| Basic Information | |
|---|---|
| Family ID | F045784 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 152 |
| Average Sequence Length | 41 residues |
| Representative Sequence | PLPALDLSRHPEAQALDVRPHDLETYDELAHPRDDDSEQ |
| Number of Associated Samples | 146 |
| Number of Associated Scaffolds | 152 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.36 % |
| % of genes near scaffold ends (potentially truncated) | 94.74 % |
| % of genes from short scaffolds (< 2000 bps) | 94.08 % |
| Associated GOLD sequencing projects | 139 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.895 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog (7.237 % of family members) |
| Environment Ontology (ENVO) | Unclassified (16.447 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.711 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.42% β-sheet: 0.00% Coil/Unstructured: 83.58% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 152 Family Scaffolds |
|---|---|---|
| PF01695 | IstB_IS21 | 93.42 |
| PF00589 | Phage_integrase | 1.32 |
| PF13620 | CarboxypepD_reg | 0.66 |
| PF16793 | RepB_primase | 0.66 |
| PF05717 | TnpB_IS66 | 0.66 |
| PF00702 | Hydrolase | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
|---|---|---|---|
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 93.42 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.89 % |
| Unclassified | root | N/A | 17.11 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908009|FWIRA_GRAM18401DI008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300001159|JGI12650J13346_1004337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_103597094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300002568|C688J35102_120320720 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300004114|Ga0062593_102018800 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 641 | Open in IMG/M |
| 3300004152|Ga0062386_101098229 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 660 | Open in IMG/M |
| 3300004156|Ga0062589_101266068 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 710 | Open in IMG/M |
| 3300004633|Ga0066395_10515279 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 691 | Open in IMG/M |
| 3300004778|Ga0062383_10069437 | All Organisms → cellular organisms → Bacteria | 1439 | Open in IMG/M |
| 3300005327|Ga0070658_10600243 | Not Available | 954 | Open in IMG/M |
| 3300005337|Ga0070682_102022668 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 507 | Open in IMG/M |
| 3300005456|Ga0070678_101874861 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 566 | Open in IMG/M |
| 3300005530|Ga0070679_101345152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300005553|Ga0066695_10805168 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
| 3300005561|Ga0066699_10895407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300005602|Ga0070762_10169878 | Not Available | 1317 | Open in IMG/M |
| 3300005610|Ga0070763_10276629 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 917 | Open in IMG/M |
| 3300005610|Ga0070763_10444633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
| 3300005712|Ga0070764_10751926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300005719|Ga0068861_100292561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1407 | Open in IMG/M |
| 3300005952|Ga0080026_10160009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 655 | Open in IMG/M |
| 3300005993|Ga0080027_10427615 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300006057|Ga0075026_100721919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300006358|Ga0068871_100526586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1068 | Open in IMG/M |
| 3300007004|Ga0079218_12497237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300009012|Ga0066710_100795965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1449 | Open in IMG/M |
| 3300009082|Ga0105099_10669518 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300009700|Ga0116217_10271257 | Not Available | 1097 | Open in IMG/M |
| 3300009709|Ga0116227_11313310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300010046|Ga0126384_11249944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
