NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F047671

Metagenome / Metatranscriptome Family F047671

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F047671
Family Type Metagenome / Metatranscriptome
Number of Sequences 149
Average Sequence Length 43 residues
Representative Sequence AALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPNDKAFGSTGK
Number of Associated Samples 110
Number of Associated Scaffolds 149

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 4.73 %
% of genes near scaffold ends (potentially truncated) 61.07 %
% of genes from short scaffolds (< 2000 bps) 85.23 %
Associated GOLD sequencing projects 108
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (75.168 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(32.215 % of family members)
Environment Ontology (ENVO) Unclassified
(66.443 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(50.336 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 40.28%    β-sheet: 0.00%    Coil/Unstructured: 59.72%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 149 Family Scaffolds
PF05257CHAP 15.44
PF04404ERF 2.68
PF01844HNH 2.68
PF04586Peptidase_S78 1.34
PF07733DNA_pol3_alpha 0.67
PF13671AAA_33 0.67
PF13539Peptidase_M15_4 0.67
PF05065Phage_capsid 0.67

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 149 Family Scaffolds
COG3740Phage head maturation proteaseMobilome: prophages, transposons [X] 1.34
COG0587DNA polymerase III, alpha subunitReplication, recombination and repair [L] 0.67
COG2176DNA polymerase III, alpha subunit (gram-positive type)Replication, recombination and repair [L] 0.67
COG4653Predicted phage phi-C31 gp36 major capsid-like proteinMobilome: prophages, transposons [X] 0.67


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.54 %
UnclassifiedrootN/A19.46 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000124|BS_KBA_SWE12_21mDRAFT_c10178600All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage507Open in IMG/M
3300002408|B570J29032_109105514All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage596Open in IMG/M
3300002408|B570J29032_109690248All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1063Open in IMG/M
3300003277|JGI25908J49247_10150532All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage543Open in IMG/M
3300003431|JGI25913J50563_1035257All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage776Open in IMG/M
3300004282|Ga0066599_100326743Not Available918Open in IMG/M
3300005662|Ga0078894_11219125All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage637Open in IMG/M
3300005805|Ga0079957_1156557All Organisms → Viruses → Predicted Viral1152Open in IMG/M
3300006484|Ga0070744_10206114Not Available559Open in IMG/M
3300007304|Ga0102689_1697579Not Available857Open in IMG/M
3300007640|Ga0070751_1343036Not Available549Open in IMG/M
3300007972|Ga0105745_1278782Not Available542Open in IMG/M
3300008055|Ga0108970_11059671All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2305Open in IMG/M
3300008108|Ga0114341_10059402All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2450Open in IMG/M
3300008111|Ga0114344_1253536All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage506Open in IMG/M
3300008119|Ga0114354_1019454All Organisms → cellular organisms → Bacteria3076Open in IMG/M
3300008119|Ga0114354_1100018Not Available1151Open in IMG/M
3300008119|Ga0114354_1114234Not Available1052Open in IMG/M
3300008266|Ga0114363_1016115All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3383Open in IMG/M
3300008266|Ga0114363_1175645All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage685Open in IMG/M
3300008339|Ga0114878_1233080All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage588Open in IMG/M
3300008448|Ga0114876_1035393All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2395Open in IMG/M
3300008448|Ga0114876_1081552Not Available1341Open in IMG/M
3300008450|Ga0114880_1135488All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage906Open in IMG/M
3300008450|Ga0114880_1235765All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage583Open in IMG/M
3300009026|Ga0102829_1186857All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage670Open in IMG/M
3300009068|Ga0114973_10274599Not Available903Open in IMG/M
3300009082|Ga0105099_10240290Not Available1047Open in IMG/M
3300009082|Ga0105099_10450820All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage774Open in IMG/M
3300009085|Ga0105103_10928326All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage511Open in IMG/M
