| Basic Information | |
|---|---|
| Family ID | F047171 |
| Family Type | Metagenome |
| Number of Sequences | 150 |
| Average Sequence Length | 41 residues |
| Representative Sequence | VERKKALVLMERRSLKAEVIDLKALPSKNIVKKELKSKIF |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 150 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.00 % |
| % of genes from short scaffolds (< 2000 bps) | 85.33 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.667 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (20.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (76.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (72.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.53% β-sheet: 0.00% Coil/Unstructured: 51.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 150 Family Scaffolds |
|---|---|---|
| PF05050 | Methyltransf_21 | 13.33 |
| PF00118 | Cpn60_TCP1 | 8.00 |
| PF01757 | Acyl_transf_3 | 8.00 |
| PF16254 | DUF4910 | 3.33 |
| PF05656 | DUF805 | 2.67 |
| PF00239 | Resolvase | 2.67 |
| PF13578 | Methyltransf_24 | 2.00 |
| PF13302 | Acetyltransf_3 | 2.00 |
| PF09940 | DUF2172 | 1.33 |
| PF00685 | Sulfotransfer_1 | 1.33 |
| PF07330 | DUF1467 | 1.33 |
| PF00271 | Helicase_C | 1.33 |
| PF00535 | Glycos_transf_2 | 1.33 |
| PF13483 | Lactamase_B_3 | 1.33 |
| PF01493 | GXGXG | 0.67 |
| PF13489 | Methyltransf_23 | 0.67 |
| PF00145 | DNA_methylase | 0.67 |
| PF05175 | MTS | 0.67 |
| PF01161 | PBP | 0.67 |
| PF02493 | MORN | 0.67 |
| PF14269 | Arylsulfotran_2 | 0.67 |
| PF00893 | Multi_Drug_Res | 0.67 |
| PF00166 | Cpn10 | 0.67 |
| PF08241 | Methyltransf_11 | 0.67 |
| PF00551 | Formyl_trans_N | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
|---|---|---|---|
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 8.00 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 2.67 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 2.67 |
| COG3152 | Uncharacterized membrane protein YhaH, DUF805 family | Function unknown [S] | 2.67 |
| COG5454 | Predicted secreted protein | Function unknown [S] | 1.33 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.67 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.67 |
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 0.67 |
| COG2076 | Multidrug transporter EmrE and related cation transporters | Defense mechanisms [V] | 0.67 |
| COG2849 | Antitoxin component YwqK of the YwqJK toxin-antitoxin module | Defense mechanisms [V] | 0.67 |
| COG4642 | Uncharacterized conserved protein | Function unknown [S] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.67 % |
| Unclassified | root | N/A | 1.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10284294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales | 503 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10085475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1080 | Open in IMG/M |
| 3300000265|LP_A_09_P04_10DRAFT_1023326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales | 1110 | Open in IMG/M |
| 3300001347|JGI20156J14371_10067747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1343 | Open in IMG/M |
| 3300001347|JGI20156J14371_10187986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 543 | Open in IMG/M |
| 3300001349|JGI20160J14292_10029372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2869 | Open in IMG/M |
| 3300001352|JGI20157J14317_10084416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1222 | Open in IMG/M |
| 3300001353|JGI20159J14440_10081131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1083 | Open in IMG/M |
| 3300001355|JGI20158J14315_10026887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2786 | Open in IMG/M |
| 3300001938|GOS2221_1017386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1653 | Open in IMG/M |
| 3300002186|JGI24539J26755_10131252 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 724 | Open in IMG/M |
| 3300005239|Ga0073579_1001068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1374 | Open in IMG/M |
| 3300005239|Ga0073579_1005222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1155 | Open in IMG/M |
| 3300005239|Ga0073579_1082697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1777 | Open in IMG/M |
| 3300005239|Ga0073579_1580963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 892 | Open in IMG/M |
| 3300005931|Ga0075119_1013027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2737 | Open in IMG/M |
| 3300005931|Ga0075119_1014910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2489 | Open in IMG/M |
| 3300005931|Ga0075119_1071880 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 805 | Open in IMG/M |
| 3300006191|Ga0075447_10201245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 655 | Open in IMG/M |
| 3300006193|Ga0075445_10046053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1749 | Open in IMG/M |
| 3300006193|Ga0075445_10166971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 783 | Open in IMG/M |
| 3300006193|Ga0075445_10314781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 527 | Open in IMG/M |
