034279|Ga0335052_0395301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 737 | Open in IMG/M |
3300034283|Ga0335007_0276828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1114 | Open in IMG/M |
3300034283|Ga0335007_0355620 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 935 | Open in IMG/M |
3300034356|Ga0335048_0321709 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 794 | Open in IMG/M |
3300034356|Ga0335048_0403144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
3300034357|Ga0335064_0843413 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 557 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 32.21% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 14.77% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.71% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.37% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.70% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.70% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.03% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.36% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.68% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.01% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 2.01% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.01% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.34% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 1.34% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.34% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.34% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.67% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.67% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.67% |
Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.67% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.67% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.67% |
Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.67% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.67% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.67% |
Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.67% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.67% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.67% |
Marine | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine | 0.67% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.67% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.67% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000124 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21m | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003431 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN | Environmental | Open in IMG/M |
3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300007304 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008339 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigs | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
3300011336 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Paldang | Environmental | Open in IMG/M |
3300011339 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Hannam | Environmental | Open in IMG/M |
3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
3300012724 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES138 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012731 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES145 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020573 | Freshwater microbial communities from Lake Mendota, WI - 17JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024514 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8d | Environmental | Open in IMG/M |
3300025080 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - 4C3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300027212 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 (SPAdes) | Environmental | Open in IMG/M |
3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300027983 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 (SPAdes) | Environmental | Open in IMG/M |
3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
3300034050 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095 | Environmental | Open in IMG/M |
3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
3300034107 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133 | Environmental | Open in IMG/M |
3300034167 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082 | Environmental | Open in IMG/M |
3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
3300034357 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
BS_KBA_SWE12_21mDRAFT_101786001 | 3300000124 | Marine | AALALYMAGEQDPKTLAMAGVAAVAPVILRWLNPNDKSFGNLGK* |
B570J29032_1091055142 | 3300002408 | Freshwater | SFMAAVLALYMAGVTDPKTLAMAGVAAIAPVVLRWLNPQDKSFGLTGK* |
B570J29032_1096902481 | 3300002408 | Freshwater | RSFMAAALALYLAGVTDPKTLAMGGVAAVAPVILRWLNPQDKSFGLSGK* |
JGI25908J49247_101505321 | 3300003277 | Freshwater Lake | YIAAALAVYMAGGDWKQIAMGGVAAVVPVILRWLNPADKAFGSTGK* |
JGI25913J50563_10352571 | 3300003431 | Freshwater Lake | AAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPSDASFGVSKK* |
Ga0066599_1003267433 | 3300004282 | Freshwater | ALYMAGVTDPKTLAMAGGAAVAPVILRWLNPNDAAFGVKGK* |
Ga0078894_112191251 | 3300005662 | Freshwater Lake | LTLYMAGVNDPKTLLMAGVAAIAPVVLRYLNPNDKSFGVTGE* |
Ga0079957_11565571 | 3300005805 | Lake | GLAVYLAGVTEPKAIAMAGVSAVAPVILRWLNPNDSAFGRSKG* |
Ga0070744_102061142 | 3300006484 | Estuarine | MAGVTDPKTLAMAGVAAVAPVVLRWLNPQDKSFGLTGK* |
Ga0102689_16975792 | 3300007304 | Freshwater Lake | MAAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPNDKAFGSTGK* |
Ga0102873_12450051 | 3300007545 | Estuarine | YMTGNTNPKDLAMAGVAAVAPVLLRALNPNDKSFGVTK* |
Ga0070751_13430362 | 3300007640 | Aqueous | MAAALALFMAGVTDPKTLAMGGIAAIAPVVLRWLNPNDNIGSTGK* |
Ga0105745_12787821 | 3300007972 | Estuary Water | MAAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNANDKAFGSTGK* |
Ga0108970_110596714 | 3300008055 | Estuary | MLALYMAGITDPKVLLHAGIAAIAPVVLRAVNPKDKSFGVTGE* |
Ga0114341_100594025 | 3300008108 | Freshwater, Plankton | MAGVTDPKALLMAGGAAVAPVVLRYLNPNDKSFGVTGE* |
Ga0114344_12535362 | 3300008111 | Freshwater, Plankton | MLALYMAGIQDPKVLLHAGLAAIAPVLLRTINPKDKSFGVTGE* |
Ga0114354_10194545 | 3300008119 | Freshwater, Plankton | MAGVTDPKTLLMAGVAAIAPVVLRYLNPNDKSFGVTGE* |
Ga0114354_11000183 | 3300008119 | Freshwater, Plankton | MLALYMAGITDPKVLLHAGIAAVAPVLLRAVNPKDKSFGVTGE* |
Ga0114354_11142343 | 3300008119 | Freshwater, Plankton | MLALYMAGITDPKVLLHAGIAAVAPVLLRAINPKDKSFGVTGE* |