3300009152|Ga0114980_10274904All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage981Open in IMG/M
3300009155|Ga0114968_10002043All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage15563Open in IMG/M
3300009160|Ga0114981_10364837All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage780Open in IMG/M
3300009161|Ga0114966_10303076All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage966Open in IMG/M
3300009161|Ga0114966_10666858All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage573Open in IMG/M
3300009164|Ga0114975_10650289Not Available559Open in IMG/M
3300009165|Ga0105102_10461761All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage684Open in IMG/M
3300009165|Ga0105102_10559871All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage627Open in IMG/M
3300009168|Ga0105104_10824456All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage540Open in IMG/M
3300009170|Ga0105096_10764135All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage515Open in IMG/M
3300009183|Ga0114974_10008696All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7427Open in IMG/M
3300010354|Ga0129333_11173378All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage639Open in IMG/M
3300010885|Ga0133913_13146357All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1093Open in IMG/M
3300011010|Ga0139557_1017878All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1319Open in IMG/M
3300011010|Ga0139557_1078336All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage550Open in IMG/M
3300011011|Ga0139556_1025597Not Available859Open in IMG/M
3300011336|Ga0153703_1405All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage14955Open in IMG/M
3300011339|Ga0153700_10806All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage15020Open in IMG/M
3300012663|Ga0157203_1030284All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage760Open in IMG/M
3300012666|Ga0157498_1053210All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage621Open in IMG/M
3300012724|Ga0157611_1111706Not Available601Open in IMG/M
3300012731|Ga0157616_1334191All Organisms → Viruses → Predicted Viral2521Open in IMG/M
3300013004|Ga0164293_10010435All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7799Open in IMG/M
3300013004|Ga0164293_10224679All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1341Open in IMG/M
3300013004|Ga0164293_10621405All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage700Open in IMG/M
3300013004|Ga0164293_10870289Not Available568Open in IMG/M
3300013004|Ga0164293_10900577All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C455556Open in IMG/M
3300013005|Ga0164292_10192495All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1458Open in IMG/M
3300013005|Ga0164292_10195803All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1442Open in IMG/M
3300013005|Ga0164292_10479954All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage817Open in IMG/M
3300013295|Ga0170791_13065477Not Available577Open in IMG/M
3300013372|Ga0177922_10864387All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage931Open in IMG/M
3300014811|Ga0119960_1088859All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage554Open in IMG/M
3300017707|Ga0181363_1050109All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage749Open in IMG/M
3300017723|Ga0181362_1070855All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage708Open in IMG/M
3300017736|Ga0181365_1082855Not Available785Open in IMG/M
3300017766|Ga0181343_1057030All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1140Open in IMG/M
3300017777|Ga0181357_1170887All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage791Open in IMG/M
3300017777|Ga0181357_1187634All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage745Open in IMG/M
3300017777|Ga0181357_1319959All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage522Open in IMG/M
3300017784|Ga0181348_1107112All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1086Open in IMG/M
3300017784|Ga0181348_1218714All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage673Open in IMG/M
3300017784|Ga0181348_1259792All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage597Open in IMG/M
3300017785|Ga0181355_1380728All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage514Open in IMG/M
3300019784|Ga0181359_1121129All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage935Open in IMG/M
3300019784|Ga0181359_1212333All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage615Open in IMG/M
3300020048|Ga0207193_1325794All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1072Open in IMG/M
