| Basic Information | |
|---|---|
| Family ID | F045913 |
| Family Type | Metagenome |
| Number of Sequences | 152 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MEAFLIVLAVIAGTGVAFFLFVIEPRRKIYDYDPRD |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 151 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 73.03 % |
| % of genes near scaffold ends (potentially truncated) | 42.11 % |
| % of genes from short scaffolds (< 2000 bps) | 93.42 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (73.026 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.632 % of family members) |
| Environment Ontology (ENVO) | Unclassified (51.316 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.842 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.31% β-sheet: 0.00% Coil/Unstructured: 54.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 151 Family Scaffolds |
|---|---|---|
| PF04226 | Transgly_assoc | 3.31 |
| PF03457 | HA | 1.99 |
| PF04392 | ABC_sub_bind | 1.32 |
| PF01165 | Ribosomal_S21 | 1.32 |
| PF07040 | DUF1326 | 1.32 |
| PF08972 | DUF1902 | 0.66 |
| PF02653 | BPD_transp_2 | 0.66 |
| PF01425 | Amidase | 0.66 |
| PF08734 | GYD | 0.66 |
| PF07676 | PD40 | 0.66 |
| PF01381 | HTH_3 | 0.66 |
| PF12804 | NTP_transf_3 | 0.66 |
| PF09361 | Phasin_2 | 0.66 |
| PF00589 | Phage_integrase | 0.66 |
| PF00872 | Transposase_mut | 0.66 |
| PF08388 | GIIM | 0.66 |
| PF05762 | VWA_CoxE | 0.66 |
| PF02371 | Transposase_20 | 0.66 |
| PF06707 | DUF1194 | 0.66 |
| PF07369 | DUF1488 | 0.66 |
| PF03401 | TctC | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 151 Family Scaffolds |
|---|---|---|---|
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 3.31 |
| COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 1.32 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.32 |
| COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 1.32 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.66 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.66 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.66 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.66 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 73.03 % |
| All Organisms | root | All Organisms | 26.97 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.34% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 23.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.24% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.29% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.63% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.97% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.97% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.32% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.32% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.32% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.66% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.66% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.66% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000734 