| 3300006193|Ga0075445_10323674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 518 | Open in IMG/M |
| 3300007074|Ga0075110_1010897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2755 | Open in IMG/M |
| 3300007074|Ga0075110_1121729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 529 | Open in IMG/M |
| 3300007653|Ga0102868_1176103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 518 | Open in IMG/M |
| 3300007715|Ga0102827_1109747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 626 | Open in IMG/M |
| 3300007956|Ga0105741_1130631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 615 | Open in IMG/M |
| 3300008950|Ga0102891_1238809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 522 | Open in IMG/M |
| 3300009071|Ga0115566_10045393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3019 | Open in IMG/M |
| 3300009071|Ga0115566_10585852 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 626 | Open in IMG/M |
| 3300009079|Ga0102814_10650638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 578 | Open in IMG/M |
| 3300009172|Ga0114995_10342978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 821 | Open in IMG/M |
| 3300009172|Ga0114995_10577338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 614 | Open in IMG/M |
| 3300009173|Ga0114996_10469664 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300009193|Ga0115551_1060370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1836 | Open in IMG/M |
| 3300009420|Ga0114994_10468272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 831 | Open in IMG/M |
| 3300009420|Ga0114994_10539717 | Not Available | 767 | Open in IMG/M |
| 3300009420|Ga0114994_10663501 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 682 | Open in IMG/M |
| 3300009420|Ga0114994_11048874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 527 | Open in IMG/M |
| 3300009422|Ga0114998_10303490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 748 | Open in IMG/M |
| 3300009422|Ga0114998_10312337 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300009425|Ga0114997_10271124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 949 | Open in IMG/M |
| 3300009425|Ga0114997_10661899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 547 | Open in IMG/M |
| 3300009425|Ga0114997_10669419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 544 | Open in IMG/M |
| 3300009496|Ga0115570_10145882 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300009497|Ga0115569_10030655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3169 | Open in IMG/M |
| 3300009497|Ga0115569_10121452 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1287 | Open in IMG/M |
| 3300009498|Ga0115568_10145875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1131 | Open in IMG/M |
| 3300009498|Ga0115568_10470701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 538 | Open in IMG/M |
| 3300009508|Ga0115567_10184526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1360 | Open in IMG/M |
| 3300009526|Ga0115004_10115511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1639 | Open in IMG/M |
| 3300009526|Ga0115004_10291203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 969 | Open in IMG/M |
| 3300009526|Ga0115004_11003548 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
| 3300009544|Ga0115006_10421200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1169 | Open in IMG/M |
| 3300009786|Ga0114999_10420825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1047 | Open in IMG/M |
| 3300009842|Ga0131972_11021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 6261 | Open in IMG/M |
| 3300010368|Ga0129324_10123978 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300010883|Ga0133547_10435998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales | 2667 | Open in IMG/M |
| 3300010883|Ga0133547_10585862 | All Organisms → cellular organisms → Bacteria | 2234 | Open in IMG/M |
| 3300010883|Ga0133547_11439512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1298 | Open in IMG/M |
| 3300010883|Ga0133547_11466765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1283 | Open in IMG/M |
| 3300010883|Ga0133547_11576607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1228 | Open in IMG/M |
| 3300013010|Ga0129327_10257478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 893 | Open in IMG/M |
| 3300017697|Ga0180120_10188737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 858 | Open in IMG/M |
| 3300017729|Ga0181396_1070330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales | 703 | Open in IMG/M |
| 3300020165|Ga0206125_10285909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales | 620 | Open in IMG/M |
| 3300020187|Ga0206130_10032352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 4152 | Open in IMG/M |
| 3300020372|Ga0211683_10009205 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → Nitrospinia → Nitrospinales → Nitrospinaceae → Nitrospina | 3617 | Open in IMG/M |