3300020160|Ga0211733_10108359All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage512Open in IMG/M
3300020162|Ga0211735_10619062All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage922Open in IMG/M
3300020162|Ga0211735_11312002All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage919Open in IMG/M
3300020573|Ga0208485_1013801Not Available1757Open in IMG/M
3300021963|Ga0222712_10271645All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1075Open in IMG/M
3300021963|Ga0222712_10718931All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage560Open in IMG/M
3300024346|Ga0244775_10067440All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3075Open in IMG/M
3300024514|Ga0255177_1057322All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage655Open in IMG/M
3300025080|Ga0209103_1034823All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage630Open in IMG/M
3300025848|Ga0208005_1048016All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1323Open in IMG/M
3300025889|Ga0208644_1135086All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1155Open in IMG/M
3300025889|Ga0208644_1395494All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage510Open in IMG/M
3300027212|Ga0208554_1003978All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2368Open in IMG/M
3300027621|Ga0208951_1081889Not Available900Open in IMG/M
3300027697|Ga0209033_1020369All Organisms → Viruses → Predicted Viral2706Open in IMG/M
3300027732|Ga0209442_1232432All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage667Open in IMG/M
3300027734|Ga0209087_1349178All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage511Open in IMG/M
3300027764|Ga0209134_10261440Not Available592Open in IMG/M
3300027798|Ga0209353_10151531All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1033Open in IMG/M
3300027808|Ga0209354_10416130All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage521Open in IMG/M
3300027900|Ga0209253_10765333All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage690Open in IMG/M
3300027983|Ga0209284_10097964Not Available1561Open in IMG/M
3300031566|Ga0307378_10647016All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage918Open in IMG/M
3300031787|Ga0315900_10323910All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1261Open in IMG/M
3300031787|Ga0315900_11097989All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage513Open in IMG/M
3300031857|Ga0315909_10017093All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7411Open in IMG/M
3300031857|Ga0315909_10521055All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage815Open in IMG/M
3300031963|Ga0315901_10645470All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage795Open in IMG/M
3300032092|Ga0315905_10101993Not Available2893Open in IMG/M
3300032116|Ga0315903_10841085All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage664Open in IMG/M
3300032116|Ga0315903_10986694All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage591Open in IMG/M
3300032177|Ga0315276_12044769All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage584Open in IMG/M
3300032401|Ga0315275_10795361All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1049Open in IMG/M
3300033816|Ga0334980_0159761Not Available918Open in IMG/M
3300033981|Ga0334982_0325320All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage717Open in IMG/M
3300033993|Ga0334994_0025560All Organisms → Viruses → Predicted Viral3875Open in IMG/M
3300033993|Ga0334994_0108453All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1619Open in IMG/M
3300033993|Ga0334994_0148735All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1319Open in IMG/M
3300033993|Ga0334994_0216031All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1026Open in IMG/M
3300033993|Ga0334994_0385617Not Available682Open in IMG/M
3300033994|Ga0334996_0031152All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3407Open in IMG/M
3300033994|Ga0334996_0245396All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage924Open in IMG/M
3300033996|Ga0334979_0143618Not Available1449Open in IMG/M
3300033996|Ga0334979_0179266All Organisms → Viruses → Predicted Viral1262Open in IMG/M
3300033996|Ga0334979_0208743Not Available1148Open in IMG/M
3300034012|Ga0334986_0209846Not Available1083Open in IMG/M
3300034013|Ga0334991_0267953All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage705Open in IMG/M
3300034020|Ga0335002_0657542All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage533Open in IMG/M
3300034050|Ga0335023_0026229All Organisms → Viruses → Predicted Viral3415Open in IMG/M
