 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F045783 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 152 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MTTVQALWFRADEHPDGGEPDHQAFTQFDVLNVARRLLG |
| Number of Associated Samples | 135 |
| Number of Associated Scaffolds | 152 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 3.29 % |
| % of genes near scaffold ends (potentially truncated) | 95.39 % |
| % of genes from short scaffolds (< 2000 bps) | 89.47 % |
| Associated GOLD sequencing projects | 129 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (73.684 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (23.026 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.605 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.316 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.91% β-sheet: 0.00% Coil/Unstructured: 82.09% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 152 Family Scaffolds |
|---|---|---|
| PF01261 | AP_endonuc_2 | 17.76 |
| PF00749 | tRNA-synt_1c | 2.63 |
| PF01699 | Na_Ca_ex | 1.32 |
| PF06224 | HTH_42 | 1.32 |
| PF16901 | DAO_C | 1.32 |
| PF00072 | Response_reg | 0.66 |
| PF13419 | HAD_2 | 0.66 |
| PF01544 | CorA | 0.66 |
| PF04389 | Peptidase_M28 | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
|---|---|---|---|
| COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 2.63 |
| COG0387 | Cation (Ca2+/Na+/K+)/H+ antiporter ChaA | Inorganic ion transport and metabolism [P] | 1.32 |
| COG0530 | Ca2+/Na+ antiporter | Inorganic ion transport and metabolism [P] | 1.32 |
| COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 1.32 |
| COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 73.68 % |
| All Organisms | root | All Organisms | 26.32 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 23.03% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.61% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.95% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.29% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.29% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.29% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.29% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.63% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.63% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.97% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.97% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.97% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.32% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.32% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.32% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.32% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.32% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.32% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 