| 3300020372|Ga0211683_10220554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 602 | Open in IMG/M |
| 3300020376|Ga0211682_10054027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1629 | Open in IMG/M |
| 3300020376|Ga0211682_10133631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 985 | Open in IMG/M |
| 3300020382|Ga0211686_10054278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1620 | Open in IMG/M |
| 3300020382|Ga0211686_10138586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1002 | Open in IMG/M |
| 3300020396|Ga0211687_10017086 | All Organisms → cellular organisms → Bacteria | 3807 | Open in IMG/M |
| 3300020396|Ga0211687_10090116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1310 | Open in IMG/M |
| 3300020396|Ga0211687_10229214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 746 | Open in IMG/M |
| 3300020396|Ga0211687_10422602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 509 | Open in IMG/M |
| 3300021378|Ga0213861_10147463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1339 | Open in IMG/M |
| 3300021959|Ga0222716_10711516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 532 | Open in IMG/M |
| 3300022853|Ga0222652_1005823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2738 | Open in IMG/M |
| 3300023240|Ga0222676_1009500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1897 | Open in IMG/M |
| (restricted) 3300024261|Ga0233439_10135876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1199 | Open in IMG/M |
| (restricted) 3300024264|Ga0233444_10098074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1542 | Open in IMG/M |
| 3300024348|Ga0244776_10541954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 744 | Open in IMG/M |
| 3300024428|Ga0233396_1150979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 512 | Open in IMG/M |
| 3300025438|Ga0208770_1004588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 5261 | Open in IMG/M |
| 3300025438|Ga0208770_1056893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales | 764 | Open in IMG/M |
| 3300025577|Ga0209304_1045540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1182 | Open in IMG/M |
| 3300025577|Ga0209304_1061314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 950 | Open in IMG/M |
| 3300025590|Ga0209195_1086486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 713 | Open in IMG/M |
| 3300025603|Ga0208414_1058252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales | 1077 | Open in IMG/M |
| 3300025663|Ga0209775_1205062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 533 | Open in IMG/M |
| 3300025668|Ga0209251_1136041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales | 656 | Open in IMG/M |
| 3300025676|Ga0209657_1165567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 611 | Open in IMG/M |
| 3300025690|Ga0209505_1075211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1016 | Open in IMG/M |
| 3300025694|Ga0209406_1041701 | All Organisms → cellular organisms → Bacteria | 1789 | Open in IMG/M |
| 3300025869|Ga0209308_10072397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1743 | Open in IMG/M |
| 3300025876|Ga0209223_10065331 | All Organisms → cellular organisms → Bacteria | 2134 | Open in IMG/M |
| 3300025876|Ga0209223_10109499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales | 1494 | Open in IMG/M |
| 3300025876|Ga0209223_10273610 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300025876|Ga0209223_10484652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → alpha proteobacterium HIMB114 | 507 | Open in IMG/M |
| 3300025880|Ga0209534_10125448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1406 | Open in IMG/M |
| 3300025881|Ga0209309_10409924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 582 | Open in IMG/M |
| 3300025886|Ga0209632_10093302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1774 | Open in IMG/M |
| 3300025886|Ga0209632_10133423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1394 | Open in IMG/M |
| 3300025886|Ga0209632_10238242 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300025890|Ga0209631_10047355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2843 | Open in IMG/M |
| 3300027572|Ga0208964_1054077 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 938 | Open in IMG/M |
| 3300027668|Ga0209482_1157625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 663 | Open in IMG/M |
| 3300027687|Ga0209710_1078512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1372 | Open in IMG/M |
| 3300027751|Ga0208304_10306002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 555 | Open in IMG/M |
| 3300027779|Ga0209709_10177194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1016 | Open in IMG/M |
| 3300027780|Ga0209502_10068936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales | 1879 | Open in IMG/M |
| 3300027780|Ga0209502_10454449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales | 512 | Open in IMG/M |
| 3300027801|Ga0209091_10192847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1022 | Open in IMG/M |