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300022518 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 20-24 | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026723 | Grasslands soil microbial communities from Chapel Hill, North Carolina, USA that are Nitrogen fertilized - NN357 (SPAdes) | Environmental | Open in IMG/M |
| 3300026800 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 43 (SPAdes) | Environmental | Open in IMG/M |
| 3300026810 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 16 (SPAdes) | Environmental | Open in IMG/M |
| 3300026819 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 59 (SPAdes) | Environmental | Open in IMG/M |
| 3300026847 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 20 (SPAdes) | Environmental | Open in IMG/M |
| 3300026869 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 53 (SPAdes) | Environmental | Open in IMG/M |
| 3300026871 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 78 (SPAdes) | Environmental | Open in IMG/M |
| 3300026908 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 77 (SPAdes) | Environmental | Open in IMG/M |
| 3300026927 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 56 (SPAdes) | Environmental | Open in IMG/M |
| 3300026941 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 39 (SPAdes) | Environmental | Open in IMG/M |
| 3300026942 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 63 (SPAdes) | Environmental | Open in IMG/M |
| 3300026979 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 13 (SPAdes) | Environmental | Open in IMG/M |
| 3300026982 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 7 (SPAdes) | Environmental | Open in IMG/M |
| 3300027010 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 64 (SPAdes) | Environmental | Open in IMG/M |
| 3300027014 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027019 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 22 (SPAdes) | Environmental | Open in IMG/M |
| 3300027042 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 68 (SPAdes) | Environmental | Open in IMG/M |
| 3300027043 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027049 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 72 (SPAdes) | Environmental | Open in IMG/M |
| 3300027063 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes) | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12535J11911_10140211 | 3300000734 | Tropical Forest Soil | MEIFLIALLVIAATGVAFFLFVIEPRRKIYDYDPLDPR* |
| AF_2010_repII_A001DRAFT_101017022 | 3300000793 | Forest Soil | EFFLIALAVIAATGVVFFLFVMEPRRKIYDYDPHGPQ* |
| Ga0066388_1030613431 | 3300005332 | Tropical Forest Soil | MEVFLIALAVIAGTGVVFFLFVIEPRRKIYDYDPVSGDRL* |