1.32% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.32% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.66% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.66% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.66% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.66% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.66% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.66% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.66% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.66% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.66% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000754 | Amended soil microbial communities from Kansas Great Prairies, USA - acetate Total DNA F2.4TB | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005159 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPB | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009808 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012001 | Permafrost microbial communities from Nunavut, Canada - A24_80cm_12M | Environmental | Open in IMG/M |
| 3300012004 | Permafrost microbial communities from Nunavut, Canada - A30_5cm_6M | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012514 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510 | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014267 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300020012 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1 | Environmental | Open in IMG/M |
| 3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300025174 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3 | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026763 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A4-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027006 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027954 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300034417 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17 | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11851J11668_10054482 | 3300000754 | Soil | KTVQPLWFRADDGASPVEPDYQAFTQMDVLNLVDRLRS* |
| C688J14111_100246843 | 3300001305 | Soil | MTTVQALWYRVDDHSDGAEPDHQAFTQLDVLNVARRLLAA* |
| C688J18823_105894661 | 3300001686 | Soil | QAFWFRADDDERGIDADFEAFTQMDVLNAVRRLNGEL* |
| C688J35102_1180279711 | 3300002568 | Soil | LGMTTVQAVWFRADENPDGAEPDHQAFTQMDVLNIADRLLAEG* |
| JGI25407J50210_101023121 | 3300003373 | Tabebuia Heterophylla Rhizosphere | KAVGMTTVQAYWFRADDDERGLEPDFEAFTPMDVLNVVRRLVGET* |
| Ga0063455_1004467733 | 3300004153 | Soil | GMTTVQALWFRADEHPDGGVPDFEAFTEMDVLNFVDRLAAAA* |
| Ga0063356_1049564582 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VRGSNEAGMTSVQALWFRADENDEGGEPDHQAFTQMDVLNLADRLLA* |