| 3300027813|Ga0209090_10323170 | Not Available | 759 | Open in IMG/M |
| 3300027838|Ga0209089_10441703 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300028194|Ga0257106_1071770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1275 | Open in IMG/M |
| 3300028196|Ga0257114_1303680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales | 550 | Open in IMG/M |
| 3300028197|Ga0257110_1049149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1839 | Open in IMG/M |
| 3300031510|Ga0308010_1077078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1320 | Open in IMG/M |
| 3300031510|Ga0308010_1118606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1010 | Open in IMG/M |
| 3300031510|Ga0308010_1224119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 670 | Open in IMG/M |
| 3300031510|Ga0308010_1292613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 560 | Open in IMG/M |
| 3300031519|Ga0307488_10215006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1291 | Open in IMG/M |
| 3300031519|Ga0307488_10316985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 997 | Open in IMG/M |
| 3300031519|Ga0307488_10756191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 543 | Open in IMG/M |
| 3300031598|Ga0308019_10254069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 666 | Open in IMG/M |
| 3300031599|Ga0308007_10007658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 4357 | Open in IMG/M |
| 3300031599|Ga0308007_10022758 | All Organisms → cellular organisms → Bacteria | 2446 | Open in IMG/M |
| 3300031599|Ga0308007_10051819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1550 | Open in IMG/M |
| 3300031599|Ga0308007_10313269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 518 | Open in IMG/M |
| 3300031629|Ga0307985_10387436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 540 | Open in IMG/M |
| 3300031630|Ga0308004_10077612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1433 | Open in IMG/M |
| 3300031644|Ga0308001_10163091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 905 | Open in IMG/M |
| 3300031659|Ga0307986_10002000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 14676 | Open in IMG/M |
| 3300031659|Ga0307986_10049312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2209 | Open in IMG/M |
| 3300031659|Ga0307986_10125188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1219 | Open in IMG/M |
| 3300031659|Ga0307986_10385154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 564 | Open in IMG/M |
| 3300031695|Ga0308016_10105663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1139 | Open in IMG/M |
| 3300031695|Ga0308016_10317775 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 568 | Open in IMG/M |
| 3300031695|Ga0308016_10372620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 510 | Open in IMG/M |
| 3300031702|Ga0307998_1017889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3060 | Open in IMG/M |
| 3300031702|Ga0307998_1059790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1486 | Open in IMG/M |
| 3300031702|Ga0307998_1111278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1003 | Open in IMG/M |
| 3300031702|Ga0307998_1308105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales | 500 | Open in IMG/M |
| 3300031721|Ga0308013_10207704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 719 | Open in IMG/M |
| 3300031721|Ga0308013_10277169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 595 | Open in IMG/M |
| 3300032151|Ga0302127_10202124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 881 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 20.67% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 16.67% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 10.67% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 10.67% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 10.00% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 4.67% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 4.00% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.00% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 3.33% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 2.00% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.00% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.33% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.33% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.33% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.33% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.33% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.67% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.67% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.67% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.67% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.67% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.67% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000265 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_10 | Environmental | Open in IMG/M |