3300034060|Ga0334983_0715704All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage531Open in IMG/M
3300034061|Ga0334987_0047097All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3610Open in IMG/M
3300034062|Ga0334995_0423638Not Available825Open in IMG/M
3300034062|Ga0334995_0705419All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage567Open in IMG/M
3300034063|Ga0335000_0453389Not Available750Open in IMG/M
3300034092|Ga0335010_0357724All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage814Open in IMG/M
3300034093|Ga0335012_0300727All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage814Open in IMG/M
3300034095|Ga0335022_0583507All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage568Open in IMG/M
3300034101|Ga0335027_0089097All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2380Open in IMG/M
3300034101|Ga0335027_0520449All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage741Open in IMG/M
3300034104|Ga0335031_0344808All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage954Open in IMG/M
3300034104|Ga0335031_0851244All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage505Open in IMG/M
3300034105|Ga0335035_0530868All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage637Open in IMG/M
3300034107|Ga0335037_0065805All Organisms → Viruses → Predicted Viral1957Open in IMG/M
3300034167|Ga0335017_0533933All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage617Open in IMG/M
3300034272|Ga0335049_0751210All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage584Open in IMG/M
3300034279|Ga0335052_0395301All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage737Open in IMG/M
3300034283|Ga0335007_0276828All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1114Open in IMG/M
3300034283|Ga0335007_0355620All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage935Open in IMG/M
3300034356|Ga0335048_0321709All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage794Open in IMG/M
3300034356|Ga0335048_0403144All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage678Open in IMG/M
3300034357|Ga0335064_0843413All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes557Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater32.21%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake14.77%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake6.71%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater5.37%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment4.70%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton4.70%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater4.03%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.36%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.68%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater2.01%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater2.01%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.01%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.34%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater1.34%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.34%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.34%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.67%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.67%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.67%
Freshwater, Surface IceEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice0.67%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment0.67%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.67%
AquaticEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic0.67%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.67%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.67%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.67%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.67%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.67%
MarineEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine0.67%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.67%
EstuaryHost-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary0.67%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000124Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21mEnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300003277Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300003431Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SNEnvironmentalOpen in IMG/M