| Ga0066808_10407211 | 3300005159 | Soil | SEAGMATVQALWFRADENPDGAEPDHQAFTQMDVLNIVDRLLAAA* |
| Ga0066683_107943431 | 3300005172 | Soil | GMTTVQALWFRADEHPEGGEPDFQAFTPMDILNIVRRLRGEQP* |
| Ga0068869_1013777251 | 3300005334 | Miscanthus Rhizosphere | MTTVQALWFRADENPDGAEPDHQAFTQMDVLNIADRLLAAA* |
| Ga0070689_1003142981 | 3300005340 | Switchgrass Rhizosphere | MTTVQAFWFRADDDERGLDPDFEAFTTMDVLNVVRRLSGEL* |
| Ga0070661_1014067901 | 3300005344 | Corn Rhizosphere | RGAAELGMTTVQALWYRADDHPDGAEPDHQAFTQLDVLNVARRLARD* |
| Ga0070668_1000053991 | 3300005347 | Switchgrass Rhizosphere | GELGMRTVQALWFRVDEHADGREPDHQAFTQVDVLNVARRLA* |
| Ga0070705_1004415001 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | AGMTTVQAFWFRADDDERGLDPDFEAFTTMDVLNVVRRLSGEL* |
| Ga0070685_102548801 | 3300005466 | Switchgrass Rhizosphere | GAAELGMTTVQALWYRADDHPDGAEPDYQAFTQLDVLNIARRLAA* |
| Ga0070706_1020791641 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LGMATVQALWFRADENPDGREPDYQAFTQHDVLNVALRLLAA* |
| Ga0070699_1019456611 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VQALWFRADEHPDGGEPDFQAFTQFDVLNIARRLAALPG* |
| Ga0073909_106173952 | 3300005526 | Surface Soil | TVQALWFRADEHPDGGEPDFQAFTQFDVLNIVDRLRA* |
| Ga0066695_107502212 | 3300005553 | Soil | TTVQALWFRADEHPDGGVPDFQAFTMHDVLNIARRLAAES* |
| Ga0066700_105476512 | 3300005559 | Soil | GMTTVQALWFRADEHPDGAEPDHQAFTQLDVLNIARRLAA* |
| Ga0066699_100952314 | 3300005561 | Soil | QALWFRADDTPGAPEPDYRAFTQMDVLNVAARLLAAA* |
| Ga0066705_109336522 | 3300005569 | Soil | WFRADEHPEGGEPDFQAFTQMDVLNVVGRLDTASV* |
| Ga0068856_1010077883 | 3300005614 | Corn Rhizosphere | GMTTVQAVWFRADENPDGAEPDYQAFTQMDVLNVADRLLGSA* |
| Ga0066905_1019316641 | 3300005713 | Tropical Forest Soil | GMTSVQALWFRADENDEGGEPDHQAFTQMDVLNLADRLLA* |
| Ga0068860_1009126461 | 3300005843 | Switchgrass Rhizosphere | TVQAFWFRADDDERGLDPDFEAFTTMDVLNVVRRLSGEL* |
| Ga0081455_100814434 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VQALWFRADEHPDGGEPDHEAFTQMDVLNIVERLRPAA* |
| Ga0068871_1007576743 | 3300006358 | Miscanthus Rhizosphere | SRLGIRTVQALWFRADEHPDGGVPDYQAFTQMDVLNVARRLAR* |
| Ga0074053_118621102 | 3300006575 | Soil | LWFRADENPDGAEPDHQAFTQMDVLNIADRLLGSG* |
| Ga0074053_119402982 | 3300006575 | Soil | TVQAVWFRADEHPEGREPDHQAFTMMDVLNVADRLVRA* |
| Ga0074049_128342181 | 3300006580 | Soil | QALWFRADENPDGAEPDHQAFTQMDVLNIADRLLAAA* |
| Ga0074049_129751981 | 3300006580 | Soil | VQALWFRADEHPDGREPDHRAFTMMDVLNVAERLVSG* |
| Ga0074048_127274872 | 3300006581 | Soil | WFRADENPHGAEPDHQAFTQMDVLNIADRLLGST* |
| Ga0079222_109373752 | 3300006755 | Agricultural Soil | RGSAELGMTTVQALWYRADEHPDGAEPDHQAFTQLDVLNVARRLARD* |
| Ga0066653_101448321 | 3300006791 | Soil | QALWFRADEHPEGGDPDFQAFTQMDVLNVVDRLAAAA* |
| Ga0075428_1021470071 | 3300006844 | Populus Rhizosphere | ALGMQTVQAFWFRADPDDGGPEPDWEAFTPMDVLNVVRRLTGES* |