| 3300001347 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 | Environmental | Open in IMG/M |
| 3300001349 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 | Environmental | Open in IMG/M |
| 3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
| 3300001353 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 | Environmental | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300001938 | Marine microbial communities from Bedford Basin, Nova Scotia, Canada - GS005 | Environmental | Open in IMG/M |
| 3300002186 | Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Metagenome | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005931 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9 | Environmental | Open in IMG/M |
| 3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
| 3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
| 3300007074 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8 | Environmental | Open in IMG/M |
| 3300007653 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-3 | Environmental | Open in IMG/M |
| 3300007715 | Estuarine microbial communities from the Columbia River estuary - metaG S.751 | Environmental | Open in IMG/M |
| 3300007956 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_0.2um | Environmental | Open in IMG/M |
| 3300008950 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
| 3300009497 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009544 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300009842 | Bacterial communities in Amundsen Sea Polynya. Combined Assembly of Gp0149108, Gp0149160, Gp0151052 | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
| 3300020372 | Marine microbial communities from Tara Oceans - TARA_B100000787 (ERX556133-ERR599090) | Environmental | Open in IMG/M |
| 3300020376 | Marine microbial communities from Tara Oceans - TARA_B100000795 (ERX555997-ERR599121) | Environmental | Open in IMG/M |
| 3300020382 | Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059) | Environmental | Open in IMG/M |
| 3300020396 | Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122) | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022853 | Saline water microbial communities from Ace Lake, Antarctica - #371 | Environmental | Open in IMG/M |
| 3300023240 | Saline water microbial communities from Ace Lake, Antarctica - #870 | Environmental | Open in IMG/M |
| 3300024261 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_100_MG | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024428 | Seawater microbial communities from Monterey Bay, California, United States - 32D | Environmental | Open in IMG/M |
| 3300025438 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9 (SPAdes) | Environmental | Open in IMG/M |
| 3300025577 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 (SPAdes) | Environmental | Open in IMG/M |
| 3300025590 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 (SPAdes) | Environmental | Open in IMG/M |
| 3300025603 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKE (SPAdes) | Environmental | Open in IMG/M |
| 3300025663 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_135m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025668 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025676 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025690 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 (SPAdes) | Environmental | Open in IMG/M |
| 3300025694 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 (SPAdes) | Environmental | Open in IMG/M |
| 3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
| 3300025876 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes) | Environmental | Open in IMG/M |
| 3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025881 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes) | Environmental | Open in IMG/M |
| 3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300027572 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_08_M0_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027668 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027751 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027780 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes) | Environmental | Open in IMG/M |
| 3300027801 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027838 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
| 3300028196 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m | Environmental | Open in IMG/M |
| 3300028197 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m | Environmental | Open in IMG/M |
| 3300031510 | Marine microbial communities from water near the shore, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031598 | Marine microbial communities from water near the shore, Antarctic Ocean - #284 | Environmental | Open in IMG/M |
| 3300031599 | Marine microbial communities from water near the shore, Antarctic Ocean - #71 | Environmental | Open in IMG/M |