| 3300010047|Ga0126382_11981888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300010379|Ga0136449_100955932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1386 | Open in IMG/M |
| 3300012187|Ga0136622_10294465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
| 3300012285|Ga0137370_10785150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300012929|Ga0137404_10912519 | Not Available | 801 | Open in IMG/M |
| 3300013306|Ga0163162_13160710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300013308|Ga0157375_12873089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300014159|Ga0181530_10319331 | Not Available | 809 | Open in IMG/M |
| 3300014164|Ga0181532_10249815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1020 | Open in IMG/M |
| 3300014167|Ga0181528_10512626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300015192|Ga0167646_1080273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
| 3300015245|Ga0137409_10540864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 991 | Open in IMG/M |
| 3300015261|Ga0182006_1199527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300015262|Ga0182007_10331715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300016357|Ga0182032_10721997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 838 | Open in IMG/M |
| 3300017822|Ga0187802_10098125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1101 | Open in IMG/M |
| 3300017929|Ga0187849_1111023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1149 | Open in IMG/M |
| 3300017946|Ga0187879_10243330 | Not Available | 1003 | Open in IMG/M |
| 3300018042|Ga0187871_10849357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300018043|Ga0187887_10323415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 911 | Open in IMG/M |
| 3300018060|Ga0187765_10993597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300018432|Ga0190275_12478093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300018468|Ga0066662_11412215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
| 3300021361|Ga0213872_10294434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
| 3300021403|Ga0210397_10071255 | All Organisms → cellular organisms → Bacteria | 2279 | Open in IMG/M |
| 3300021407|Ga0210383_10456561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1103 | Open in IMG/M |
| 3300021420|Ga0210394_10891808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
| 3300021433|Ga0210391_10731937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
| 3300021444|Ga0213878_10069066 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
| 3300022214|Ga0224505_10201194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 762 | Open in IMG/M |
| 3300022756|Ga0222622_10492945 | Not Available | 875 | Open in IMG/M |
| 3300023247|Ga0224529_1011707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 2212 | Open in IMG/M |
| 3300025161|Ga0209381_1150260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
| 3300025457|Ga0208850_1022326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1121 | Open in IMG/M |
| 3300025475|Ga0208478_1022658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1300 | Open in IMG/M |
| 3300025725|Ga0209638_1076179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1259 | Open in IMG/M |
| 3300025857|Ga0209014_10280700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300025914|Ga0207671_10580034 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300025918|Ga0207662_11085274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300025921|Ga0207652_10926890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 768 | Open in IMG/M |
| 3300025931|Ga0207644_11346352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300026271|Ga0209880_1081927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
| 3300026294|Ga0209839_10203939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
| 3300026326|Ga0209801_1094891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1295 | Open in IMG/M |
| 3300026333|Ga0209158_1090568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1179 | Open in IMG/M |
| 3300026482|Ga0257172_1034727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 914 | Open in IMG/M |
| 3300026502|Ga0255350_1044510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1079 | Open in IMG/M |