| Ga0075429_1007976311 | 3300006880 | Populus Rhizosphere | VQAFWFRADPDDGGPEPDWEAFTPMDVLNVVRRLTGES* |
| Ga0075426_102195251 | 3300006903 | Populus Rhizosphere | VQALWFRADEHPEGGEPDHLALTQFDVLNIARRLVAA* |
| Ga0079218_119639291 | 3300007004 | Agricultural Soil | ALWFRADDDQRGVDPDYEAYTPMDVLNVVLRLLGER* |
| Ga0066709_1000907451 | 3300009137 | Grasslands Soil | TVQALWFRADEHPDGGEPDHQAFTQLDVLNIVRRRLGN* |
| Ga0066709_1038519502 | 3300009137 | Grasslands Soil | VQALWFRADEHPDGAEPDHQAFTQLDVLNIARRLAA* |
| Ga0066709_1041182981 | 3300009137 | Grasslands Soil | MTTVQALWFRADEHPDGAEHDHQAFTQLDVLNIARRLAA* |
| Ga0111538_132996782 | 3300009156 | Populus Rhizosphere | DDDERGLDPDHEAFTPMDVLNVVRRLLGEDAGHYT* |
| Ga0105241_104893321 | 3300009174 | Corn Rhizosphere | AELGMTTVQALWFRADEHPDGAEPDHQAFTQLDVLNIARRLAT* |
| Ga0105249_109263603 | 3300009553 | Switchgrass Rhizosphere | VTTVQALWFRVDEGSGGVEPDYLAFTPLDVLAIVRQLAD* |
| Ga0105249_112408391 | 3300009553 | Switchgrass Rhizosphere | TVQALWFRADENPDGIEPDFQAFTQMDVLNIVRRLNGE* |
| Ga0105071_10533522 | 3300009808 | Groundwater Sand | VQAFWFRADEDERGLDPDYEAFTAMDVLNVVRRLTGEAE* |
| Ga0126313_100083527 | 3300009840 | Serpentine Soil | IGMKTVQAFWFRADEGVDGVEPDYEAFTLMDVLNVVDRLAA* |
| Ga0126313_105404921 | 3300009840 | Serpentine Soil | SVQALWFRADENDEGGEPDHQAFTQMDVLNIADRLVA* |
| Ga0126304_104580941 | 3300010037 | Serpentine Soil | GMTTVLAYWFRADEDDRGLEPDHEAFTQMDVLNVVRRLLRET* |
| Ga0126315_106652012 | 3300010038 | Serpentine Soil | MTTVQALWFRADERSGGAAPDFQAFTPMDVLNVVRRLNGEV* |
| Ga0126310_103139481 | 3300010044 | Serpentine Soil | VWFRADENPNGIEPDYQAFTQIDVLNVVERVSGRR* |
| Ga0134070_104546612 | 3300010301 | Grasslands Soil | QALWFRADEHPDGAVPDYQAFTQLDVLNVARRLAA* |
| Ga0134082_102918191 | 3300010303 | Grasslands Soil | VQALWFRADEHPEGGEPDFQAFTQMDVLNVVGRLDTASV* |
| Ga0134065_103060181 | 3300010326 | Grasslands Soil | ELGMTTVQALWFRADEHPDGREPDHQAFTQLDVLNVARRLLDA* |
| Ga0134080_104908542 | 3300010333 | Grasslands Soil | TTVQALWFRADEHPEGGEPDFQAVTPMDILNIVRRLRGEQP* |
| Ga0134063_101765033 | 3300010335 | Grasslands Soil | WFRADEHPEGGEPDFQAFTQMDVLNVVDRLAAAA* |
| Ga0126378_105257361 | 3300010361 | Tropical Forest Soil | MTTVQAVWFRADEHPDGGVPDHVAFTQFDVLNIARRLVSV* |
| Ga0126377_101267191 | 3300010362 | Tropical Forest Soil | QALWFRADENPDGARPDHEAFTQMDVLNIADRLLGSGW* |
| Ga0134126_130966002 | 3300010396 | Terrestrial Soil | MATVQAFWFRADDDERGLDPDFEAFTPMDVLNVVRRLSGEL* |
| Ga0134121_110927871 | 3300010401 | Terrestrial Soil | AGMVTVQALWSRADEHPDGAEPDFEAYTMMDVLNIAARLNEPR* |
| Ga0120167_10674832 | 3300012001 | Permafrost | MKTVQAVWFRADENPAGAEPDYQAFTQFDVLNIADRLLS* |
| Ga0120167_10829922 | 3300012001 | Permafrost | MTTVQALWFRADEHLEGGEPDYEAFTQMDVLNIARRLAA* |
| Ga0120134_10687152 | 3300012004 | Permafrost | MTTVQALWFSADRVDGIEPDFMAFTPMDVLNIARRLRD* |