3300004282Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sedimentEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300007304Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300007545Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3EnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300007972Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0umEnvironmentalOpen in IMG/M
3300008055Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393Host-AssociatedOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008111Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NAEnvironmentalOpen in IMG/M
3300008119Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008339Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigsEnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009082Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009160Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaGEnvironmentalOpen in IMG/M
3300009161Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaGEnvironmentalOpen in IMG/M
3300009164Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaGEnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009170Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011010Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface IceEnvironmentalOpen in IMG/M
3300011011Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300011336Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - PaldangEnvironmentalOpen in IMG/M
3300011339Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - HannamEnvironmentalOpen in IMG/M
3300012663Freshwater microbial communities from Indian River, Ontario, Canada - S50EnvironmentalOpen in IMG/M
3300012666Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2EnvironmentalOpen in IMG/M
3300012724Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES138 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012731Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES145 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300014811Aquatic viral communities from ballast water - Michigan State University - AB_ballast waterEnvironmentalOpen in IMG/M
3300017707Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.NEnvironmentalOpen in IMG/M
3300017723Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020160Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1EnvironmentalOpen in IMG/M
3300020162Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1EnvironmentalOpen in IMG/M
3300020573Freshwater microbial communities from Lake Mendota, WI - 17JUL2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024514Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8dEnvironmentalOpen in IMG/M
3300025080Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - 4C3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025848Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300027212Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027621Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027697Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027732Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027734Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027764Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300027983Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 (SPAdes)EnvironmentalOpen in IMG/M
3300031566Soil microbial communities from Risofladan, Vaasa, Finland - UN-1EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300033816Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300033993Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037EnvironmentalOpen in IMG/M
3300033994Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034013Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034EnvironmentalOpen in IMG/M
3300034020Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055EnvironmentalOpen in IMG/M
3300034050Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095EnvironmentalOpen in IMG/M
3300034060Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034063Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053EnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M
3300034093Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072EnvironmentalOpen in IMG/M
3300034095Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034105Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127EnvironmentalOpen in IMG/M
3300034107Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133EnvironmentalOpen in IMG/M
3300034167Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082EnvironmentalOpen in IMG/M
3300034272Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156EnvironmentalOpen in IMG/M
3300034279Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M