| 3300031629 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #80 | Environmental | Open in IMG/M |
| 3300031630 | Marine microbial communities from water near the shore, Antarctic Ocean - #38 | Environmental | Open in IMG/M |
| 3300031644 | Marine microbial communities from water near the shore, Antarctic Ocean - #5 | Environmental | Open in IMG/M |
| 3300031659 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 | Environmental | Open in IMG/M |
| 3300031695 | Marine microbial communities from water near the shore, Antarctic Ocean - #233 | Environmental | Open in IMG/M |
| 3300031702 | Marine microbial communities from David Island wharf, Antarctic Ocean - #37 | Environmental | Open in IMG/M |
| 3300031721 | Marine microbial communities from water near the shore, Antarctic Ocean - #181 | Environmental | Open in IMG/M |
| 3300032151 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_SCM | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_102842941 | 3300000101 | Marine | KVHQRVEKKKALVLMERRSLKVEVTDPKVSPSKNTVKKELNSKIF* |
| DelMOSum2011_100854751 | 3300000115 | Marine | LKVHLLVERKKALVLMERRSLKVEVIDLKPLPLKNTVKKELNLKSL* |
| LP_A_09_P04_10DRAFT_10233262 | 3300000265 | Marine | VERKKALVLMERRSLKAEVIDLKALPSKNIVKKELKSKIF* |
| JGI20156J14371_100677473 | 3300001347 | Pelagic Marine | ERKKALVLMERRSLKVEVIDLKALPLKNIVKKELKSKIF* |
| JGI20156J14371_101879863 | 3300001347 | Pelagic Marine | KTLVLMERRSLKAEVIDLKTSPSKNIVKKELKSKIF* |
| JGI20160J14292_100293725 | 3300001349 | Pelagic Marine | KKALVLMERRSLKAEVIDLKALPSKNIVKKELRSKIF* |
| JGI20157J14317_100844164 | 3300001352 | Pelagic Marine | KKALVLMERRSLKAEVIDLKALPSKNIVKKELKSKIF* |
| JGI20159J14440_100811311 | 3300001353 | Pelagic Marine | QKRKTLLLKVKKNLKVEVIDLKVLLLKNIVKKEPNFKIF* |
| JGI20158J14315_100268874 | 3300001355 | Pelagic Marine | LVLMERRSLKAEVIDLKALPSKNIVKKELRSKIF* |
| GOS2221_10173861 | 3300001938 | Marine | VERKKVLVLMERRSLKVEVIDLKALPSKNIVKKELKSKIF* |
| JGI24539J26755_101312521 | 3300002186 | Marine | HLKVHLLVEREKNLVLMERRSLKAEVIDLKVSPSKNTVKKKLKFKTF* |
| Ga0073579_10010681 | 3300005239 | Marine | SSTSGEKKVLVLMERRSLKVEVIDLKALPSKNIVKKELKSKIF* |
| Ga0073579_10052222 | 3300005239 | Marine | LEKKHLKVHQLVKRKKTLVLMDRRSLKAEVIDLKALPSKTQSKRAKV* |
| Ga0073579_10826972 | 3300005239 | Marine | VHLLVERKKALVLMERRSLKVEVIDLKALPSKNIVKKELKSKIF* |
| Ga0073579_15809632 | 3300005239 | Marine | MERKKALVLMEKRSLKVEVIDLKALPSKNIVKKELKSKIF* |
| Ga0075119_10130271 | 3300005931 | Saline Lake | VERKKALVLMEKRSLKVEATDLKASPSKNIVKKELKFKTF* |
| Ga0075119_10149101 | 3300005931 | Saline Lake | VEKKKALVLMERRSLKVEVTDPKALPSKNTVKKELKSKTF* |
| Ga0075119_10718801 | 3300005931 | Saline Lake | QLVERKKALVLMERRSLKAEVIDLKALPLRNIVKKETNLKIS* |
| Ga0075447_102012453 | 3300006191 | Marine | ALVLMERRSLKAEVIDLKASPSKNTVKKEEKSKIF* |
| Ga0075445_100460532 | 3300006193 | Marine | LKVHQLVERKKALVLMERRSLKVEVIDLKALPLKNTVKKELKSKTF* |
| Ga0075445_101669711 | 3300006193 | Marine | APVLMERRSLKAEVIDLKISPSKNIVKKKLKPKTF* |
| Ga0075445_103147811 | 3300006193 | Marine | HLKVHQRVEKKKALVLMERRSLKAEVIDLKASPSKNIAKKNKV* |
| Ga0075445_103236743 | 3300006193 | Marine | VERKKALVLMERRSLKAEVIDLKASPSKNIAKKKIKSKTF* |
| Ga0075110_10108971 | 3300007074 | Saline Lake | LKVHPLVERKKALVLMEKRSLKVEATDLKASPSKNIVKKELKFKTF* |
| Ga0075110_11217292 | 3300007074 | Saline Lake | LVERKKALVLMEKRSLKVEATDLKASPSKNIVKKELKSKTF* |
| Ga0102868_11761032 | 3300007653 | Estuarine | VHPVVERKKALVLMERRSLKVEVIDLKALPSKNIVKKELKSKIF* |
| Ga0102827_11097473 | 3300007715 | Estuarine | LVLMERRSLKAEVIDLKALPSKNTVKKELKSKIF* |
| Ga0105741_11306311 | 3300007956 | Estuary Water | LVLMERRSLKVEVIDLKVSPSKNIVKKELKSKIF* |
| Ga0102891_12388093 | 3300008950 | Estuarine | KHLKVHPLVERKKALVLMEKRSLKVEATDLKASPLKNIVKKELKSKIF* |
| Ga0115566_100453935 | 3300009071 | Pelagic Marine | KVHLLVERKKALVLMERRSLKAEVIDLKALPSKNIVKKELRSKIF* |
| Ga0115566_105858521 | 3300009071 | Pelagic Marine | EKAEALMERRSLKVEVTGPKALPLKNIVKKELKSKIS* |
| Ga0102814_106506383 | 3300009079 | Estuarine | LLVERKKALVLMERRSLKVEMIDLKTLPSKNIAKKELKLKIF* |
| Ga0114995_103429782 | 3300009172 | Marine | VHQLVGIKKALVLIEKRSLKVEMIDQKTSPLKSIVKKELKSKIF* |
| Ga0114995_105773383 | 3300009172 | Marine | RKKTLVFKERKSLKAEVTDLKVLPSKNTVKKELKSKIF* |
| Ga0114996_104696641 | 3300009173 | Marine | HLKAHQRVEKKKALVLMERKSLKVEVTDPKALPSKNTVKKDLKSKTF* |
| Ga0115551_10603701 | 3300009193 | Pelagic Marine | KHLKVHLLVERKKALVLMERRSLKVEVTDPKALPSKNTVKKDLKSKTF* |
| Ga0114994_104682721 | 3300009420 | Marine | EKKKTLVLMERRNLKVEVIDPKASPLKNIVKKELKSKIF* |
| Ga0114994_105397171 | 3300009420 | Marine | ERKKAQGLMERRSLKAEVIDLKVSPSKNIVKKELKSKTF* |
| Ga0114994_106635011 | 3300009420 | Marine | KKALVLMERRSLKAEVTDLKALLSKNTVKKELKSKIF* |
| Ga0114994_110488743 | 3300009420 | Marine | EKKSLKVQQLAKIKKVLVSRERRGLKVEVIDLKVSLSKNIVKKN* |
| Ga0114998_103034901 | 3300009422 | Marine | HLKVHQRVEKKKALVLMERRSLKVEVIDPKALPSKNTVKKELKSKTF* |
| Ga0114998_103123371 | 3300009422 | Marine | VERKKALVLMERRSLKVEVIDLKASPSKNIVKKELKFKTF* |
| Ga0114997_102711241 | 3300009425 | Marine | LKVHQRVEKKKALVLMERRSLKVEVTDPKALPSKNTVKKDLKSKTF* |