| 3300026835|Ga0207782_105756 | Not Available | 1092 | Open in IMG/M |
| 3300026869|Ga0207821_1015980 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300027575|Ga0209525_1099356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300027680|Ga0207826_1167918 | Not Available | 597 | Open in IMG/M |
| 3300027778|Ga0209464_10143923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 835 | Open in IMG/M |
| 3300027846|Ga0209180_10058685 | All Organisms → cellular organisms → Bacteria | 2136 | Open in IMG/M |
| 3300027855|Ga0209693_10213317 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 949 | Open in IMG/M |
| 3300027867|Ga0209167_10437808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 714 | Open in IMG/M |
| 3300027875|Ga0209283_10176860 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1417 | Open in IMG/M |
| 3300027879|Ga0209169_10518477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300028573|Ga0265334_10086748 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300028652|Ga0302166_10135576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300028779|Ga0302266_10238514 | Not Available | 680 | Open in IMG/M |
| 3300028808|Ga0302228_10266391 | Not Available | 771 | Open in IMG/M |
| 3300028854|Ga0302268_1098442 | Not Available | 725 | Open in IMG/M |
| 3300028860|Ga0302199_1063190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1252 | Open in IMG/M |
| 3300028906|Ga0308309_10586297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 967 | Open in IMG/M |
| 3300029636|Ga0222749_10117122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1268 | Open in IMG/M |
| 3300029903|Ga0247271_120857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
| 3300029911|Ga0311361_10523753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1168 | Open in IMG/M |
| 3300029911|Ga0311361_11102668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
| 3300029914|Ga0311359_10051432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4368 | Open in IMG/M |
| 3300029988|Ga0302190_10099740 | Not Available | 1305 | Open in IMG/M |
| 3300029989|Ga0311365_11496774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300030020|Ga0311344_10702526 | Not Available | 843 | Open in IMG/M |
| 3300030041|Ga0302274_10132535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1302 | Open in IMG/M |
| 3300030053|Ga0302177_10143662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1350 | Open in IMG/M |
| 3300030294|Ga0311349_11639975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300030399|Ga0311353_10388623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1258 | Open in IMG/M |
| 3300030580|Ga0311355_10676174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 963 | Open in IMG/M |
| 3300031229|Ga0299913_10935386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 835 | Open in IMG/M |
| 3300031231|Ga0170824_101087286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 756 | Open in IMG/M |
| 3300031236|Ga0302324_102865798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300031242|Ga0265329_10292539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300031258|Ga0302318_10390237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
| 3300031366|Ga0307506_10066244 | Not Available | 1100 | Open in IMG/M |
| 3300031446|Ga0170820_16895355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300031546|Ga0318538_10153221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1219 | Open in IMG/M |
| 3300031726|Ga0302321_101873536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
| 3300031744|Ga0306918_11344451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300031754|Ga0307475_10290716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1311 | Open in IMG/M |
| 3300031788|Ga0302319_10887420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 868 | Open in IMG/M |
| 3300031879|Ga0306919_11395475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300031910|Ga0306923_12250731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300031912|Ga0306921_10478933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1449 | Open in IMG/M |