| Ga0137388_117647622 | 3300012189 | Vadose Zone Soil | KTVQALWFRADDHPDGVEPDFQAFTQMDILNIVKRLS* |
| Ga0137374_1000925413 | 3300012204 | Vadose Zone Soil | ANEVGMTSVQAVWFRADEHSEGGEPDHQAFTQMDVLNVVDRALASA* |
| Ga0137381_117193661 | 3300012207 | Vadose Zone Soil | MRTVQALWFRAEGKPPGVEPDFCAFTQADVLDIVRRLTGES* |
| Ga0137367_1001089510 | 3300012353 | Vadose Zone Soil | QALWFRADEHPQGGEPDHQAFTQMDVLNIARRLA* |
| Ga0137369_107064393 | 3300012355 | Vadose Zone Soil | GMTTVQALWFRADENPDGAEPDHEAFTQMDVLNIADRLLGAV* |
| Ga0137375_113477291 | 3300012360 | Vadose Zone Soil | MTTVQALWFRADENPDGAEPDHEAFTQMDVLNIADRLLGAV* |
| Ga0157342_10569721 | 3300012507 | Arabidopsis Rhizosphere | ELGMTTVQALWYRADEHPDGAEPDYQAFTQLDVLNVAQRLAT* |
| Ga0157330_10244991 | 3300012514 | Soil | VQAVWFRADENPEGAEADHQAFTQLDVLNITRRLVAA* |
| Ga0157308_100509793 | 3300012910 | Soil | RGAAELGMTTVQALWYRADDHPDGAEPDHQAFTQLDVLNVARQLAA* |
| Ga0164300_109611041 | 3300012951 | Soil | MTTVQALWFRADEHPDGGEPDHQAFTQFDVLNVARRLLG* |
| Ga0164303_111771402 | 3300012957 | Soil | VQALWFRADEHPDGAEPDYQAFTQLDVLNIARRVAT* |
| Ga0164299_101506633 | 3300012958 | Soil | MTTVQALWFRADEHPEGGEPDFQAFTQMDVLNVVDRLAAAA* |
| Ga0164301_105576233 | 3300012960 | Soil | VQALWFRADEHPEGAEPDHQAFTQFDVLNVARRLLG* |
| Ga0134087_102178421 | 3300012977 | Grasslands Soil | LWFRADAYLGAPEPDYQAFTQMDVLNIAARVSAT* |
| Ga0164305_102848373 | 3300012989 | Soil | TTVQALWFRADEHPEGGEPDFQAFTQMDVLNVVDRLAAAA* |
| Ga0164305_119266851 | 3300012989 | Soil | MTTVQALWFRADEHPGGGEPDHQAFTQFDVLNIARRMLG* |
| Ga0157373_101107113 | 3300013100 | Corn Rhizosphere | GMTTVQALWYRADDHPDGAEPDYQAFTQLDVLNVARRLARD* |
| Ga0157374_124009821 | 3300013296 | Miscanthus Rhizosphere | RDAGMVTVQALWSRADEHPDGAEPDFEAYTMMDVLNIAARLNEAR* |
| Ga0157378_113885131 | 3300013297 | Miscanthus Rhizosphere | MTTVQALWFRADEHPDGAEPDHQAFTQLDVLNIARRLATSP* |
| Ga0120158_100180891 | 3300013772 | Permafrost | ELGMTTVQALWFRADEHPEGGEPDYEAFTQMDVLNIARRLQQ* |
| Ga0134078_106002932 | 3300014157 | Grasslands Soil | ELGMTTVQALWYRADDHPDGAEPDHQAFTQLDVLNVARRLARNS* |
| Ga0075313_11686171 | 3300014267 | Natural And Restored Wetlands | LGMTTVQAFWFRADPDDRAPEPDWEAFTPMDVLNIVRRLTGES* |
| Ga0163163_110539633 | 3300014325 | Switchgrass Rhizosphere | FWFRADDDERGLDPDFEAFTTMDVLNVVRRLCGEL* |
| Ga0134085_101903803 | 3300015359 | Grasslands Soil | LWFRADEHPDGGEPDFQAFTQFDVLNIARRLVAA* |
| Ga0163161_119573021 | 3300017792 | Switchgrass Rhizosphere | MMTVQALWFRADENPDGAEPDHQAFTQMDVMNIADRLLAAA |
| Ga0184610_11998142 | 3300017997 | Groundwater Sediment | AEVGMTTVQAMWFRADEHPEGGEPDYQAFTQMDGLNIANRLLPAA |
| Ga0184639_104175712 | 3300018082 | Groundwater Sediment | GELGMTTVQALWFRADENPDGAEPDHQAFTQMDVLNIVDRLLGSG |
| Ga0190268_104278801 | 3300018466 | Soil | GMTTVQALWFRADEHPEGGEPDYLAFTQMDVLNFVDRLRS |