| Ga0066388_1069442071 | 3300005332 | Tropical Forest Soil | MEMFFIVLAVIAGAGVAFFLFVIEPRRKIYDYDPRDYDPGPR* |
| Ga0070714_1021473042 | 3300005435 | Agricultural Soil | LEAVMEVFLIGLALVAGAGIVFFLFVIEPRRKVYDYDPRDF |
| Ga0070697_1009964822 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MEMFFIVPALVAGAGIVFFLFVIEPRRKIYDYDPSDYDPRGPR* |
| Ga0066903_1007313201 | 3300005764 | Tropical Forest Soil | MEVFFIMLAVIAGAGIAVFLFVIEPRRKIYDYDPHDPRQ* |
| Ga0066903_1021789083 | 3300005764 | Tropical Forest Soil | MEFFLIALLAIAATGVVFFLFVMEPRRKIYDYDPRDPR* |
| Ga0066903_1022708261 | 3300005764 | Tropical Forest Soil | MEFFLIALLAIAATGVVFFLFVMEPRRKIYDYDPR |
| Ga0066903_1022708263 | 3300005764 | Tropical Forest Soil | FFLIALLAIAATGVVFFLFVMEPRRKIYDYDPRDPR* |
| Ga0066903_1025290481 | 3300005764 | Tropical Forest Soil | LEALRGVYVVEAILIVLAAIAATGVVFFLFVIEPRRKIYDYDPLDHR* |
| Ga0066903_1056090362 | 3300005764 | Tropical Forest Soil | MEVFLIALAVIAGTGVVFLLFVIEPRRKIYDYDPVSGDRL* |
| Ga0066903_1057374073 | 3300005764 | Tropical Forest Soil | LEAVMEIFLIALLVIAATGVAFFLFVIEPHRKIYDYDPLDPR* |
| Ga0066903_1058489071 | 3300005764 | Tropical Forest Soil | LEAVMEVFLIGLALVAGAGIAFFLFVIEPRRKIYDYDPATFDKR* |
| Ga0066903_1058834502 | 3300005764 | Tropical Forest Soil | FLIALAVIAATGVVFFLFVMEPRRKIYDYDPHGPQ* |
| Ga0066903_1080711471 | 3300005764 | Tropical Forest Soil | MEIFLIILAVIAGIGVAIFLFVIEPRRAIYDYDPHDPRQ* |
| Ga0075023_1002115211 | 3300006041 | Watersheds | MEVFLIGLAVIAGAGVAFFLFVIEPRRKIYDYDPRDYDPGPR* |
| Ga0075024_1000575622 | 3300006047 | Watersheds | MEVFFIGLAVIAGTGVAFFLFVIEPRRKIYDYDPRDYDPRDPR* |
| Ga0075029_1008499242 | 3300006052 | Watersheds | ISGSVYAMETFFIALAVMAMAGVCIFLFVIEPRRKIYDQ* |
| Ga0070712_1003814161 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MEVFLIGLALVAGAGIVFFLFVIEPRRKVYDYDPRDFGK* |
| Ga0070712_1005544811 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MEVFLIGLALVAGAGIGFLLFVIEPRRKIYDYDPATFGKR* |
| Ga0079222_101859282 | 3300006755 | Agricultural Soil | MEMFLIVLAVIAGTGIVFFLFVIEPRRKIYDYDPRDFDPRDPR* |
| Ga0073928_100347873 | 3300006893 | Iron-Sulfur Acid Spring | METLLIVLGVIAGAAVVFWLFFIEPRRKIYDRDD* |
| Ga0073928_101989713 | 3300006893 | Iron-Sulfur Acid Spring | YFLERKVMETFLIVLAIAAMAGICVFLFVIEPRRKIYD* |
| Ga0075426_106427231 | 3300006903 | Populus Rhizosphere | MEMFFIVLAVIAGAGVAFFLFVIEPRRKIYDYDPRDYDPRGPR* |
| Ga0075435_1016839131 | 3300007076 | Populus Rhizosphere | FFIVLAVIAGTGVAFFLFVIEPRRKIYDYDPRDYDPRGPR* |
| Ga0126384_110289301 | 3300010046 | Tropical Forest Soil | FLIMLVVIAGVGVAVFLFVIEPRRKIYDYDPHDPRQ* |
| Ga0126373_103593512 | 3300010048 | Tropical Forest Soil | MELFLIVFLAIAGTGIAFFLFVIEPRRKIYDYDPRDLR* |
| Ga0126373_122405581 | 3300010048 | Tropical Forest Soil | MEAFLIMLVAIAGVGVAFFLFVIEPRRKIYDYDPHDPRQ* |