| 3300031912|Ga0306921_11531859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300031912|Ga0306921_12128767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300031918|Ga0311367_10617556 | Not Available | 1106 | Open in IMG/M |
| 3300031941|Ga0310912_10911826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 676 | Open in IMG/M |
| 3300031946|Ga0310910_10313750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1235 | Open in IMG/M |
| 3300032076|Ga0306924_11430800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 736 | Open in IMG/M |
| 3300032076|Ga0306924_12120489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300032156|Ga0315295_11917743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
| 3300032160|Ga0311301_12451429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300032173|Ga0315268_11372219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
| 3300032783|Ga0335079_11780937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300032895|Ga0335074_10498556 | Not Available | 1265 | Open in IMG/M |
| 3300032955|Ga0335076_10790067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 831 | Open in IMG/M |
| 3300033004|Ga0335084_10460082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1308 | Open in IMG/M |
| 3300033158|Ga0335077_10276486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1848 | Open in IMG/M |
| 3300033158|Ga0335077_11065672 | Not Available | 801 | Open in IMG/M |
| 3300033402|Ga0326728_10785617 | Not Available | 696 | Open in IMG/M |
| 3300033418|Ga0316625_102296398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300033513|Ga0316628_103316800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300033561|Ga0371490_1142910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300033827|Ga0334848_031571 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300033887|Ga0334790_205866 | Not Available | 562 | Open in IMG/M |
| 3300033891|Ga0334811_149777 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300034065|Ga0334827_080502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1114 | Open in IMG/M |
| 3300034268|Ga0372943_0944554 | Not Available | 574 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 7.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.61% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.61% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 3.95% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.29% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.29% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.29% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.63% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.97% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.97% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.97% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.32% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.32% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.32% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.32% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.32% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.32% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.32% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.32% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.66% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.66% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.66% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.66% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.66% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.66% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.66% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.66% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.66% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.66% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.66% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.66% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.66% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.66% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.66% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.66% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.66% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.66% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.66% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908009 | Soil microbial communities from sample at FACE Site Metagenome WIR_Amb2 | Environmental | Open in IMG/M |