Ga0114363_10161154 | 3300008266 | Freshwater, Plankton | MAAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPQDKSFGLTGK* |
Ga0114363_11756452 | 3300008266 | Freshwater, Plankton | MAGGDIKAMAMGGVAAVVPVILRWLNPADKAFGSTGK* |
Ga0114878_12330801 | 3300008339 | Freshwater Lake | ALALYMAGVTDPKTLAMAGAAAVAPVILRWLNPNDASFGVGKE* |
Ga0114876_10353937 | 3300008448 | Freshwater Lake | FAAALALYMAGETDPKTLAMAGGAAVAPVVLRWLNPNDSAFGVTRGR* |
Ga0114876_10815524 | 3300008448 | Freshwater Lake | MAGVSDPKTLLMAGVAAIAPVVLRYLNPNDKSFGVTGE* |
Ga0114880_11354883 | 3300008450 | Freshwater Lake | MAAALALYLAGVTDPKTLAMGGVAAVAPVVLRWLNPDDKAFGSTGK* |
Ga0114880_12357651 | 3300008450 | Freshwater Lake | LTLYMAGVTDPKTLLMAGVAAIAPVVLRYLNPNDKSFGVTGE* |
Ga0102829_11868572 | 3300009026 | Estuarine | MAGVTDPKTLAMAGAAAVAPVILRWLNPKDASFGVGKE* |
Ga0114973_102745992 | 3300009068 | Freshwater Lake | MLALYMAGVTDPEVLLHAGIAAIAPVVLRAVNPKDKSFGVTGE* |
Ga0105099_102402901 | 3300009082 | Freshwater Sediment | MAAALALYMAGVTDPKALAMGGVAAVAPVILRWLNPNDQS |
Ga0105099_104508202 | 3300009082 | Freshwater Sediment | MAAAIAVYMTGETDPKTLGMAGLAAVLPVILRWLNPNDAAFGLKGK* |
Ga0105103_109283261 | 3300009085 | Freshwater Sediment | GGDIKAMAMGGVAAVVPVILRWLNPADKAFGSTGK* |
Ga0114980_102749041 | 3300009152 | Freshwater Lake | IAVYMAGITDPKAILYAGLSSVLPVILRYINPKDKSFGVTGE* |
Ga0114968_100020436 | 3300009155 | Freshwater Lake | MAGVTDPKKLLMAGVAAIAPVVLRYLNPNDKSFGVTGE* |
Ga0114981_103648371 | 3300009160 | Freshwater Lake | MAGVTDPKTLLMAGVAAVAPVILRWLNPNDKSFGVTGE* |
Ga0114966_103030764 | 3300009161 | Freshwater Lake | SYLAAALAVYMAGGTFQQMLMGGVAAVLPVLLRWLNSDDKEFGLGSK* |
Ga0114966_106668582 | 3300009161 | Freshwater Lake | YMAGVTDPKAILSAGIAAVVPVLMRWLNPNDQVYGRK* |
Ga0114975_106502892 | 3300009164 | Freshwater Lake | MAAALALYMAGVQDPKTLAMGGIAAIAPVVLRWLNPNDKIGSTGK* |
Ga0105102_104617611 | 3300009165 | Freshwater Sediment | YIAAALAVYMAGGDLKAMAMGGVAAVVPVILRWLNPADTAFGSTGK* |
Ga0105102_105598711 | 3300009165 | Freshwater Sediment | ALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPSDASFGVTKE* |
Ga0105104_108244561 | 3300009168 | Freshwater Sediment | MGAVIHCRSLAVYMAGGTWQQMAMGGVAAVVPVIMRWLNPADTAFGSTGK* |
Ga0105096_107641352 | 3300009170 | Freshwater Sediment | MAAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPNDSAFGSTGK* |
Ga0114974_1000869612 | 3300009183 | Freshwater Lake | MLALYMAGITDPKVLLHAGIAAVAPVVLRAINPKDKSFGVTGE* |
Ga0129333_111733781 | 3300010354 | Freshwater To Marine Saline Gradient | LAAGLAVYLAGVTEPKAIAMAGVSAVAPVILRWLNPNDSAFGRSKG* |
Ga0133913_131463571 | 3300010885 | Freshwater Lake | ALALYMAGVTDPKTLAMAGIAAVAPVVLRWLNPQDKSFGLSGK* |
Ga0139557_10178782 | 3300011010 | Freshwater | MLALYMAGITDPKVLLHAGIAAIAPVFLRAINPKDKSFGVTGE* |
Ga0139557_10783362 | 3300011010 | Freshwater | MLALYMAGITDPKVLLHAGIAAVAPVILRAINPKDKSFGVTGE* |
Ga0139556_10255972 | 3300011011 | Freshwater | MLALYMAGITDPKVLLHAGLAAIAPVFLRAINPKDKSFGVTGE* |
Ga0153703_140515 | 3300011336 | Freshwater | MAAALALYMAGVTDPKTLAMGGVAAVAPVILRWLNPNDKAFGSTGK* |
Ga0153700_1080614 | 3300011339 | Freshwater | LAGVTDPKTLAMGGVAAIAPVILRWLNPNDKSFGVIGE* |
Ga0157203_10302843 | 3300012663 | Freshwater | ALYMAGVTDPKTLAMAGAAAVAPVILRWLNPNDKAFGSTGK* |
Ga0157498_10532102 | 3300012666 | Freshwater, Surface Ice | LALYLAGITDPKTLSMAGLAAVAPVILRWLNPNDASFGINKDK* |
Ga0157611_11117062 | 3300012724 | Freshwater | MAAALALYLAGVTDPKTLAMGGVAAVAPVILRWLNPNDKAFGSTGK* |