| Ga0126376_115695533 | 3300010359 | Tropical Forest Soil | VMEVFFLMLAVIAGVGVAVFLFVIEPRRKIYDYDPHDPRQ* |
| Ga0126378_129016092 | 3300010361 | Tropical Forest Soil | MELFLIVLLAIAGTGIAFFLFVLEPRRKIYDYDPRDLR* |
| Ga0126379_102633234 | 3300010366 | Tropical Forest Soil | MEVFLIMLVVIAGVGVAVYLFVIEPRRKIYDYDPHDPRQ* |
| Ga0126381_1006604481 | 3300010376 | Tropical Forest Soil | GIFLIALAVIAATGVAFFLFVMEPRRKIYDYDLHDPR* |
| Ga0126381_1019390851 | 3300010376 | Tropical Forest Soil | MEVFLIGLALVAGAGIAFFLFVIEPRRKIYDYDPATFDKR* |
| Ga0126375_114924932 | 3300012948 | Tropical Forest Soil | EAPREAYGMEAFFIVLAAIAAAGVVFFLFVIEPRRKVYDYDPLDPR* |
| Ga0126369_106665481 | 3300012971 | Tropical Forest Soil | MELFLIVLLAIAGTGIAFFLFVIEPRRKIYDYDPRDLR* |
| Ga0126369_121183062 | 3300012971 | Tropical Forest Soil | WGATVMEVFFIMLAVIAGAGIAVFLFVIEPRRKIYDYDPHDPRQ* |
| Ga0182036_100180061 | 3300016270 | Soil | VMEMFLIALALIAGTGVVFLLFVIEPRRKIYDYDPCDHR |
| Ga0182036_117862151 | 3300016270 | Soil | LEALRGAYVMEAFLIVLAVIAAAGVVLFLFVIEPRRKIYDYDPLDPR |
| Ga0182036_118306662 | 3300016270 | Soil | LEAPREACGMEAFLIVLAAIAAAGVVFFLFVIEPRRKIYDYDPLDPR |
| Ga0182033_101805303 | 3300016319 | Soil | GGVYVMEAFLIVLAVIAGTGVAFFLFVIEPRRKIYDYDPRDYDRRDTG |
| Ga0182033_103295433 | 3300016319 | Soil | MEAFLIVLAVIAETGVAFFLFVIEPRRKIYDYDPRDYDRRDT |
| Ga0182033_105791241 | 3300016319 | Soil | PLLGSDVMEVFFLMLAVIAGVGVAVFLFVIEPRRKIYDYDPHDPRQ |
| Ga0182035_100301579 | 3300016341 | Soil | MEAFLIVLAVIAGTGVAFFLFVIEPRRKIYDYDPRDYDRRDT |
| Ga0182032_100915074 | 3300016357 | Soil | EHTVMEMFFIVLAVIAGAGVAFFLFVIEPRRKIYDYDPRDYDPGPR |
| Ga0182032_109846341 | 3300016357 | Soil | MELFLIVLLAIAGTGIAFFLFVIEPRRKIYDYDPRDL |
| Ga0182040_102453361 | 3300016387 | Soil | LEAVMELFLIVLLAVAGTGIAFFLFVIEPRRKIYDYDPRDLR |
| Ga0182037_112754081 | 3300016404 | Soil | GEHTVMEMFFIVLAVIAGAGVAFFLFVIEPRRKIYDYDPRDYDPGPR |
| Ga0182037_119927751 | 3300016404 | Soil | MEFFLIALAVIAGTGVIFFLFVIEPRRKIYDYDPPDAQ |
| Ga0182039_105304912 | 3300016422 | Soil | MEIFLIALLVVAATGVAFFLFVIEPRRKIYDYDPLDPR |
| Ga0182039_105939613 | 3300016422 | Soil | MEVFFIMLAVIAGVGIAVFLFVIEPRRKIYDYDPHD |
| Ga0182039_115639881 | 3300016422 | Soil | LEAVMELFLIVLLAIAGTGIAFFLFVMEPRRKIYDYDPRDHR |
| Ga0182038_108921162 | 3300016445 | Soil | MELFLIVLLAIAVTGIAFFLFVMEPRRKIYDYDPRDHR |
| Ga0187779_105018971 | 3300017959 | Tropical Peatland | LEALREDTVMEMFFIVLAVIAGTAVAFWLFVIEPRRKIYDYDPRDYDPRDRR |
| Ga0187778_100497194 | 3300017961 | Tropical Peatland | MEMFFIVLAVIAGTAVAFWLFVIEPRRKIYDYDPRDYDPRDRR |
| Ga0187783_109144762 | 3300017970 | Tropical Peatland | MEAFLIALAVIAAAGIAFFLFVIEPRRKIYDYDPLSGDRP |
| Ga0210397_109003811 | 3300021403 | Soil | MEMFFIVLAVIVGAAVAFWLFVIEPGRKIYDYDPRDYDRDRR |
| Ga0224548_10205791 | 3300022518 | Soil | LERKVMETFLIVLAIAAMAGICVFLFVIEPRRKIYD |
| Ga0207693_111179092 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VMEVFLIGLALVAGAGIVFFLFVIEPRRKVYDYDPRDFGK |