3300034356Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152EnvironmentalOpen in IMG/M
3300034357Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
BS_KBA_SWE12_21mDRAFT_1017860013300000124MarineAALALYMAGEQDPKTLAMAGVAAVAPVILRWLNPNDKSFGNLGK*
B570J29032_10910551423300002408FreshwaterSFMAAVLALYMAGVTDPKTLAMAGVAAIAPVVLRWLNPQDKSFGLTGK*
B570J29032_10969024813300002408FreshwaterRSFMAAALALYLAGVTDPKTLAMGGVAAVAPVILRWLNPQDKSFGLSGK*
JGI25908J49247_1015053213300003277Freshwater LakeYIAAALAVYMAGGDWKQIAMGGVAAVVPVILRWLNPADKAFGSTGK*
JGI25913J50563_103525713300003431Freshwater LakeAAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPSDASFGVSKK*
Ga0066599_10032674333300004282FreshwaterALYMAGVTDPKTLAMAGGAAVAPVILRWLNPNDAAFGVKGK*
Ga0078894_1121912513300005662Freshwater LakeLTLYMAGVNDPKTLLMAGVAAIAPVVLRYLNPNDKSFGVTGE*
Ga0079957_115655713300005805LakeGLAVYLAGVTEPKAIAMAGVSAVAPVILRWLNPNDSAFGRSKG*
Ga0070744_1020611423300006484EstuarineMAGVTDPKTLAMAGVAAVAPVVLRWLNPQDKSFGLTGK*
Ga0102689_169757923300007304Freshwater LakeMAAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPNDKAFGSTGK*
Ga0102873_124500513300007545EstuarineYMTGNTNPKDLAMAGVAAVAPVLLRALNPNDKSFGVTK*
Ga0070751_134303623300007640AqueousMAAALALFMAGVTDPKTLAMGGIAAIAPVVLRWLNPNDNIGSTGK*
Ga0105745_127878213300007972Estuary WaterMAAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNANDKAFGSTGK*
Ga0108970_1105967143300008055EstuaryMLALYMAGITDPKVLLHAGIAAIAPVVLRAVNPKDKSFGVTGE*
Ga0114341_1005940253300008108Freshwater, PlanktonMAGVTDPKALLMAGGAAVAPVVLRYLNPNDKSFGVTGE*
Ga0114344_125353623300008111Freshwater, PlanktonMLALYMAGIQDPKVLLHAGLAAIAPVLLRTINPKDKSFGVTGE*
Ga0114354_101945453300008119Freshwater, PlanktonMAGVTDPKTLLMAGVAAIAPVVLRYLNPNDKSFGVTGE*
Ga0114354_110001833300008119Freshwater, PlanktonMLALYMAGITDPKVLLHAGIAAVAPVLLRAVNPKDKSFGVTGE*
Ga0114354_111423433300008119Freshwater, PlanktonMLALYMAGITDPKVLLHAGIAAVAPVLLRAINPKDKSFGVTGE*
Ga0114363_101611543300008266Freshwater, PlanktonMAAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPQDKSFGLTGK*
Ga0114363_117564523300008266Freshwater, PlanktonMAGGDIKAMAMGGVAAVVPVILRWLNPADKAFGSTGK*
Ga0114878_123308013300008339Freshwater LakeALALYMAGVTDPKTLAMAGAAAVAPVILRWLNPNDASFGVGKE*
Ga0114876_103539373300008448Freshwater LakeFAAALALYMAGETDPKTLAMAGGAAVAPVVLRWLNPNDSAFGVTRGR*
Ga0114876_108155243300008448Freshwater LakeMAGVSDPKTLLMAGVAAIAPVVLRYLNPNDKSFGVTGE*
Ga0114880_113548833300008450Freshwater LakeMAAALALYLAGVTDPKTLAMGGVAAVAPVVLRWLNPDDKAFGSTGK*
Ga0114880_123576513300008450Freshwater LakeLTLYMAGVTDPKTLLMAGVAAIAPVVLRYLNPNDKSFGVTGE*
Ga0102829_118685723300009026EstuarineMAGVTDPKTLAMAGAAAVAPVILRWLNPKDASFGVGKE*
Ga0114973_1027459923300009068Freshwater LakeMLALYMAGVTDPEVLLHAGIAAIAPVVLRAVNPKDKSFGVTGE*
Ga0105099_1024029013300009082Freshwater SedimentMAAALALYMAGVTDPKALAMGGVAAVAPVILRWLNPNDQS
Ga0105099_1045082023300009082Freshwater SedimentMAAAIAVYMTGETDPKTLGMAGLAAVLPVILRWLNPNDAAFGLKGK*
Ga0105103_1092832613300009085Freshwater SedimentGGDIKAMAMGGVAAVVPVILRWLNPADKAFGSTGK*
Ga0114980_1027490413300009152Freshwater LakeIAVYMAGITDPKAILYAGLSSVLPVILRYINPKDKSFGVTGE*
Ga0114968_1000204363300009155Freshwater LakeMAGVTDPKKLLMAGVAAIAPVVLRYLNPNDKSFGVTGE*
Ga0114981_1036483713300009160Freshwater LakeMAGVTDPKTLLMAGVAAVAPVILRWLNPNDKSFGVTGE*
Ga0114966_1030307643300009161Freshwater LakeSYLAAALAVYMAGGTFQQMLMGGVAAVLPVLLRWLNSDDKEFGLGSK*
Ga0114966_1066685823300009161Freshwater LakeYMAGVTDPKAILSAGIAAVVPVLMRWLNPNDQVYGRK*
Ga0114975_1065028923300009164Freshwater LakeMAAALALYMAGVQDPKTLAMGGIAAIAPVVLRWLNPNDKIGSTGK*
Ga0105102_1046176113300009165Freshwater SedimentYIAAALAVYMAGGDLKAMAMGGVAAVVPVILRWLNPADTAFGSTGK*
Ga0105102_1055987113300009165Freshwater SedimentALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPSDASFGVTKE*
Ga0105104_1082445613300009168Freshwater SedimentMGAVIHCRSLAVYMAGGTWQQMAMGGVAAVVPVIMRWLNPADTAFGSTGK*
Ga0105096_1076413523300009170Freshwater SedimentMAAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPNDSAFGSTGK*
Ga0114974_10008696123300009183Freshwater LakeMLALYMAGITDPKVLLHAGIAAVAPVVLRAINPKDKSFGVTGE*
Ga0129333_1117337813300010354Freshwater To Marine Saline GradientLAAGLAVYLAGVTEPKAIAMAGVSAVAPVILRWLNPNDSAFGRSKG*
Ga0133913_1314635713300010885Freshwater LakeALALYMAGVTDPKTLAMAGIAAVAPVVLRWLNPQDKSFGLSGK*
Ga0139557_101787823300011010FreshwaterMLALYMAGITDPKVLLHAGIAAIAPVFLRAINPKDKSFGVTGE*
Ga0139557_107833623300011010FreshwaterMLALYMAGITDPKVLLHAGIAAVAPVILRAINPKDKSFGVTGE*
Ga0139556_102559723300011011FreshwaterMLALYMAGITDPKVLLHAGLAAIAPVFLRAINPKDKSFGVTGE*
Ga0153703_1405153300011336FreshwaterMAAALALYMAGVTDPKTLAMGGVAAVAPVILRWLNPNDKAFGSTGK*