Ga0157616_13341911 | 3300012731 | Freshwater | MAAALALYMAGVTDPKALAMGGVAAVAPVILRWLNPNDQSFG |
Ga0164293_1001043510 | 3300013004 | Freshwater | MAAALALYMAGVTDPKALAMGGVAAVAPVILRWLNPNDQSFGLTGK* |
Ga0164293_102246794 | 3300013004 | Freshwater | GRSFLAAALALYMAGVTDPKTLVMAGVAAVAPVILRWLNPNDKAFGSTGK* |
Ga0164293_106214052 | 3300013004 | Freshwater | AAALALYMAGVTDPKTLAMAGAAAVAPVILRWLNPNDKSFGNLGK* |
Ga0164293_108702891 | 3300013004 | Freshwater | MAAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNP |
Ga0164293_109005772 | 3300013004 | Freshwater | MAGGDIKAMAMGGVAAIVPVILRWLNPADTAFGSTGK* |
Ga0164292_101924952 | 3300013005 | Freshwater | MAAALALYMAGVTDPKTLAMAGVAAVAPVVLRWLNPNDKAFGSTGK* |
Ga0164292_101958031 | 3300013005 | Freshwater | YMAGVTDPKTLAMAGVAAVAPVILRWLNPNDKAFGSTGK* |
Ga0164292_104799542 | 3300013005 | Freshwater | MAAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPNDKSFGLTGK* |
Ga0170791_130654772 | 3300013295 | Freshwater | MLALYMAGITDPKVLLHAGIAAVAPVVLRAINPKD |
Ga0177922_108643874 | 3300013372 | Freshwater | YIAAALAVYMSGGNLQAMAMGGVAAIVPVLIRYLNPNDAAFGVKK* |
Ga0119960_10888591 | 3300014811 | Aquatic | FPVTIGLAAALALYMAGVTDPKTLAMGGVAAIAPVVLRWLNPQDKSFGLTGK* |
Ga0181363_10501091 | 3300017707 | Freshwater Lake | AGVTDPKTIAMAGAAAVAPVILRWLNPKDASFGVTKE |
Ga0181362_10708551 | 3300017723 | Freshwater Lake | SYIAAALAVYMAGGDWKQIAMGGVAAVVPVILRWLNPADKAFGSTGK |
Ga0181365_10828553 | 3300017736 | Freshwater Lake | KITDPKTLAMGGVAAVAPVLLRVLNPKDAAFGLQGK |
Ga0181343_10570301 | 3300017766 | Freshwater Lake | MLALYMAGITDPKVLLHAGIAAVAPVILRAINPKDKSFGVTGE |
Ga0181357_11708871 | 3300017777 | Freshwater Lake | SFLAAALALYMAGVQDPKTLAMAGVAAVAPVILRWLNPSDASFGVSKE |
Ga0181357_11876344 | 3300017777 | Freshwater Lake | AAALAVYMSGGNLQAMAMGGVAAIVPVLIRYLNPNDALGAKK |
Ga0181357_13199592 | 3300017777 | Freshwater Lake | YIAAALAVYMSGGNLQAMAMGGVAAIVPVLIRYLNPNDQAFGRMASSK |
Ga0181348_11071121 | 3300017784 | Freshwater Lake | SFLAAILALYMAGITDPKTLLTAGIAALAPVVLRWLNPNDKAFGNK |
Ga0181348_12187143 | 3300017784 | Freshwater Lake | YIAAALAVYMSGGNLQAMAMGGVAAIVPVLIRYLNPNDQAFGRLASSK |
Ga0181348_12597921 | 3300017784 | Freshwater Lake | RSFLAAALALYRAGVQDPKTLAMADVAAVAPVILRWLNPSDASFGVSKE |
Ga0181355_13807281 | 3300017785 | Freshwater Lake | AVYMSGGNLQAMAMGGVAAIVPVLIRYLNPNDQAFGRMASSK |
Ga0181359_11211291 | 3300019784 | Freshwater Lake | GIAAMLALYMAGVTDPKVLLHAGIAAVAPVILRAINPKDKSFGVTGE |
Ga0181359_12123332 | 3300019784 | Freshwater Lake | SFMAAALALYMAGVQDPKTLAMGGVAAIAPVILRWLNPADKSFGLTGK |
Ga0207193_13257941 | 3300020048 | Freshwater Lake Sediment | VYMAGGDFKAMAMGGVAAVVPVILRWLNPADTAFGSTGK |
Ga0211733_101083593 | 3300020160 | Freshwater | YMAGVTDPKTLAMAGVAAVAPVILRWLNPQDKNFGVTGQ |
Ga0211735_106190621 | 3300020162 | Freshwater | YMAGVTDPKTLAMAGVAAVAPVILRWLNPQDKSFGLTGK |
Ga0211735_113120021 | 3300020162 | Freshwater | YIAAALAVYMAGGSLEQKAMGGVAAVVPVILRWLNPADKAFGSTGK |
Ga0208485_10138011 | 3300020573 | Freshwater | MAGGDWKQIAMGGVAAVVPVILRWLNPADKAFGSTGK |
Ga0222712_102716451 | 3300021963 | Estuarine Water | YIAAALAVYMAGGDIKAMAMGGVAAVVPVVLRWLNPADKAFGSTGK |
Ga0222712_107189312 | 3300021963 | Estuarine Water | MAAALALYMAGVTDPKTLAMGGVAAVAPVILRWLNPNDKAFGSTGK |
Ga0244775_100674401 | 3300024346 | Estuarine | YMAGGDLKAMAMGGVAAIVPVVLRWLNPADTAFGSTGK |