| Ga0208342_1009001 | 3300026723 | Soil | MEMFLIVLAVIAGTGIVFFLFVIEPRRKIYDYDPRDFDPRDPR |
| Ga0207742_1136822 | 3300026800 | Tropical Forest Soil | MEFFLIALALIAGTGVVFFLFVMEPRRKIYDYDPH |
| Ga0207801_1083422 | 3300026810 | Tropical Forest Soil | LEAVMEIFLIALLVIAATGVAFFLFVIEPRRKIYDYDPLDPR |
| Ga0207765_1020292 | 3300026819 | Tropical Forest Soil | MEFFLMALGVIAGTGVVFFLFVMEPRRKIYDYDPHEQ |
| Ga0207765_1128131 | 3300026819 | Tropical Forest Soil | MEIFLIALLVIAATGVAFFLFVIEPRRKIYDYDPLDP |
| Ga0207802_10039094 | 3300026847 | Tropical Forest Soil | MEIFLIALLVIAATGVAFFLFVIEPRRKIYDYDPL |
| Ga0207821_10104872 | 3300026869 | Tropical Forest Soil | LEAVMEIFLIALLVIAATGVAFFLFVIEPRRKIYDYDPHDHR |
| Ga0207825_1075242 | 3300026871 | Tropical Forest Soil | MEAFLIVLAAIAGAGAAFFLFVIEPRRKIYDYDPHDHR |
| Ga0207787_10033292 | 3300026908 | Tropical Forest Soil | MEVFFIGLAVIAGVGVAVFLFVIEPRRKIYDYDPHDPR |
| Ga0207787_10282721 | 3300026908 | Tropical Forest Soil | MEFFLMALALIAGTGVVFFLFVMEPRRKIYDYDPHDAQ |
| Ga0207744_10180742 | 3300026927 | Tropical Forest Soil | MEFFLMALAVIAATGVVFFLFVMEPRRKIYDYDPHDAQ |
| Ga0207741_10175573 | 3300026941 | Tropical Forest Soil | MEFFLIALALIAGTGVIFFLFVMEPRRKIYDYDPLDPLA |
| Ga0207783_10027553 | 3300026942 | Tropical Forest Soil | MEFFLIALALIAGTGVVFFLFVMEPRRKIYDYDPLDPLA |
| Ga0207783_10150151 | 3300026942 | Tropical Forest Soil | WRKSLLEAVMEIFLIALLVIAATGVAFFLFVIEPRRKIYDYDPLDPR |
| Ga0207817_10029244 | 3300026979 | Tropical Forest Soil | MEFFLMALAVIAATGVVFFLFVMEPRRKIYDYDPLDPLA |
| Ga0207854_10017882 | 3300026982 | Tropical Forest Soil | MEFFLMALAVIAATGVVFFLFVMEPRRKIYDYDPLDPR |
| Ga0207839_10380501 | 3300027010 | Tropical Forest Soil | MEFFLIALAVIAGTGVIFFLFVMEPRRKIYDYDPHDAQ |
| Ga0207815_10125671 | 3300027014 | Tropical Forest Soil | TWGEYVMEFFLIALAVIAGTGVIFFLFVMEPRRKIYDYDPHDAQ |
| Ga0207857_10532501 | 3300027019 | Tropical Forest Soil | LEAVMEIFLIALLVIAATGVAFFLFVIEPRRKIYDYDPHDAQ |
| Ga0207766_10081672 | 3300027042 | Tropical Forest Soil | MEAFLIVLAAIAGAGAAFFLFVIEPRRKIYDYDPHDPR |
| Ga0207800_10483292 | 3300027043 | Tropical Forest Soil | MEVFFIMLAVIAGVGVAVFLFVIEPRRKIYDYDPHDPRQ |
| Ga0207806_10170971 | 3300027049 | Tropical Forest Soil | VMEFFLIALALIAGTGVVFFLFVMEPRRKIYDYDPHDAQ |
| Ga0207762_10210253 | 3300027063 | Tropical Forest Soil | MEFFLMALAVIAATGVVFFLFVMEPRRRIYDYDPLDPLA |
| Ga0208365_10051983 | 3300027070 | Forest Soil | MEVFLIGLALIAGVGVAFFLFVIEPRRKIYDYDPRDLR |
| Ga0207862_12435202 | 3300027703 | Tropical Forest Soil | MEVFFIALAVIAGAGAAIFLFVIEPRRKIYDYDPLDRR |
| Ga0209073_100507311 | 3300027765 | Agricultural Soil | MEMFLIVLAVIAGTGIVFFLFVIEPRRKIYDYDPRDFDPRDP |
| Ga0209069_100806643 | 3300027915 | Watersheds | MEVFFIGLAVIAGTGVAFFLFVIEPRRKIYDYDPRDYDPRDPR |
| Ga0209069_105268731 | 3300027915 | Watersheds | LEAVMEVFLIGLALIAGTGIAFFLFVIEPRRKIYDYDPRDYDSRDLR |