| 3300001159 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009709 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012187 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ448 (21.06) | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300015192 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2a, rock/snow interface) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300022214 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300023247 | Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T50 | Environmental | Open in IMG/M |
| 3300025161 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Dewar Creek DC9 2012 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025475 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025725 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 (SPAdes) | Environmental | Open in IMG/M |
| 3300025857 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026271 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026502 | Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T-25.r1 | Environmental | Open in IMG/M |
| 3300026835 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 60 (SPAdes) | Environmental | Open in IMG/M |
| 3300026869 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 53 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Host-Associated | Open in IMG/M |
| 3300028652 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_3 | Environmental | Open in IMG/M |
| 3300028779 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028854 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_1 | Environmental | Open in IMG/M |
| 3300028860 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029903 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703 | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029988 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Host-Associated | Open in IMG/M |
| 3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033561 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fraction | Environmental | Open in IMG/M |
| 3300033827 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 5-9 | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| 3300033891 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-D | Environmental | Open in IMG/M |
| 3300034065 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FWIRA_00584360 | 2124908009 | Soil | PALDLSRHPEAQALDVRPHNLETYDELAHPRDDDPEQ |
| JGI12650J13346_10043372 | 3300001159 | Forest Soil | VDLSRHPQAQSLDVRPHDLETYDELARNKNNNADDRNDEQ* |
| JGIcombinedJ13530_1035970941 | 3300001213 | Wetland | LSGHPLAQSIDVRPHDLETYDELARTQDNTLDPDQ* |
| C688J35102_1203207201 | 3300002568 | Soil | PLPALDLSRHPEAQALDVRPHDLETYDELAHPRDDDSEQ* |
| Ga0062593_1020188002 | 3300004114 | Soil | PLPALDLSRHPEAQALDVRPHNLETYDELAHSRDDDPEQ* |
| Ga0062386_1010982291 | 3300004152 | Bog Forest Soil | PAPLPALDLSRHPEAQALDVRPHDLETYDELAHPHDDDSEQ* |
| Ga0062589_1012660683 | 3300004156 | Soil | QPCPRRVALDLSHHPQAQSVDVRPHDLETYDELARTEDDDPEP* |
| Ga0066395_105152792 | 3300004633 | Tropical Forest Soil | SVAFLLRRNQRSSPLPALDLSRHPEAQALEVRPHDLETYDELAHSHDDDSEQ* |
| Ga0062383_100694373 | 3300004778 | Wetland Sediment | PLPALDLSRHPEAQALDVRPHDLETYDELAHSRDDDPEQ* |
| Ga0070658_106002431 | 3300005327 | Corn Rhizosphere | VCCFVAARPQQRITPRLAVDLSRHPEAQSIEVRPHDLETYDELAHN |
| Ga0070682_1020226681 | 3300005337 | Corn Rhizosphere | PLPAVDLSRHPEAQALDVRPHDLETYDELARTHDDDAES* |
| Ga0070678_1018748612 | 3300005456 | Miscanthus Rhizosphere | SVAFLLRRRHRSAPLPALDLSRYPEARAMDVRPHNLETYDELAHPRDDDPEQ* |
| Ga0070679_1013451521 | 3300005530 | Corn Rhizosphere | LLRRQPHSRRLAVDLSGHPEAQSIDVRPHSLETYDELAHPEDDDPEQ* |
| Ga0066695_108051682 | 3300005553 | Soil | RVALDLSHNPQAQSVDVRPHDLETYDELARTEDDDPKP* |
| Ga0066699_108954071 | 3300005561 | Soil | PLPALDLSRHPEAQALDVRPHDLETYDELAHPRDDDDSEQ* |
| Ga0070762_101698781 | 3300005602 | Soil | NHAMPLPLDLSRHPEALSLEVRPHDLETYDELAHRRDDEPER* |
| Ga0070763_102766292 | 3300005610 | Soil | SAPAPMVVDLSRHPEAQAIEVRPHDLETYDELAEHGLDDSEQ* |