| Ga0190268_115338891 | 3300018466 | Soil | AKELGMTTVQALWFRADDDERGLDPDYEAFTPMDVLNVVRRLAGET |
| Ga0190268_116548642 | 3300018466 | Soil | GMTTVLAYWFRADEDDRGLEPDHEAFTQMDVLNVVRRLLGET |
| Ga0190270_103328791 | 3300018469 | Soil | AFWFRADDDERGLDPDFEAFTTMDVLNVVRRLSGAL |
| Ga0066669_105812391 | 3300018482 | Grasslands Soil | QALWFRADEHPDGAEPDHQAFTQLDVLNVARRLAA |
| Ga0193728_13688982 | 3300019890 | Soil | TTVQALWFRADESPDGGEPDFQAFTQMDVLNVVDRLAAAA |
| Ga0193739_10517011 | 3300020003 | Soil | IWFRADENPDGIEPDYQAFTQMDVLNVVERLRAAA |
| Ga0193732_10523032 | 3300020012 | Soil | ELGMTTVQALWFRVDEHPEGGVPDFEAFTQMDVLNFIDRLAAAA |
| Ga0193738_11746281 | 3300020020 | Soil | MTTVQALWFRADDHPDAVEADYQAFTQMDVLNVVRRLNGE |
| Ga0210378_101352853 | 3300021073 | Groundwater Sediment | MTTVLAHWFRADEDDRGLEPDHEAFTQMDVLNVVRRLLGET |
| Ga0210378_102525401 | 3300021073 | Groundwater Sediment | GELGMTTVQALWFRADEHPEGGEPDYLAFTQMDVLNFVDRLRS |
| Ga0210381_102199102 | 3300021078 | Groundwater Sediment | TTVQALWFRADENPDGAEPDHQAFTQMDVLNIADRLLASG |
| Ga0212128_106807672 | 3300022563 | Thermal Springs | LWFRADADERGVEPDFEAFTQMDVLNIARRLVGEI |
| Ga0247667_10641311 | 3300024290 | Soil | AELGMTTVQALWFRADEHPNGAEPDHQAFTQLDVLNIARRLAA |
| Ga0209324_106130671 | 3300025174 | Soil | MRAVQALWYRVDDDPRGLDADFEAFTQLDVLNAVRRLLGEI |
| Ga0207688_101415493 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | TVQALWFRADEHPDGAEPDHQAFTQLDVLNIARRLAT |
| Ga0207652_106918791 | 3300025921 | Corn Rhizosphere | VQALWYRADEHPDGAEPDHQAFTQLDVLNVARRLARD |
| Ga0207687_100134658 | 3300025927 | Miscanthus Rhizosphere | GRDATVQALWFRADDDERGLEPDYEAFTPMDVLNVVRRLSGEL |
| Ga0207678_100893996 | 3300026067 | Corn Rhizosphere | MTTVQALWYRADEHPDGAEPDYQAFTQLDVLNVAQRLAT |
| Ga0207702_116402482 | 3300026078 | Corn Rhizosphere | ELGMTTVQALWFRADEHPDGAEPDHRAFTQLDVLNVARRLQG |
| Ga0207568_1039042 | 3300026763 | Soil | AFWFRADDDERGLDPDFEAFTTMDVLNVVRRLSGEL |
| Ga0209896_10159263 | 3300027006 | Groundwater Sand | QALWFRADEHPDGGKPDYTAFTQMDVLNVVTRLNSE |
| Ga0209178_11249061 | 3300027725 | Agricultural Soil | TVQALWFRADEHPEGGEPDFQAFTQMDVLNVVDRLAAAA |
| Ga0209074_102452682 | 3300027787 | Agricultural Soil | ELGMTTVQALWYRVDEHPDGAEPDYQAFTQLDVLNVAQRLAT |
| Ga0209486_108945981 | 3300027886 | Agricultural Soil | LWFRADDDQRGVDPDYEAYTPMDVLNVVLRLLGER |
| Ga0209382_100300268 | 3300027909 | Populus Rhizosphere | QALWFRADDHPEGGEPEFQAFTQMDVLNVVDRLAAAA |
| Ga0209859_10274211 | 3300027954 | Groundwater Sand | LGMTTVQAFWFRADDDERGLDPDYEAFTAMDVLNVVRRLTGEL |
| Ga0268264_124684081 | 3300028381 | Switchgrass Rhizosphere | TVQAFWFRADDDERGLDPDFEAFTTMDVLNVVRRLSGEL |
| Ga0307291_10965583 | 3300028707 | Soil | GMTTVQAFWFRADDDERGLDPDFEAFTTMDVLNVVRRLSGEL |
| Ga0307298_101033611 | 3300028717 | Soil | LWFRADENPDGAEPDHQAFTQMDVLNIADRLLAAA |
| Ga0307301_100818073 | 3300028719 | Soil | AGELGMMTVQALWFRADEHADGREPDHQAFTQADVLNVVRHLA |