| Ga0114997_106618991 | 3300009425 | Marine | KEKALVLMERRSLKAEVIDPKASPSKNTVKKELKSKIF* |
| Ga0114997_106694191 | 3300009425 | Marine | APVLMERKSLKVEVTDLKVLPSKNTVKKELKSKIS* |
| Ga0115570_101458821 | 3300009496 | Pelagic Marine | KALVLMERRSLKVEVIDLKALPSKNIVKKELKSKTF* |
| Ga0115569_100306551 | 3300009497 | Pelagic Marine | LVERKKALVLMDRRSLKAEVIDLKALPSKNIVKKELRSKIF* |
| Ga0115569_101214522 | 3300009497 | Pelagic Marine | KRKTLLLKEKRSLKAEVTDLKASPSKNIVKKELKFKIF* |
| Ga0115568_101458751 | 3300009498 | Pelagic Marine | KKVQVLMKRRGLSAEVIDQKVLLLKNIVKKELKLKTF* |
| Ga0115568_104707012 | 3300009498 | Pelagic Marine | PVLTERRSLKVEVIDLRVLPSKNTVKKELKSKTF* |
| Ga0115567_101845263 | 3300009508 | Pelagic Marine | ALVLMERRSLKAEVIDLKVLPSKNIVKKELKSKIF* |
| Ga0115004_101155111 | 3300009526 | Marine | KALVLMERRSLKVEVTDLRVLLSKNTVKKELKSKTF* |
| Ga0115004_102912031 | 3300009526 | Marine | RVEKKKALVLMERRSLKVEVTDPKALPSKNTVKKELKSKTF* |
| Ga0115004_110035481 | 3300009526 | Marine | HLKVHLLVERKKALVLMERRSLKAEVTDLKVLHLKSTVKKKLKSKIF* |
| Ga0115006_104212003 | 3300009544 | Marine | HQRVEKKKALVLMERRSLKVEVTDPKALPSKNTVKKELKSKTF* |
| Ga0114999_104208251 | 3300009786 | Marine | IKKALVLMEKRSLKVEVIDLRVLPSKNTVKEELKSKTF* |
| Ga0131972_110214 | 3300009842 | Marine | KALVLMERRSLKAEVIDLKASPSKNIVKKKLKFKTF* |
| Ga0129324_101239783 | 3300010368 | Freshwater To Marine Saline Gradient | LVERKKALVLMERRSLKVEVIDLKVLPSKNIVKKELKSKIF* |
| Ga0133547_104359981 | 3300010883 | Marine | IKKALVLMERRSLKAEVIDLKALPSKNTAKKELKSKIF* |
| Ga0133547_105858624 | 3300010883 | Marine | LVLMERRSLKVEVIDLKVLPSKNTVKKELKSKIF* |
| Ga0133547_114395121 | 3300010883 | Marine | QRVEKKKALVLMERRSLKVEVTDPKALPSKNTVKKELKSKTF* |
| Ga0133547_114667651 | 3300010883 | Marine | KALVLMERRSLKVEVTDPKTLPSKNTVKKELKSKTF* |
| Ga0133547_115766073 | 3300010883 | Marine | KVHQRVEKKKALVLMERRSLKVEVTDPKALPSKNTVKKELRSKTF* |
| Ga0129327_102574783 | 3300013010 | Freshwater To Marine Saline Gradient | QKRKTLLLKVKKSLRVEAIDLKASPSKNTVKKELKSKTF* |
| Ga0180120_101887371 | 3300017697 | Freshwater To Marine Saline Gradient | KKQLKVHLLVEKEKALVLMERRSLKAEAIDLKALLSKNTVKKELKSKIF |
| Ga0181396_10703301 | 3300017729 | Seawater | KHLKIHHLVQIKKTLALVEKRSLKAETTDLKVLPSKNIVKKELNLKTF |
| Ga0206125_102859091 | 3300020165 | Seawater | LKAHLLVEKEKALVLMERRSLKVEAIDLKALPLKNTVKEELKPRTF |
| Ga0206130_100323521 | 3300020187 | Seawater | ERKKALVLMERRSLKAEVIDLKALPSKNIVKKELKSKIF |
| Ga0211683_100092056 | 3300020372 | Marine | RVEKKKALVLMERRSLKVEVTDPKASPSRNTVKRELKPKSF |
| Ga0211683_102205543 | 3300020372 | Marine | KKALVLMERRSLKAEVIDLKASPSKNIVKKELKSKTF |
| Ga0211682_100540271 | 3300020376 | Marine | VHQLVGRKKALGLMERRSLKAEVIDPKVSPLKNIVKKRTKF |
| Ga0211682_101336313 | 3300020376 | Marine | KALVLMERRSLKAEVIDLKASPSKNTVKKEEKSKIF |
| Ga0211686_100542781 | 3300020382 | Marine | IKKTLVLMERKSLKVEVTDPKVSLLKNIAKKELKLKFF |
| Ga0211686_101385861 | 3300020382 | Marine | VHQRVEKKKALVLMERRSLKAEVIDPKASPSKNIVKKELKFKTF |
| Ga0211687_100170865 | 3300020396 | Marine | VERKKALVLMEKRSLKVEATDLKASPSKNIVKKELKSKIF |
| Ga0211687_100901163 | 3300020396 | Marine | KKKALVLMERRSLKVEVTDPKTLPSKNTVKKELKFKTF |
| Ga0211687_102292141 | 3300020396 | Marine | LVERKKALVLMERRSLKVEVIDLKALPSKNIVKKELKSKIF |
| Ga0211687_104226021 | 3300020396 | Marine | ERKKALVLIERRSLKAEVIDLKALPSKNIVKKELKSKIF |
| Ga0213861_101474634 | 3300021378 | Seawater | KRKTLLLKVKKSLRVEAIDLKASPSKNTVKKELKSKTF |
| Ga0222716_107115161 | 3300021959 | Estuarine Water | KAHLLVEKEKALVLTERRGLKAEAIDLKALLLKNIVKKELKPRIF |
| Ga0222652_10058231 | 3300022853 | Saline Water | EKKKALVLMERRSLKVEVTDPKALPSKNTVKKDLKSKTF |
| Ga0222676_10095006 | 3300023240 | Saline Water | HQRVEKKKALVLMERRSLKVEVTDPKTLPSKNTVKKELKSKTF |
| (restricted) Ga0233439_101358763 | 3300024261 | Seawater | QKRKTLLLKVKKSLRVEAIDLKASPSKNTVKKELKSKTF |
| (restricted) Ga0233444_100980741 | 3300024264 | Seawater | LLVERKKALVLMERRSLKAEVIDLKVLPSKNTVKKELKSKIF |
| Ga0244776_105419541 | 3300024348 | Estuarine | VEKEKALVLMERRSLKVEAIDLKVSLLKNIVKKELNPRTF |
| Ga0233396_11509793 | 3300024428 | Seawater | KAHPLAEKEKALVLMERRSLKVEAIDLKALPLKNTVKEELKPRTF |
| Ga0208770_10045881 | 3300025438 | Saline Lake | VERKKALVLMEKRSLKVEATDLKASPSKNIVKKELKFKTF |
| Ga0208770_10568934 | 3300025438 | Saline Lake | ERKKALVLMEKRSLKVEATDLKASPSKNIVKKELKSKTF |
| Ga0209304_10455401 | 3300025577 | Pelagic Marine | DQAQKRKTLLLKVKKSLRVEAIDLKASPSKNTVKKELKSKTF |
| Ga0209304_10613141 | 3300025577 | Pelagic Marine | QKRKTLLLKVKKSLRVEVIDLKVLLLKNIVKKEPNFKIF |
| Ga0209195_10864861 | 3300025590 | Pelagic Marine | KKKTLLLKEKRSLKAEVTDLKASPSKNTVKKEIKSRTF |
| Ga0208414_10582521 | 3300025603 | Saline Lake | KKALVLMEKRSLKVEATDLKASPSKNIVKKELKFKTF |
| Ga0209775_12050621 | 3300025663 | Marine | VHPLVERKKALVLMEKRSLKVEATDLKASPLKNIVKKELKSKIF |
| Ga0209251_11360413 | 3300025668 | Marine | EMERKKALALVERRSLKVEVTDLKILPLKNIAKKELKSKTF |
| Ga0209657_11655671 | 3300025676 | Marine | ALKRKTLLLKEKRSLKAEVTDLKASPSKNTVKKEIKSRTF |
| Ga0209505_10752113 | 3300025690 | Pelagic Marine | KALVLMERRSLKVEVIDLKALPSKNIVKKELNLKSL |