| Ga0070763_104446331 | 3300005610 | Soil | APIAVDLSRHPAAQAIEVRPHDLEIYDELSRNGNDSEQ* |
| Ga0070764_107519262 | 3300005712 | Soil | VDLDLSRYPEAQSIDVRPHDLETYDELAHTPDDDDSEP* |
| Ga0068861_1002925614 | 3300005719 | Switchgrass Rhizosphere | RVALDLSHNPQAQSVDVRPHDLETYDELARTEDDDPNPEQ* |
| Ga0080026_101600092 | 3300005952 | Permafrost Soil | LSLDLSRHPQAMALDIRPHDLETYDELTRTKDDDNDEQ* |
| Ga0080027_104276151 | 3300005993 | Prmafrost Soil | SAPAPMAVDLSRHPGAQAIEVRPHDLETYDELARNEDDDDDAEQ* |
| Ga0075026_1007219191 | 3300006057 | Watersheds | DLSHHPDAQSIDIRPHDLETYDELAHSQDDDPDPEQ* |
| Ga0068871_1005265861 | 3300006358 | Miscanthus Rhizosphere | PRAPRVVLDLSGHPEAQSIDVRPHALETYDELARTQDDDAEQ* |
| Ga0079218_124972371 | 3300007004 | Agricultural Soil | SSPLPALDLSHHPEAQALDVRPHDLETYDELAHPRDDDSEQ* |
| Ga0066710_1007959651 | 3300009012 | Grasslands Soil | RSSPLPALDLSRHPEAQALDVRPHDLETYDELAHPRDDDDSEQ |
| Ga0105099_106695182 | 3300009082 | Freshwater Sediment | SPLPALDLSRHPEAQALDVRPHDLETYDELAHSRDDDPEQ* |
| Ga0116217_102712571 | 3300009700 | Peatlands Soil | RQNRSTPLPALDLSRHPEAQALDVRPHDLETYDELAHPRDDDPEQ* |
| Ga0116227_113133102 | 3300009709 | Host-Associated | APMAVDLSRHPEAQAIEVWPHHLETYDELARNNDNDDDSEQ* |
| Ga0126374_116925712 | 3300009792 | Tropical Forest Soil | ASSVAFLLRRHHRSTPPALDLSRYPEAQALDVRPHDLETYDELAHPRDDNPDQ* |
| Ga0126384_112499442 | 3300010046 | Tropical Forest Soil | RALVDLSHHPQAQSVDVRPHDLETYDELARPQNDKPKQQ* |
| Ga0126382_119818882 | 3300010047 | Tropical Forest Soil | TSPLPALDLSRHPEAQALDVRPHNLETYDELAHPRDDDPEQ* |
| Ga0136449_1009559324 | 3300010379 | Peatlands Soil | SLDLSHHPQAQSLDIRPHDLETYDELARTQDTDNDDEQ* |
| Ga0136622_102944651 | 3300012187 | Polar Desert Sand | SLDLSHHPQAQSLDIRPHDLETYDELSRTDDNGNDEP* |
| Ga0137370_107851501 | 3300012285 | Vadose Zone Soil | LLRRNYRASPLPALDLSRHPEAQALGVRPHNLETYDELAHPRDDDPDQ* |
| Ga0137404_109125191 | 3300012929 | Vadose Zone Soil | RSFLSPSPAVAFLLRRNHRSSPLPALDLSRHPEAQALDVRPHDLETYDERAHARDDDPEQ |
| Ga0163162_131607102 | 3300013306 | Switchgrass Rhizosphere | AFLLRRQHRSTPLPVLDLSRHPEAQALDVRPHNLETYDELAHPRDPDSE* |
| Ga0157375_128730892 | 3300013308 | Miscanthus Rhizosphere | LSLDLSRHPEAQSVEVRPHDLEIYDELAHKKDDEQQ* |
| Ga0181530_103193311 | 3300014159 | Bog | HPRPAPLPALDLSRHPEAQALDVRPHDLETYDELAHPHDDDSE* |
| Ga0181532_102498151 | 3300014164 | Bog | MVVDLSRHPEAQAIEVRPHDLETYDELARNDNDDNDSGQ* |
| Ga0181528_105126261 | 3300014167 | Bog | VAFLLRRQHRSTPLPALDLSRHPEAQALDVRPHDLETYDELAHPHDDSEQ* |
| Ga0167646_10802732 | 3300015192 | Glacier Forefield Soil | TLPALDLSHHPEAQSLDVRTHDLETYDALARTQNNDDDE* |
| Ga0137409_105408643 | 3300015245 | Vadose Zone Soil | LSHHPQAQSLDIRPHDLEAYDELARNKDTGNDDE* |
| Ga0182006_11995272 | 3300015261 | Rhizosphere | LRRHHRSTPLPALDLSRHPEAQALDVRPHDLETYDELAHPHNDDSEQ* |
| Ga0182007_103317151 | 3300015262 | Rhizosphere | PTPLPALDLSRHPEAQALDVRPHDLETYDELAHPHNDDSEQ* |
| Ga0182032_107219972 | 3300016357 | Soil | FLLRRHHRASPLPALDLSRHPEAQALDVRPHNLETYDELAHARDDDSEQ |
| Ga0187802_100981253 | 3300017822 | Freshwater Sediment | LRRSQRSSPLPALDLSRHPEAQALDVRPHDLETYDELAHSRDDDSDQ |
| Ga0187849_11110233 | 3300017929 | Peatland | SPALAVDLSRHPEAQSIEVRPHDLETYDELARHHDDDPDQ |
| Ga0187853_105184122 | 3300017940 | Peatland | SSVAFLLRRNHRCSPLPALDLSRHPEAQALDVRPHDLETYDELAHSHDDDPEQ |
| Ga0187879_102433301 | 3300017946 | Peatland | PLPLDLSRHPGAQNLEVRPHDLETYDELAHRRDDEPKR |
| Ga0187871_108493572 | 3300018042 | Peatland | RSTPLPALDLSRHPEAQALDVRPHDLETYDELAHPRDDDDSEQ |
| Ga0187887_103234151 | 3300018043 | Peatland | KQQRSAPSPMAVDLSRHPAAQAIEVRPHDLETYDELAEHGLDDSEQ |
| Ga0187765_109935971 | 3300018060 | Tropical Peatland | VAFLLRRGAPGAPRSAPLPALDLSRHPEAQALDVRPHDLETYDELAHPHDDDSE |
| Ga0190275_124780932 | 3300018432 | Soil | LDLSRHPEAQALDVRPHDLETYDELAHPRDDDSEQ |
| Ga0066662_114122152 | 3300018468 | Grasslands Soil | LDLSRHPEAQALEVRPHDLETYDELAHPHDDDSEQ |
| Ga0213872_102944341 | 3300021361 | Rhizosphere | RRQPRVARLALDLSRHPEAQAVEVRPHDLEIYDELARTQDNDSEQ |
| Ga0210397_100712554 | 3300021403 | Soil | HRSTPLPALDLSRHPEAQALDVRPHDLETYDELAHPRDDDSEQ |
| Ga0210383_104565611 | 3300021407 | Soil | PSALEVDLSRHPEAQSIEVRPHDLETYDELAQTRDDSDESGE |
| Ga0210394_108918082 | 3300021420 | Soil | APMVVDLSRHPEAQAIEVRPHDLETYDELAEHGLDDSEQ |
| Ga0210391_107319372 | 3300021433 | Soil | APKVDLSRHPEAQAIDVQPHALETYDELAHHHDDDPDE |