| Ga0170834_1098577401 | 3300031057 | Forest Soil | RVFFIVLAVIAGAGVAFFLFVIEPRRKIYDYDPRDYDPRGPR |
| Ga0170820_117825011 | 3300031446 | Forest Soil | MVSLEALGEHTVMEIFLIVLAVIAGTGVAFFLFVIEPRRKIYDYDPRDYDPRGPR |
| Ga0318541_101333694 | 3300031545 | Soil | MEIFLIALLVVAATGVAFFLFVIEPRRKIYDYDPLDAR |
| Ga0318541_101819212 | 3300031545 | Soil | LEAVMELFLIVLLAIAGTGIAFFLFVIEPRRKIYDYDPRGPR |
| Ga0318538_100550674 | 3300031546 | Soil | MEFFLIALAVIAATGVVFFLFVMEPRRKIYDYDPHGPQ |
| Ga0318538_102130052 | 3300031546 | Soil | MEVFFIVLAVIAGTGAVFFLFVIEPRRKIYDYDPSDPR |
| Ga0318538_106274701 | 3300031546 | Soil | MEVFFIVLAVIAGAGVVFFLFVMEPRRKIYDYDPPDHR |
| Ga0318573_106382951 | 3300031564 | Soil | MEIFFIVLAVIAGTGAAFFLFVIEPRRKIYDYDPLD |
| Ga0318573_106531772 | 3300031564 | Soil | MEVFFIVLALIAGAGVVFFLFVMEPRRKIYDYDPPDHR |
| Ga0310915_101543612 | 3300031573 | Soil | MEAFLIVLAAIAGTGVAFFLFVIEPRRKIYDYDPRDYDRRDTR |
| Ga0310915_101751364 | 3300031573 | Soil | MEAFLIVVAVIAAAGVVFFLFVVEPRRKIYDYDPLDPR |
| Ga0310915_101892785 | 3300031573 | Soil | MEVFFIVLAVIAGTGAVFFLFVIEPRRKIYDYDPL |
| Ga0310915_102622862 | 3300031573 | Soil | MEAFLIVVAMIVAAGAVFFLFVIEPRRKIYDYDPLDPR |
| Ga0310915_103502792 | 3300031573 | Soil | MEMFFIVLAVIVGTGVAFFLFVIEPRRKIYDYDPRGPR |
| Ga0310915_104954691 | 3300031573 | Soil | MEAFLIVLAVIAGTGVAFFLFVIEPRRKIYDYDPRDYDRRDTR |
| Ga0310915_107952222 | 3300031573 | Soil | MEAFLIVLAVIAETGVAFFLFVIEPRRKIYDYDPRDYD |
| Ga0310915_111837291 | 3300031573 | Soil | MEVFLIALAVIAGTGVVFLLFVIEPRRKIYDYDPVSGDRL |
| Ga0318542_101530132 | 3300031668 | Soil | MEAFLIVLAAIAGTGVAFFLFVIEPRRKIYDYDPRDYDRRDTG |
| Ga0318560_107508371 | 3300031682 | Soil | MEVFFLMLAVIAGVGVAVFLFVIEPRRKIYDYDPHDP |
| Ga0306917_111538141 | 3300031719 | Soil | MEAFLIVLAVIAGTGVAFFLFVIEPRRKIYDYDPR |
| Ga0318501_101818142 | 3300031736 | Soil | MEAFLIVLAVIAETGVAFFLFVIEPRRKIYDYDPRDYDRRDTR |
| Ga0318501_104821321 | 3300031736 | Soil | MEAFLIVLAVIAAAGVVLFLFVIEPRRKIYDYDPLDPR |
| Ga0306918_106494253 | 3300031744 | Soil | LEAVMELFLIVLLAIAGTGIAFFLFVIEPRRKIYDY |
| Ga0306918_108006902 | 3300031744 | Soil | STWEAHVMEVFLIALAVIAGTGVVFFLFVIEPRRKIYDYDPVSGDRL |
| Ga0306918_109210131 | 3300031744 | Soil | RLGGVYVMEAFLIVLAVIAGTGVAFFLFVIEPRRKIYDYDPRDYDRRDTR |
| Ga0318576_104614751 | 3300031796 | Soil | MEVFLIALAVIAGTGVVFFLFVIEPRRKIYDYDPRDHR |
| Ga0318550_101303862 | 3300031797 | Soil | MEVFFIVLAVIAGTGAVFFLFVIEPRRKIYDYDPRDPR |
| Ga0318565_105593362 | 3300031799 | Soil | MEFFLIALAVIAATGVVFFLFVMEPRMKIYDYDPHGPQ |
| Ga0310917_105587282 | 3300031833 | Soil | MEIFFIVLAVIAGTGAAFFLFVIEPRRKIYDYDPLDPR |
| Ga0310917_112016641 | 3300031833 | Soil | HVMEMFFIVLAVIVGTGVAFFLFVIEPRRKIYDYDPRGPR |
| Ga0318511_102820501 | 3300031845 | Soil | MEVFFIMLAVIAGVGIAVFLFVIEPRRKIYDYDPHDPR |
| Ga0306919_106553742 | 3300031879 | Soil | MEMFFIVLAVIAGAGVAFFLFVIEPRRKIYDYDPRDYDPGPR |
| Ga0306919_110549352 | 3300031879 | Soil | MEVFFIVLAVIAGAGVVFFLFVMEPRRKIYDYDPP |