| Ga0209406_10417011 | 3300025694 | Pelagic Marine | LVERKKALVLMERRSLKAEVIDLKALPSKNIVKKELRSKIF |
| Ga0209308_100723974 | 3300025869 | Pelagic Marine | QRAEKKKALVLMERRSLKVEVTDPKALPSKNTVKKDLKSKTF |
| Ga0209223_100653314 | 3300025876 | Pelagic Marine | LKVHLLVERKKALVLMERRSLKAEVIDLKALPSKNIVKKELRSKIF |
| Ga0209223_101094991 | 3300025876 | Pelagic Marine | KRKTLLLKEKRSLKAEVTDLKALPSKNTVKKEIKFRTF |
| Ga0209223_102736103 | 3300025876 | Pelagic Marine | VEKKKALVLMERRSLKAEVIDLKALPSKNIVKKELKSKIF |
| Ga0209223_104846522 | 3300025876 | Pelagic Marine | HLVEKKKVQVLMKRRGLRAEVIDQKVLLLKNIVKKELKLKTF |
| Ga0209534_101254481 | 3300025880 | Pelagic Marine | VERKKALVLMERRSLKAEVIDLKALPSKNIVKKELKSKIF |
| Ga0209309_104099242 | 3300025881 | Pelagic Marine | AHQLVEKKKVLVLMERRSLKVEVIDLKVSPSKNIVKKELKSKIF |
| Ga0209632_100933021 | 3300025886 | Pelagic Marine | VHLVMVRKKVLILIERRSLKVEVIDLKASPSKNTVKKELKSKTF |
| Ga0209632_101334231 | 3300025886 | Pelagic Marine | KVQVLMERRGLRAEVIDLKVLLLKNIVKKELKLKTF |
| Ga0209632_102382423 | 3300025886 | Pelagic Marine | VKEKVLVLTERRDLKVETIDLKALPLKNIVKKDLKLKIF |
| Ga0209631_100473555 | 3300025890 | Pelagic Marine | KKALVLMERRSLKAEVIDLKALPSKNIVKKELRSKIF |
| Ga0208964_10540771 | 3300027572 | Marine | VERKKALVLMERRGLKAEVIDLKASPSKNIIKKELKFKIF |
| Ga0209482_11576253 | 3300027668 | Marine | KKALVLMERRSLKAEVIDLKASPSKNTVKKEEKSKIF |
| Ga0209710_10785123 | 3300027687 | Marine | WIKKILVLMERKSLKVEVIDLKASPLKNTVKKELKSKIF |
| Ga0208304_103060023 | 3300027751 | Estuarine | KHLKVHPLVERKKALVLMEKRSLKVEATDLKASPLKNIVKKELKSKIF |
| Ga0209709_101771941 | 3300027779 | Marine | KTLVLMERRSLKVEAIDLRILPSKNTVKKELKSKIF |
| Ga0209502_100689364 | 3300027780 | Marine | KHLKVHLLMEKKKTLVLMERKSLKAEVIDLKALLLKNIVKKELKSKIF |
| Ga0209502_104544491 | 3300027780 | Marine | RKQALVLMERRSLKVEVIDLKASPSKNIVKKELKSKTF |
| Ga0209091_101928471 | 3300027801 | Marine | VERKKTLVLMVRRSLKAEVTDLKALPLKSTVKKELKSKIF |
| Ga0209090_103231701 | 3300027813 | Marine | KAQGLMERRSLKAEVIDLKVSPSKNIVKKELKSKTF |
| Ga0209089_104417032 | 3300027838 | Marine | QMKEKKKVLVLKVRKSLKAEAIDLKVLPLKNIVKKELKSKIFLIFLF |
| Ga0257106_10717701 | 3300028194 | Marine | YLKVHPLVEREKTLVLMERRSLRVEVTDLKASPSKNIVKKELKFKIF |
| Ga0257114_13036801 | 3300028196 | Marine | KTHQIVMIKKTLVLKEKKNSKVEVIDLKALPLKNIVKRELNLKIF |
| Ga0257110_10491491 | 3300028197 | Marine | HQRVEKKKALVLMERRSLKVEVTDPKALPSKNIVKKELKFKTF |
| Ga0308010_10770783 | 3300031510 | Marine | PLVERKKALVLMERRSLKAEVIDLKASPSKNIVKKELKSKTF |
| Ga0308010_11186061 | 3300031510 | Marine | LEKKHPKVHQLVEKKKALVLMERRSLKVEVIDLKVLPSKNIVKKELRSKIF |
| Ga0308010_12241191 | 3300031510 | Marine | KKKALVLMERRSLKVEVIGLKASPSKNIAKKKIKFKTF |
| Ga0308010_12926131 | 3300031510 | Marine | IKKALVLMERRSLKVEAIDLRALPSKNTVKKELKFKIF |
| Ga0307488_102150064 | 3300031519 | Sackhole Brine | VEKKKALVLMERRSLKVEVTDPKTLPSKNTVKKELKFKTF |
| Ga0307488_103169851 | 3300031519 | Sackhole Brine | EKKKALVLMERRNLKVEVTDPKALPSKNTVKKELKSKTF |
| Ga0307488_107561912 | 3300031519 | Sackhole Brine | KKALVLMERRSLKVEVIDLKASPSKNIVKKEFKSKTF |
| Ga0308019_102540693 | 3300031598 | Marine | LVERKKALGLMEKRSLKVEVIDLKASPSKNIVKKELKFKIF |
| Ga0308007_100076581 | 3300031599 | Marine | KKHLKVHPLMERKKALVLMERRSLKAEAIDLKILPSKNTKKNY |
| Ga0308007_100227581 | 3300031599 | Marine | KKALRLMERRSLKAEVTDLKASPSKNIVKSEPKFKIF |
| Ga0308007_100518191 | 3300031599 | Marine | HQRVEKKKALVLMERRSLKVEVTDPKALPSKNTVKKELKFKTF |
| Ga0308007_103132691 | 3300031599 | Marine | KVHQRVEKKKALVLMERRNLKAEVIDLKASPSKNIVKKKLKSKTF |
| Ga0307985_103874361 | 3300031629 | Marine | KKHLKVHQLVERKKALVLMEKRSLKVEVTDLKVSPSKNIVKKELKSKTF |
| Ga0308004_100776121 | 3300031630 | Marine | KLLKVYLLVEKKKALVLMGRRSLKVEVTGPKALLSKNTVKKELKSKIF |
| Ga0308001_101630913 | 3300031644 | Marine | QMAIKKALVLMERRSLKAEVIDLKALPSKNTAKKELKSKIF |
| Ga0307986_100020001 | 3300031659 | Marine | KVHQPAERKKALRLMERRSLKAEVTDLKASPSKNIVKSEPKFKIF |
| Ga0307986_100493124 | 3300031659 | Marine | RVEKKKALVLMERGSLKVEVTDPKALPSKNTVKKELKFKTF |
| Ga0307986_101251881 | 3300031659 | Marine | QLVQIKKALVLMERRSLKVEVTDLRVLPSKNTVKKELKSKTF |
| Ga0307986_103851543 | 3300031659 | Marine | APVLMERRNLKVEVIDPKVLPSKNTVKKELKPKTF |
| Ga0308016_101056631 | 3300031695 | Marine | KKVLVLMERRSLKVEVTDPKALPLKNIVKKELKSKIS |
| Ga0308016_103177751 | 3300031695 | Marine | HLKVHQPAERKKALRLMERRSLKAEVTDLKASPSKNIVKSEPKFKIF |
| Ga0308016_103726203 | 3300031695 | Marine | KKHLKVHQRVEKKKALVLMERRSLKAEVIDLKVSPSKNIVKKELKSKTF |
| Ga0307998_10178891 | 3300031702 | Marine | VERKKALVLMERRSLKAEVIDLKASPSKNTVKKEEKSKIF |
| Ga0307998_10597904 | 3300031702 | Marine | HQLVEKKKVLVLMEKRSLKVEVTDLKASPSKNIVKIIKKDLKRGFL |
| Ga0307998_11112783 | 3300031702 | Marine | VERKKALVLTERRSLKVEVTDLKASPSKNIVKKELKSKTF |
| Ga0307998_13081051 | 3300031702 | Marine | HQPVERKKALVLMKKRSLKAEVTDPKASPSKNIVKRELKFKIF |
| Ga0308013_102077043 | 3300031721 | Marine | LVERKKVLVLMERRSLKAEVIDLKASPSKNIVKKERKLKTF |
| Ga0308013_102771691 | 3300031721 | Marine | KKALVLMQRRSLKVEVTDPKALPSKNTVKKELKSKIF |
| Ga0302127_102021242 | 3300032151 | Marine | HQRVEKKKALVLMERRSLKVEVTDPKALPSKNTVKKELKSKTF |
| ⦗Top⦘ |