Ga0153700_10806143300011339FreshwaterLAGVTDPKTLAMGGVAAIAPVILRWLNPNDKSFGVIGE*
Ga0157203_103028433300012663FreshwaterALYMAGVTDPKTLAMAGAAAVAPVILRWLNPNDKAFGSTGK*
Ga0157498_105321023300012666Freshwater, Surface IceLALYLAGITDPKTLSMAGLAAVAPVILRWLNPNDASFGINKDK*
Ga0157611_111170623300012724FreshwaterMAAALALYLAGVTDPKTLAMGGVAAVAPVILRWLNPNDKAFGSTGK*
Ga0157616_133419113300012731FreshwaterMAAALALYMAGVTDPKALAMGGVAAVAPVILRWLNPNDQSFG
Ga0164293_10010435103300013004FreshwaterMAAALALYMAGVTDPKALAMGGVAAVAPVILRWLNPNDQSFGLTGK*
Ga0164293_1022467943300013004FreshwaterGRSFLAAALALYMAGVTDPKTLVMAGVAAVAPVILRWLNPNDKAFGSTGK*
Ga0164293_1062140523300013004FreshwaterAAALALYMAGVTDPKTLAMAGAAAVAPVILRWLNPNDKSFGNLGK*
Ga0164293_1087028913300013004FreshwaterMAAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNP
Ga0164293_1090057723300013004FreshwaterMAGGDIKAMAMGGVAAIVPVILRWLNPADTAFGSTGK*
Ga0164292_1019249523300013005FreshwaterMAAALALYMAGVTDPKTLAMAGVAAVAPVVLRWLNPNDKAFGSTGK*
Ga0164292_1019580313300013005FreshwaterYMAGVTDPKTLAMAGVAAVAPVILRWLNPNDKAFGSTGK*
Ga0164292_1047995423300013005FreshwaterMAAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPNDKSFGLTGK*
Ga0170791_1306547723300013295FreshwaterMLALYMAGITDPKVLLHAGIAAVAPVVLRAINPKD
Ga0177922_1086438743300013372FreshwaterYIAAALAVYMSGGNLQAMAMGGVAAIVPVLIRYLNPNDAAFGVKK*
Ga0119960_108885913300014811AquaticFPVTIGLAAALALYMAGVTDPKTLAMGGVAAIAPVVLRWLNPQDKSFGLTGK*
Ga0181363_105010913300017707Freshwater LakeAGVTDPKTIAMAGAAAVAPVILRWLNPKDASFGVTKE
Ga0181362_107085513300017723Freshwater LakeSYIAAALAVYMAGGDWKQIAMGGVAAVVPVILRWLNPADKAFGSTGK
Ga0181365_108285533300017736Freshwater LakeKITDPKTLAMGGVAAVAPVLLRVLNPKDAAFGLQGK
Ga0181343_105703013300017766Freshwater LakeMLALYMAGITDPKVLLHAGIAAVAPVILRAINPKDKSFGVTGE
Ga0181357_117088713300017777Freshwater LakeSFLAAALALYMAGVQDPKTLAMAGVAAVAPVILRWLNPSDASFGVSKE
Ga0181357_118763443300017777Freshwater LakeAAALAVYMSGGNLQAMAMGGVAAIVPVLIRYLNPNDALGAKK
Ga0181357_131995923300017777Freshwater LakeYIAAALAVYMSGGNLQAMAMGGVAAIVPVLIRYLNPNDQAFGRMASSK
Ga0181348_110711213300017784Freshwater LakeSFLAAILALYMAGITDPKTLLTAGIAALAPVVLRWLNPNDKAFGNK
Ga0181348_121871433300017784Freshwater LakeYIAAALAVYMSGGNLQAMAMGGVAAIVPVLIRYLNPNDQAFGRLASSK
Ga0181348_125979213300017784Freshwater LakeRSFLAAALALYRAGVQDPKTLAMADVAAVAPVILRWLNPSDASFGVSKE
Ga0181355_138072813300017785Freshwater LakeAVYMSGGNLQAMAMGGVAAIVPVLIRYLNPNDQAFGRMASSK
Ga0181359_112112913300019784Freshwater LakeGIAAMLALYMAGVTDPKVLLHAGIAAVAPVILRAINPKDKSFGVTGE
Ga0181359_121233323300019784Freshwater LakeSFMAAALALYMAGVQDPKTLAMGGVAAIAPVILRWLNPADKSFGLTGK
Ga0207193_132579413300020048Freshwater Lake SedimentVYMAGGDFKAMAMGGVAAVVPVILRWLNPADTAFGSTGK
Ga0211733_1010835933300020160FreshwaterYMAGVTDPKTLAMAGVAAVAPVILRWLNPQDKNFGVTGQ
Ga0211735_1061906213300020162FreshwaterYMAGVTDPKTLAMAGVAAVAPVILRWLNPQDKSFGLTGK
Ga0211735_1131200213300020162FreshwaterYIAAALAVYMAGGSLEQKAMGGVAAVVPVILRWLNPADKAFGSTGK
Ga0208485_101380113300020573FreshwaterMAGGDWKQIAMGGVAAVVPVILRWLNPADKAFGSTGK
Ga0222712_1027164513300021963Estuarine WaterYIAAALAVYMAGGDIKAMAMGGVAAVVPVVLRWLNPADKAFGSTGK
Ga0222712_1071893123300021963Estuarine WaterMAAALALYMAGVTDPKTLAMGGVAAVAPVILRWLNPNDKAFGSTGK
Ga0244775_1006744013300024346EstuarineYMAGGDLKAMAMGGVAAIVPVVLRWLNPADTAFGSTGK
Ga0255177_105732213300024514FreshwaterACIAVYLAGVTDPKAILGAGAAAVLPVILRWLNPDDASFGIKGK
Ga0209103_103482313300025080FreshwaterYMAGGDLKAMAMGGVAAVVPVILRWLNPADKAFGSTGK
Ga0208005_104801613300025848AqueousAGLALYMAGVTDPKKLLMGGVAAIAPVILRWLNPDDHSFGKKP
Ga0208644_113508643300025889AqueousALALYMAGVTDPKTLAMAGVAAIAPVVLRWLNPQDKSFGLTGK
Ga0208644_139549413300025889AqueousFMAAALALYMAGVQDPKTLAMGGVAAVAPVILRWLNPNDQSFGLTGK
Ga0208554_100397883300027212EstuarineFIAASLTLYMAGVTDPKMLFNAGLAAIVPVIMRWINPADKSFGAK
Ga0208951_108188933300027621Freshwater LenticLAVVMAGVTDPKAIFAAGAAAVLPVLIRWLNPNDALGKGK
Ga0209033_102036973300027697Freshwater LakeARSFMAAALALYMAGVTDPKTLAMGGVAAIAPVVLRWLNPQDKSFGLTGK
Ga0209442_123243233300027732Freshwater LakeLAVYMAGGTFQQMLMGGVAAVVPVVLRWLNTDDKEFGLGSK
Ga0209087_134917823300027734Freshwater LakeASLAVYMAGVTDPKAILSAGVAAILPVLMRWLNPNDKVYGRK
Ga0209134_1026144023300027764Freshwater LakeLASGLALYMAGVTDPKDLWTALVAALAPVAIRAINPADKAFGRA
Ga0209353_1015153113300027798Freshwater LakeALAVYMAGGDWKQMAMGGVAAVVPVVLRWLNPADSAFGSTQK
Ga0209354_1041613013300027808Freshwater LakeFLAACLTLYMAGVTDPKTLFMAGVAAIAPVVLRYLNPNDKSFGVTGE
Ga0209253_1076533323300027900Freshwater Lake SedimentFLAASLAVYMAGVTDPKTIGMAGLAAVLPVILRFLNPSDASFGISKGK
Ga0209284_1009796413300027983FreshwaterLYIAGVTDPKALLAAGAGALAPVILRWLNPKDQTFGLKK