| Ga0306919_112692331 | 3300031879 | Soil | MELFLIVLLAIAGTGIAFFLFVMEPRRKIYDYDPRDHR |
| Ga0306925_101134484 | 3300031890 | Soil | MEVFFIMLAVIAGVGIAVFLFVIEPRRKIYDYDPHDPRQ |
| Ga0306925_103308652 | 3300031890 | Soil | MEVFLIALAVIAGTGVVFFLFVIEPRRKIYDYDPVSGDRL |
| Ga0306925_103973773 | 3300031890 | Soil | MEAFLIVLAVIAGTGVAFFLFVIEPRRKIYDYDPRD |
| Ga0306925_104159352 | 3300031890 | Soil | MEAFLIVLAVIAGTGVAFFLFVIEPRRKIYDYDPRDYDRRDTG |
| Ga0306925_109675583 | 3300031890 | Soil | LEALRGAHVMEAFLIVLAVIAAAGVVLFLFVIEPRRKIYDYDPLDPR |
| Ga0318551_102932672 | 3300031896 | Soil | LGGAYVMEVFFIMLAVIAGVGVAVFLFVIEPRRKIYDYDPHDPRQ |
| Ga0306923_101231881 | 3300031910 | Soil | AVMELFLIVLLAIAGTGIAFFLFVIEPRRKIYDYDPRDLR |
| Ga0306923_109522111 | 3300031910 | Soil | MEVFLIVVAVIAAAGVVFFLFVVEPRRKIYDYDPLDPR |
| Ga0306923_115728042 | 3300031910 | Soil | LKHLGAHVMEVFLIALAVIAGTGVVFFLFVIEPRRKIYDYDPVSGDRL |
| Ga0306923_119838212 | 3300031910 | Soil | MEFFLMALAVIAATGVVFFLFVMELRRKIYDYDPHDAQ |
| Ga0306921_106438963 | 3300031912 | Soil | MEAFLIVLAAIAGTGVAFFLFVIEPRRKIYDYDPRDYDR |
| Ga0306921_122204671 | 3300031912 | Soil | LEALREAYGMEVFLIVLAAIAAAGVVFFLFVIEPRRKIYDYDPLDPR |
| Ga0306921_124612631 | 3300031912 | Soil | EFFLMALAVIAATGVVFFLFVMEPRRKIYDYDPLDPLA |
| Ga0310912_106143641 | 3300031941 | Soil | MEAFLIVLAVIAGTGVAFFLFVIEPRRKIYDYDPRDYDR |
| Ga0310916_104930211 | 3300031942 | Soil | NLEAVMELFLIVLLAIARTGIAFFLFVIEPRRKIYDYDPRDLR |
| Ga0310916_115435621 | 3300031942 | Soil | VLAVIARAGVAFFLFVIEPRRKIYDYDPRDYDPGPR |
| Ga0310913_101060232 | 3300031945 | Soil | MEAFLIVVAVIAAAGAVFFLFVIEPRRKIYDYDPLDPR |
| Ga0310910_110504231 | 3300031946 | Soil | MEMFFIVLAVIAGAGVAFFLFVIEPRRKIYDYDPRD |
| Ga0306922_121374421 | 3300032001 | Soil | AFLIVLAVIAAAGVVLFLFVIEPRRKIYDYDPLDPR |
| Ga0318569_105548281 | 3300032010 | Soil | LAVIAGTGVAFFLFVIEPRRKIYDYDPRDYDRRDTR |
| Ga0310911_105098122 | 3300032035 | Soil | MEAFLIVLAAIAGTGVAFFLFVIEPRRKIYDYDPRDYDRRDT |
| Ga0318545_100719751 | 3300032042 | Soil | MEAFLIVLAVIAETGVAFFLFVIEPRRKIYDYDPRDYDRRDTG |
| Ga0318533_109075681 | 3300032059 | Soil | AYAMEAFLIVLAVIAAAGVVVFLFVIEPRRKIYDYDPLDPR |
| Ga0318553_105565162 | 3300032068 | Soil | VYVMEAFLIVLAVIAGTGVAFFLFVIEPRRKMYDYDPRDYDRRDTR |
| Ga0306924_103387504 | 3300032076 | Soil | MEFFLLALAVIAGTGVVFFLFVMEPRRKIYDYDPRDHQ |
| Ga0318577_106035861 | 3300032091 | Soil | FLIVVAVIAAAGVVFFLFVVEPRRKIYDYDPLDPR |
| Ga0307471_1002813581 | 3300032180 | Hardwood Forest Soil | PLEAVMEVFLIGLALVAGAGIVFFLFVIEPRRKVYDYDPRDFGK |
| Ga0310914_113872321 | 3300033289 | Soil | VMEAFLIVLAVIAGTGVAFFLFVIEPRRKIYDYDPRDYDRRDTG |
| Ga0310914_117435781 | 3300033289 | Soil | MEFFLIALAVIAATGVVFFLFVMEPRRKIYDYDPHDPQ |
| Ga0318519_102547831 | 3300033290 | Soil | MEVFFLMLAVIAGVGVAVFLFVIEPRRKIYDYDPHDPRQ |
| Ga0318519_107026262 | 3300033290 | Soil | LEAVMELFLIVLLAIAGTGIAFFLFVIEPRRKIYDYDPRDLR |
| ⦗Top⦘ |