Ga0255177_10573221 | 3300024514 | Freshwater | ACIAVYLAGVTDPKAILGAGAAAVLPVILRWLNPDDASFGIKGK |
Ga0209103_10348231 | 3300025080 | Freshwater | YMAGGDLKAMAMGGVAAVVPVILRWLNPADKAFGSTGK |
Ga0208005_10480161 | 3300025848 | Aqueous | AGLALYMAGVTDPKKLLMGGVAAIAPVILRWLNPDDHSFGKKP |
Ga0208644_11350864 | 3300025889 | Aqueous | ALALYMAGVTDPKTLAMAGVAAIAPVVLRWLNPQDKSFGLTGK |
Ga0208644_13954941 | 3300025889 | Aqueous | FMAAALALYMAGVQDPKTLAMGGVAAVAPVILRWLNPNDQSFGLTGK |
Ga0208554_10039788 | 3300027212 | Estuarine | FIAASLTLYMAGVTDPKMLFNAGLAAIVPVIMRWINPADKSFGAK |
Ga0208951_10818893 | 3300027621 | Freshwater Lentic | LAVVMAGVTDPKAIFAAGAAAVLPVLIRWLNPNDALGKGK |
Ga0209033_10203697 | 3300027697 | Freshwater Lake | ARSFMAAALALYMAGVTDPKTLAMGGVAAIAPVVLRWLNPQDKSFGLTGK |
Ga0209442_12324323 | 3300027732 | Freshwater Lake | LAVYMAGGTFQQMLMGGVAAVVPVVLRWLNTDDKEFGLGSK |
Ga0209087_13491782 | 3300027734 | Freshwater Lake | ASLAVYMAGVTDPKAILSAGVAAILPVLMRWLNPNDKVYGRK |
Ga0209134_102614402 | 3300027764 | Freshwater Lake | LASGLALYMAGVTDPKDLWTALVAALAPVAIRAINPADKAFGRA |
Ga0209353_101515311 | 3300027798 | Freshwater Lake | ALAVYMAGGDWKQMAMGGVAAVVPVVLRWLNPADSAFGSTQK |
Ga0209354_104161301 | 3300027808 | Freshwater Lake | FLAACLTLYMAGVTDPKTLFMAGVAAIAPVVLRYLNPNDKSFGVTGE |
Ga0209253_107653332 | 3300027900 | Freshwater Lake Sediment | FLAASLAVYMAGVTDPKTIGMAGLAAVLPVILRFLNPSDASFGISKGK |
Ga0209284_100979641 | 3300027983 | Freshwater | LYIAGVTDPKALLAAGAGALAPVILRWLNPKDQTFGLKK |
Ga0307378_106470161 | 3300031566 | Soil | YIAAALAVYMAGGDFKAMAMGGVAAVVPVILRWLNPADKAFGSTGK |
Ga0315900_103239104 | 3300031787 | Freshwater | GRSFLAAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPNDKAFGSTGK |
Ga0315900_110979892 | 3300031787 | Freshwater | ALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPNDKAFGSTGK |
Ga0315909_1001709312 | 3300031857 | Freshwater | MAAALALYLAGVTDPKTLAMGGVAAVAPVILRWLNPNDKAFGSTGK |
Ga0315909_105210554 | 3300031857 | Freshwater | LYLAGITDPKTLSMAGLAAVAPVILRWLNPNDASFGINKDK |
Ga0315901_106454703 | 3300031963 | Freshwater | AALAVYMAGGDLKAMAMGGVAAVVPVILRWLNPADTAFGSTGK |
Ga0315905_101019939 | 3300032092 | Freshwater | LAGITDPKTLSMAGLAAVAPVILRWLNPNDASFGINKDK |
Ga0315903_108410851 | 3300032116 | Freshwater | AALAVYMAGGDLKAMAMGGVAAVVPVILRWLNPADKAFGSTGK |
Ga0315903_109866942 | 3300032116 | Freshwater | FMAAALALYLAGVTDPKTLAMGGVAAVAPVVLRWLNPDDKAFGSTGK |
Ga0315276_120447691 | 3300032177 | Sediment | MAGVTDPKAILSAGVAAILPVLMRWLNPNDKVYGRK |
Ga0315275_107953614 | 3300032401 | Sediment | FAAALALYMAGVQDPKTLAMAGVAAVAPVILRWLNPSDASFGVSKE |
Ga0334980_0159761_138_278 | 3300033816 | Freshwater | MAAVLALYMAGVTDPKTLAMAGGAALAPVILRWLNPNDASFGVTKK |
Ga0334982_0325320_392_532 | 3300033981 | Freshwater | MAAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPNDKAFGSTGK |
Ga0334994_0025560_3741_3875 | 3300033993 | Freshwater | AALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPNDKAFGSTGK |
Ga0334994_0108453_1378_1491 | 3300033993 | Freshwater | MAGGSLEQMAMGGVAAVVPVILRWLNPADKAFGSTGK |
Ga0334994_0148735_1042_1182 | 3300033993 | Freshwater | MAAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPGDKSFGLTGK |
Ga0334994_0216031_897_1025 | 3300033993 | Freshwater | LALYMAGVTDPKTLAMAGVAAVAPVILRWLNPSDKSFGLTGK |
Ga0334994_0385617_422_562 | 3300033993 | Freshwater | MAAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPQDKSFGLTGK |
Ga0334996_0031152_3251_3391 | 3300033994 | Freshwater | MAAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPQDKSFGNLGK |
Ga0334996_0245396_4_114 | 3300033994 | Freshwater | MAGVTDPQAILSAGVAAVVPVLMRWLNPNDQVYGRK |
Ga0334979_0143618_1303_1443 | 3300033996 | Freshwater | MAAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPNDKSFGLTGK |
Ga0334979_0179266_1127_1261 | 3300033996 | Freshwater | SAIAVYMAGITDPKAILYAGASSVLPVILRYLNPKDKSFGVTGE |
Ga0334979_0208743_638_778 | 3300033996 | Freshwater | MAAALALYMAGVTDPKTLAMAGVAAVAPVILRALNPQDKSFGLTGK |
Ga0334986_0209846_960_1082 | 3300034012 | Freshwater | MAAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPNDKAF |
Ga0334991_0267953_1_144 | 3300034013 | Freshwater | FMAAALALYMAGVQDPKTLAMGGVAAVAPVILRWLNPNDKAFGSTGK |
Ga0335002_0657542_12_152 | 3300034020 | Freshwater | MAAAIAVYMAGQTNPKDIAMAGVAAVLPVILRWLNPNDKSFGLSGK |
Ga0335023_0026229_10_150 | 3300034050 | Freshwater | MAAALALYMAGVTDPKTLAMAGVAAIAPVVLRWLNPQDKSFGLTGK |
Ga0334983_0715704_1_147 | 3300034060 | Freshwater | SFMAAALALYMAGVTDPKTIAMGGIAAVAPVVLRWLNPNDKSFGSTGK |
Ga0334987_0047097_2176_2316 | 3300034061 | Freshwater | MAAALALYMAGVTDPKTLAMAGAAAVAPVVLRWLNPNDKAFGSTGK |
Ga0334995_0423638_64_204 | 3300034062 | Freshwater | MAAALALYLAGVQDPKTLAMGGIAAVAPVILRWLNPNDKAFGSTGK |
Ga0334995_0705419_3_149 | 3300034062 | Freshwater | SFMAAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPQDKSFGLTGK |
Ga0335000_0453389_117_230 | 3300034063 | Freshwater | MAGGSLQQMAMGGVAAVVPVIMRWLNPADKSFGSTGK |
Ga0335010_0357724_690_803 | 3300034092 | Freshwater | MAGGDIKAMAMGGVAAVVPVILRWLNPADKAFGSTGK |
Ga0335012_0300727_658_798 | 3300034093 | Freshwater | MAAALALYMAGVTDPKTLAMGGVAAIAPVVLRWLNPQDKSFGLTGK |
Ga0335022_0583507_406_528 | 3300034095 | Freshwater | MYMAGITDPKTLAMGGVAAIAPVILRWLNPKDAAFGVKGK |
Ga0335027_0089097_2083_2208 | 3300034101 | Freshwater | MAVYMAGGDLKAMAMGGVAAVVPVILRWLNPADKAFGSTGK |
Ga0335027_0520449_597_740 | 3300034101 | Freshwater | FMAAALALYLAGVQDPKTLAMGGIAAVAPVILRWLNPNDKAFGSTGK |
Ga0335031_0344808_22_138 | 3300034104 | Freshwater | MAGVTDPKTLAMAGVAAIAPVVLRWLNPQDKSFGLTGK |
Ga0335031_0851244_362_505 | 3300034104 | Freshwater | FMAAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPQDKSFGLTGK |
Ga0335035_0530868_2_127 | 3300034105 | Freshwater | ALYMAGVTDPKTLAMAGVAAIAPVVLRWLNPADKSFGLTGK |
Ga0335037_0065805_2_112 | 3300034107 | Freshwater | GVTDPKTLAMAGVAAVAPVILRWLNPNDKAFGSTGK |
Ga0335017_0533933_444_584 | 3300034167 | Freshwater | MAAALALYMAGVTDPKTLAMAGAAAVAPVILRWLNPNDKSFGNLGK |
Ga0335049_0751210_451_582 | 3300034272 | Freshwater | ALALYMAGVTDPKTLAMGGVAAVAPVILRWLNPNDKAFGSTGK |
Ga0335052_0395301_442_558 | 3300034279 | Freshwater | MAGVTDPKTLAMAGAAAVAPVILRWLNPNDKSFGNLGK |
Ga0335007_0276828_17_157 | 3300034283 | Freshwater | MAAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPQDKNFGVTGQ |
Ga0335007_0355620_11_130 | 3300034283 | Freshwater | MAGVTDPKTIGMAGLAAVLPVILRFLNPSDASFGISKGK |
Ga0335048_0321709_645_794 | 3300034356 | Freshwater | RSFMAAALSLYMAGVTDPKTLAMAGVAAIAPVVLRWLNPADKSFGLTGK |
Ga0335048_0403144_7_123 | 3300034356 | Freshwater | MAGVTDPKTLAMAGVAAVAPVILRWLNPQDKNFGVTGQ |
Ga0335064_0843413_406_519 | 3300034357 | Freshwater | MAGGSIEQMAMGGVAAVVPVILRWLNPADKAFGSTGK |
⦗Top⦘ |