| Ga0213878_100690663 | 3300021444 | Bulk Soil | QPRTQRLAVDLSGHPEAQSIEVRPHDLETYDELARTPHDDSQQ |
| Ga0224505_102011941 | 3300022214 | Sediment | QVRRAPHLAVDLSRHPEAEALDIQPHDLETYDELARSPDDDDESGQ |
| Ga0222622_104929452 | 3300022756 | Groundwater Sediment | LRRHHRSAPLPALDLSRHPEAQALDVRPHDLETYDELAHPRDDDSEQ |
| Ga0224529_10117071 | 3300023247 | Soil | APLPLDLSRYPLAQDVHVRSHDLETYDELARNRDKKSKS |
| Ga0209381_11502602 | 3300025161 | Hot Spring Sediment | PLPALDLSRYPEAQALEVRPHNLETYDELAHPHDDGSEP |
| Ga0208850_10223263 | 3300025457 | Arctic Peat Soil | RPTLLALDLSGHPLAQSIDVRPHDLETYDELARTPDNTDDPEQ |
| Ga0208478_10226584 | 3300025475 | Arctic Peat Soil | KVNLSRFPEAQSIDVQPHDLETYDELARHDHDPDE |
| Ga0209638_10761791 | 3300025725 | Arctic Peat Soil | SLDLSHHPQAQALDIRPHDLETYDELARTQDNGNDEQ |
| Ga0209014_102807002 | 3300025857 | Arctic Peat Soil | PLMVDLSHHPEAQAIEVQPHDLETYDELAHSDDDPQQ |
| Ga0207671_105800343 | 3300025914 | Corn Rhizosphere | RHHRSMPLPALDLSRYPEAQALDVRPHDLETYDELAHPRDDDPEQ |
| Ga0207662_110852742 | 3300025918 | Switchgrass Rhizosphere | ALDLSRHPEAQALDVRPHDLETYDELTHPRDDDSE |
| Ga0207652_109268902 | 3300025921 | Corn Rhizosphere | LLRRQPHSRRLAVDLSGHPEAQSIDVRPHSLETYDELAHPEDDDPEQ |
| Ga0207644_113463521 | 3300025931 | Switchgrass Rhizosphere | VLRASSVAFLLRRNHRASLLPALDLSRHLEAQALDVCFHNLETYDELAYPRDDDSEQ |
| Ga0209880_10819271 | 3300026271 | Soil | DLSHHPEAQSLDVRTHDLETYDALARTQNNDDDSQQ |
| Ga0209839_102039392 | 3300026294 | Soil | LRRHHRSTPLPALDLSRHPEAQALNVRPHDLETYDELAHPRNDDPEQ |
| Ga0209801_10948911 | 3300026326 | Soil | LLRRHHRSIPLPALDLSRHPEAQALDVRPHDLETYDELAHPRDDDDSEQ |
| Ga0209158_10905681 | 3300026333 | Soil | HHRSIPLPALDLSRHPEAQALDVRPHDLETYDELAHPRDDDDSEQ |
| Ga0257172_10347271 | 3300026482 | Soil | KVDLSRHPEAQAIDVQPHDLETYDELAHHHDDDPDE |
| Ga0255350_10445101 | 3300026502 | Soil | TPLPLDLRRHPQAESVEVRPHDLETYDELAQRRNEEPES |
| Ga0207782_1057563 | 3300026835 | Tropical Forest Soil | PTLDLSRHPEAQAMDVRPHNLETYDELAHTHDDEPEQ |
| Ga0207821_10159802 | 3300026869 | Tropical Forest Soil | HRSAPLPTLDLSRHPEAQAMDVRPHNLETYDELAHTHDDEPEQ |
| Ga0209525_10993561 | 3300027575 | Forest Soil | RATPLSLDLSHHPQAQALDIQPHDLETYDKLTRTKDDDNDEP |
| Ga0207826_11679182 | 3300027680 | Tropical Forest Soil | TAPLPLDLRRHPQAECVEVRPHDLETYDELAQRHDEEPES |
| Ga0209464_101439231 | 3300027778 | Wetland Sediment | RSQLVAVDLSHHPIAQSVDVRPHNLETYDELANHHKKEPGE |
| Ga0209180_100586851 | 3300027846 | Vadose Zone Soil | LDLSRHPEAQALDVRPHDLETYDELAHPHDDDSEH |
| Ga0209693_102133172 | 3300027855 | Soil | RSAPAPMVVDLSRHPEAQAIEVRPHDLETYDELAEHGLDDSEQ |
| Ga0209167_104378082 | 3300027867 | Surface Soil | DLSHHPQAQSLDIRPHDLETYDELARTQDTDNDDEQ |
| Ga0209283_101768601 | 3300027875 | Vadose Zone Soil | RRRHRSTPLPALDLSRHPEAQALDVRPHDLETYDELAHPHDDDSEQ |
| Ga0209169_105184771 | 3300027879 | Soil | QPRPPRVDLDLSRYPEAQSIDVRPHDLETYDELAHTPDDDDSEP |
| Ga0265334_100867482 | 3300028573 | Rhizosphere | MAVDLSRHPEAQAIEVRPHDLETCDELARNNNDNEQ |
| Ga0302166_101355761 | 3300028652 | Fen | QHRSTPLPALDLSRHPEAQALDVRPHDLETYDELAHPRDDDSEQ |
| Ga0302266_102385142 | 3300028779 | Bog | FLLRQRHRSAPLPLDLSRYPLAQDVHVRSHDLETYDELARNRDKKSKS |
| Ga0302228_102663912 | 3300028808 | Palsa | LDLSRHPEAQSLEVRPHDLETYDELAHRRDDEPER |
| Ga0302268_10984422 | 3300028854 | Bog | LDLSRHPEAQNLEVRPHDLETYDELAHRRDDEPER |
| Ga0302199_10631903 | 3300028860 | Bog | APLPLDLRRHPQAESVEVRPHDLETYDELAQRHDEDPEPES |
| Ga0308309_105862973 | 3300028906 | Soil | RRQNRSTPLPALDLSRHPEAQALDVRPHDLETYDELAHPHDDDSEQ |
| Ga0222749_101171221 | 3300029636 | Soil | RQHRSTPLPALDLSRHPEAQALDVRPHDLETYDELAHPRDDHSEQ |
| Ga0247271_1208572 | 3300029903 | Soil | LSRHPEAQAIEVRPHNLETYDELARKDGDDDNSEQ |
| Ga0311361_105237534 | 3300029911 | Bog | PAPMAVDLSHHPEAQAIEVRPHDLETYDELAHNDADDDDSEQ |
| Ga0311361_111026681 | 3300029911 | Bog | LDLSHHPEAQSINVRPHDLEIYDELTRTQDDDPES |
| Ga0311359_100514327 | 3300029914 | Bog | LPLDLRRHPQAESVEVRPHDLETYDELAQRRDEEPES |
| Ga0302190_100997404 | 3300029988 | Bog | DLSRHPEAQNLDVRPHDLETYDELAHRRDDDEPER |
| Ga0311365_114967741 | 3300029989 | Fen | RRQQRSAPARVAVDLSRHPEAQSIDVRPHDLETYDALARSRDDDEPDE |
| Ga0311344_107025261 | 3300030020 | Bog | LDLSRHPQAQNLNVRAHDLETYDELAHNHDKKSKS |
| Ga0302274_101325353 | 3300030041 | Bog | DLRRHPQAENVEVRPHDLETYDELAQRHDEDPEPES |