Ga0307378_1064701613300031566SoilYIAAALAVYMAGGDFKAMAMGGVAAVVPVILRWLNPADKAFGSTGK
Ga0315900_1032391043300031787FreshwaterGRSFLAAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPNDKAFGSTGK
Ga0315900_1109798923300031787FreshwaterALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPNDKAFGSTGK
Ga0315909_10017093123300031857FreshwaterMAAALALYLAGVTDPKTLAMGGVAAVAPVILRWLNPNDKAFGSTGK
Ga0315909_1052105543300031857FreshwaterLYLAGITDPKTLSMAGLAAVAPVILRWLNPNDASFGINKDK
Ga0315901_1064547033300031963FreshwaterAALAVYMAGGDLKAMAMGGVAAVVPVILRWLNPADTAFGSTGK
Ga0315905_1010199393300032092FreshwaterLAGITDPKTLSMAGLAAVAPVILRWLNPNDASFGINKDK
Ga0315903_1084108513300032116FreshwaterAALAVYMAGGDLKAMAMGGVAAVVPVILRWLNPADKAFGSTGK
Ga0315903_1098669423300032116FreshwaterFMAAALALYLAGVTDPKTLAMGGVAAVAPVVLRWLNPDDKAFGSTGK
Ga0315276_1204476913300032177SedimentMAGVTDPKAILSAGVAAILPVLMRWLNPNDKVYGRK
Ga0315275_1079536143300032401SedimentFAAALALYMAGVQDPKTLAMAGVAAVAPVILRWLNPSDASFGVSKE
Ga0334980_0159761_138_2783300033816FreshwaterMAAVLALYMAGVTDPKTLAMAGGAALAPVILRWLNPNDASFGVTKK
Ga0334982_0325320_392_5323300033981FreshwaterMAAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPNDKAFGSTGK
Ga0334994_0025560_3741_38753300033993FreshwaterAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPNDKAFGSTGK
Ga0334994_0108453_1378_14913300033993FreshwaterMAGGSLEQMAMGGVAAVVPVILRWLNPADKAFGSTGK
Ga0334994_0148735_1042_11823300033993FreshwaterMAAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPGDKSFGLTGK
Ga0334994_0216031_897_10253300033993FreshwaterLALYMAGVTDPKTLAMAGVAAVAPVILRWLNPSDKSFGLTGK
Ga0334994_0385617_422_5623300033993FreshwaterMAAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPQDKSFGLTGK
Ga0334996_0031152_3251_33913300033994FreshwaterMAAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPQDKSFGNLGK
Ga0334996_0245396_4_1143300033994FreshwaterMAGVTDPQAILSAGVAAVVPVLMRWLNPNDQVYGRK
Ga0334979_0143618_1303_14433300033996FreshwaterMAAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPNDKSFGLTGK
Ga0334979_0179266_1127_12613300033996FreshwaterSAIAVYMAGITDPKAILYAGASSVLPVILRYLNPKDKSFGVTGE
Ga0334979_0208743_638_7783300033996FreshwaterMAAALALYMAGVTDPKTLAMAGVAAVAPVILRALNPQDKSFGLTGK
Ga0334986_0209846_960_10823300034012FreshwaterMAAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPNDKAF
Ga0334991_0267953_1_1443300034013FreshwaterFMAAALALYMAGVQDPKTLAMGGVAAVAPVILRWLNPNDKAFGSTGK
Ga0335002_0657542_12_1523300034020FreshwaterMAAAIAVYMAGQTNPKDIAMAGVAAVLPVILRWLNPNDKSFGLSGK
Ga0335023_0026229_10_1503300034050FreshwaterMAAALALYMAGVTDPKTLAMAGVAAIAPVVLRWLNPQDKSFGLTGK
Ga0334983_0715704_1_1473300034060FreshwaterSFMAAALALYMAGVTDPKTIAMGGIAAVAPVVLRWLNPNDKSFGSTGK
Ga0334987_0047097_2176_23163300034061FreshwaterMAAALALYMAGVTDPKTLAMAGAAAVAPVVLRWLNPNDKAFGSTGK
Ga0334995_0423638_64_2043300034062FreshwaterMAAALALYLAGVQDPKTLAMGGIAAVAPVILRWLNPNDKAFGSTGK
Ga0334995_0705419_3_1493300034062FreshwaterSFMAAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPQDKSFGLTGK
Ga0335000_0453389_117_2303300034063FreshwaterMAGGSLQQMAMGGVAAVVPVIMRWLNPADKSFGSTGK
Ga0335010_0357724_690_8033300034092FreshwaterMAGGDIKAMAMGGVAAVVPVILRWLNPADKAFGSTGK
Ga0335012_0300727_658_7983300034093FreshwaterMAAALALYMAGVTDPKTLAMGGVAAIAPVVLRWLNPQDKSFGLTGK
Ga0335022_0583507_406_5283300034095FreshwaterMYMAGITDPKTLAMGGVAAIAPVILRWLNPKDAAFGVKGK
Ga0335027_0089097_2083_22083300034101FreshwaterMAVYMAGGDLKAMAMGGVAAVVPVILRWLNPADKAFGSTGK
Ga0335027_0520449_597_7403300034101FreshwaterFMAAALALYLAGVQDPKTLAMGGIAAVAPVILRWLNPNDKAFGSTGK
Ga0335031_0344808_22_1383300034104FreshwaterMAGVTDPKTLAMAGVAAIAPVVLRWLNPQDKSFGLTGK
Ga0335031_0851244_362_5053300034104FreshwaterFMAAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPQDKSFGLTGK
Ga0335035_0530868_2_1273300034105FreshwaterALYMAGVTDPKTLAMAGVAAIAPVVLRWLNPADKSFGLTGK
Ga0335037_0065805_2_1123300034107FreshwaterGVTDPKTLAMAGVAAVAPVILRWLNPNDKAFGSTGK
Ga0335017_0533933_444_5843300034167FreshwaterMAAALALYMAGVTDPKTLAMAGAAAVAPVILRWLNPNDKSFGNLGK
Ga0335049_0751210_451_5823300034272FreshwaterALALYMAGVTDPKTLAMGGVAAVAPVILRWLNPNDKAFGSTGK
Ga0335052_0395301_442_5583300034279FreshwaterMAGVTDPKTLAMAGAAAVAPVILRWLNPNDKSFGNLGK
Ga0335007_0276828_17_1573300034283FreshwaterMAAALALYMAGVTDPKTLAMAGVAAVAPVILRWLNPQDKNFGVTGQ
Ga0335007_0355620_11_1303300034283FreshwaterMAGVTDPKTIGMAGLAAVLPVILRFLNPSDASFGISKGK
Ga0335048_0321709_645_7943300034356FreshwaterRSFMAAALSLYMAGVTDPKTLAMAGVAAIAPVVLRWLNPADKSFGLTGK
Ga0335048_0403144_7_1233300034356FreshwaterMAGVTDPKTLAMAGVAAVAPVILRWLNPQDKNFGVTGQ
Ga0335064_0843413_406_5193300034357FreshwaterMAGGSIEQMAMGGVAAVVPVILRWLNPADKAFGSTGK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.