| Ga0302177_101436623 | 3300030053 | Palsa | PLPLDLSRHPEAQSLEVRPHDLETYDELAHRRDDEPER |
| Ga0302182_103876961 | 3300030054 | Palsa | AFLLRQSDSVTPLPLDLSRHPEAQSLEVRPHDLETYDELAHRRDDEPER |
| Ga0302179_104483051 | 3300030058 | Palsa | FLLRQSDSVTPLPLDLSRHPEAQSLEVRPHDLETYDELAHRRDDEPER |
| Ga0311349_116399751 | 3300030294 | Fen | PAPLMVDLSHHPEAQAIEVQPHDLETYDELAHSDDDPQQ |
| Ga0311353_103886233 | 3300030399 | Palsa | LDLSRYPQAQNLNVRPHDLETYDELAHSRDKQSKS |
| Ga0311355_106761741 | 3300030580 | Palsa | DLSHHPEAQSVEVRPHDLEIYDELARTQDDDDSEQ |
| Ga0299913_109353861 | 3300031229 | Soil | PLPALDLSRHPEAQALNVRPHDLETYDELAHPHDDDSEQ |
| Ga0170824_1010872861 | 3300031231 | Forest Soil | FLLRRHHRSAPPALDLSRYPEAQALDVRPHDLETYDELAHPRDDDSEQ |
| Ga0302324_1028657981 | 3300031236 | Palsa | LDLSHHPQAQALDIRPHDLETYDELARTKDDDNDEQ |
| Ga0265329_102925392 | 3300031242 | Rhizosphere | LAVDLSRHPEAQSVDVRPHKLESYDELARNPDDDPEQ |
| Ga0302318_103902372 | 3300031258 | Bog | RQARPSTLLAVDLSRHPQAQAIDVRTHDLETYDELAHPHHDDPKH |
| Ga0307506_100662443 | 3300031366 | Soil | HRSTPLPTLDLSRHPEAQALDVRPHDLETYDELAHPRDDDSEQ |
| Ga0170820_168953551 | 3300031446 | Forest Soil | VAFLLRRHHRSVPLPALDLSRHPEAQALDVRPHDLETYDELTHPRDDDSE |
| Ga0318538_101532213 | 3300031546 | Soil | FLLRRHHRSAPPPALDLSRHPEAQALDVRPHDLETYDELAHSRDDDPEQ |
| Ga0302321_1018735361 | 3300031726 | Fen | PPAVDLSRHPDAQAVEVRPHDLEVYDELARTKDDSAE |
| Ga0306918_113444511 | 3300031744 | Soil | SAPLPALDLSRHPEAQALDVRPHDLETYDELAHSRDDDPEQ |
| Ga0307475_102907163 | 3300031754 | Hardwood Forest Soil | RQLRSTSPRLAVDLSRHPEAQSIDVRPHDLETYDELARNRDDDPDQ |
| Ga0302319_108874202 | 3300031788 | Bog | AVDLSRHPRAQAVDVRPHDLETYDELARTGKITDDPDR |
| Ga0306919_113954752 | 3300031879 | Soil | PLPALDLSRHPEAQALDVRPHDLETYDELANSRDDDSEQ |
| Ga0306923_122507311 | 3300031910 | Soil | VDLSRHPQAQAIDVRPHNLETYDELARPHDDDPEE |
| Ga0306921_104789333 | 3300031912 | Soil | PLPALDLSRHPEAQALDVRPHDLETYDELAHPRDDDSE |
| Ga0306921_115318591 | 3300031912 | Soil | RRHHRSVPRPALDLSRHPEAQALEVRPHDLETYDELAHPHDDDSEQ |
| Ga0306921_121287672 | 3300031912 | Soil | LLRRNQRSASLPALDLSRHPEAQALDVRPHNLETYDELAHPRDHDPEQ |
| Ga0311367_106175563 | 3300031918 | Fen | HRSTPLPALDLSRHPEAQALNVRPHDLETYDELAHSRNDDPEQ |
| Ga0310912_109118263 | 3300031941 | Soil | SPPRLAVDLSHNPVAQSVDVRPHDLETYDELAHNRKRSRD |
| Ga0310910_103137501 | 3300031946 | Soil | LPALDLSRHPEAQALDVRPHDLETYDELAHSRDDDPEQ |
| Ga0306924_114308002 | 3300032076 | Soil | PALDLSRHPEAQALEVRPHDLETYDELAHPHDDDSEQ |
| Ga0306924_121204892 | 3300032076 | Soil | PALDLSRHPEAQALDVRPHNLETYDELAHPRDDDPDQ |
| Ga0315295_119177432 | 3300032156 | Sediment | VRLPAVDLSRHPEAQALDVRPHDLETYDELANPHDDDAEP |
| Ga0311301_124514291 | 3300032160 | Peatlands Soil | SLDLSHHPQAQSLDIRPHDLETYDELARTQDTDNDDEQ |
| Ga0315268_113722193 | 3300032173 | Sediment | PRAPRIALDLSRHPEAQSIDVRPHDLETYDDLARTQDDDPEQ |
| Ga0335085_112005341 | 3300032770 | Soil | SVAFLLRRNHRASPLPALDLSRHPEAQALDVRPHDLETYDELAHPRDDDPEQ |
| Ga0335079_117809371 | 3300032783 | Soil | LPAVDLSRHPEAQALDVRPHDLETYDELARSHDDDAES |
| Ga0335074_104985563 | 3300032895 | Soil | ALDLSRHPEAQALNVRPHNLETYDELAHPRDDDPDH |
| Ga0335076_107900672 | 3300032955 | Soil | RRNHRSSPLPVLDLSRHPEAQALDVRPHDLETYDELAHSHDDDPEQ |
| Ga0335084_104600821 | 3300033004 | Soil | RREQRSSPLPVLDLSHHPEAQALDVRPHDLETYDELAHPLDDSQQ |
| Ga0335077_102764864 | 3300033158 | Soil | PRLAVDLSRHPEAQSVEVRPRDLETYDELARHRDDDSDN |
| Ga0335077_110656721 | 3300033158 | Soil | LLRRHQRSAPLPALDLSRHPEAQAMDVRPHDLETYDELAHSRDDDTGQ |
| Ga0326728_107856172 | 3300033402 | Peat Soil | LLLDLRRHPQAESVEVRPHDLETYDELAQRGDEELES |
| Ga0316625_1022963982 | 3300033418 | Soil | SVAFLLRQAPRSTPLPALDLSRHPEARALDVRPHDLETYDELARHRDDDSEQ |
| Ga0316628_1033168001 | 3300033513 | Soil | RLALDLSHHPEAQAVEVRPHDLEIYDELARTQDDDDSPK |
| Ga0371490_11429101 | 3300033561 | Peat Soil | DLSRHPEAQSIEVRPHDLETYDELAHNHDDDQSDE |
| Ga0334848_031571_746_859 | 3300033827 | Soil | MPLDLRRHPQAESVEVRPHDLETYDELAQRRDDEPES |
| Ga0334790_205866_3_134 | 3300033887 | Soil | SNSVTPLPLDLSRHPEAQSLEVRPHDLETYDELAHRRDDEPER |
| Ga0334811_149777_217_336 | 3300033891 | Soil | MPLDLRRHPQAESVEVRPHDLETYDELAQRHDEDPEPES |
| Ga0334827_080502_1006_1113 | 3300034065 | Soil | LDLRRHPQAESVEVRPHDLETYDELAQRRDDEPES |
| Ga0372943_0944554_463_573 | 3300034268 | Soil | ALDLSRHPEAQALDVRPHDLATYDGLAHRSDDDAEQ |
| ⦗Top⦘ |