| Ga0307301_100986313 | 3300028719 | Soil | ELGMTTVQALWFRADAHPEGGEPDYLAFTQMDVLNFVDRLRT |
| Ga0307301_101254792 | 3300028719 | Soil | TVQALWFRADENPDGAEPDHQAFTQMDVLNIADRLLASG |
| Ga0307301_101401851 | 3300028719 | Soil | YWFRADQDDRGLEPDHEAFTQMDVLNVVRRLLGET |
| Ga0307317_100146063 | 3300028720 | Soil | MTTVQALWFRADENPDGAEPDHQAFTQMDVLNIADRLLASG |
| Ga0307319_103033182 | 3300028722 | Soil | TSVQAVWFRADEHPEGGEPDHQAFTQMDVLNLADRALTAA |
| Ga0307318_100083481 | 3300028744 | Soil | VLAYWFRADEDERGLEPDYEAFTQMDVLNVVRRLNGEL |
| Ga0307316_1000158810 | 3300028755 | Soil | TVQALWFRADEHPDGAEPDHRAFTQLDVLNVVRRLT |
| Ga0307316_101516191 | 3300028755 | Soil | VRGAAELGMTTVQALWYRADEHPDGAEPDHQAFTQLDVLNVARRLAA |
| Ga0307299_102633541 | 3300028793 | Soil | GELGMTTVQALWFRADEHADGREPDHQAFTQADVLNVARHLA |
| Ga0307287_100754853 | 3300028796 | Soil | VRGSNEVGMTSVQAIWFRADEHADGDEPDYQAFTQMDVLNIADRLLVEA |
| Ga0247824_105805401 | 3300028809 | Soil | KEAGMTTVQAFWFRADDDERGLDPDFEAFTTMDVLNVVRRLSGEL |
| Ga0307294_100074731 | 3300028810 | Soil | ALWFRADENPDGAEPDHQAFTQMDVLNIADRLLASG |
| Ga0247825_113862362 | 3300028812 | Soil | MATVQALWFRADDHPGGIEADYQAFTQMDVLNVVRRLTGE |
| Ga0307296_103650891 | 3300028819 | Soil | GANEVGMTSVQAVWFRADEHPEGGEPDHQAFTQMDVLNLADRALTAA |
| Ga0307312_100775294 | 3300028828 | Soil | QALWFRADEHPEGGEPDFQAFTQMDVLNVVDRLAAAA |
| Ga0307278_101332873 | 3300028878 | Soil | VQALWFRADEHADGREPDHQAFTQADVLNVARRLA |
| Ga0307278_101597301 | 3300028878 | Soil | RGANDGGMTSVQAVWFRADEHPEGGEPDHQAFTQMDVLNFVDRALTPA |
| Ga0247826_109191471 | 3300030336 | Soil | FWFRADDDERGLDPDYEAFTAMDVLNVARRLLGEL |
| Ga0307499_102929511 | 3300031184 | Soil | QAFWFRADDDERGLDPDFEAFTTMDVLNVVRRLSGEL |
| Ga0307410_116657231 | 3300031852 | Rhizosphere | VGMTTVQALWFRVDEHPDGAEPDHQAFTQLDVLNIARRLAGN |
| Ga0307406_107077591 | 3300031901 | Rhizosphere | SNEAGMTSVQALWFRADENAEGGEPDHQAFTQMDVLNLADRLLT |
| Ga0308175_1018340781 | 3300031938 | Soil | GAAEVGMTTVQALWYRADEHPDGAEPDHQAFTQLDVLNVARRLGA |
| Ga0307409_1014098303 | 3300031995 | Rhizosphere | TAQALWFRVDDHPDGGEPDFQAFTQVDVLNAARRLQP |
| Ga0310897_102347313 | 3300032003 | Soil | QAFWFRADDDERGLAPDFEAFTTMDVLNVVRRLSGEL |
| Ga0307414_119221972 | 3300032004 | Rhizosphere | TVLAYWFRADEDDRGLEPDHEAFTQMDVLNVVRRLFGET |
| Ga0310902_102092743 | 3300032012 | Soil | MTTVQAFWFRADDDERGLEPDFEAFTTMDVLNVVRRLSGEL |
| Ga0307471_1024559751 | 3300032180 | Hardwood Forest Soil | WFRADDHPEGGEPDFQAFTQMDVLNIARRLRQIAVSAS |
| Ga0307471_1035106052 | 3300032180 | Hardwood Forest Soil | GMTTVQALWFRADEHPDGAEPDHQAFTQLDVLNIARRLAT |
| Ga0364941_007551_1833_1955 | 3300034417 | Sediment | MATVQALWFRADDHPDGVEADYQAFTQMDVLNVVRRLNGE |
| Ga0373948_0018202_2_112 | 3300034817 | Rhizosphere Soil | ALWFRADEHPEGGEPDFQAFTQMDVLNVVDRLAAAA |
| Ga0373950_0176840_392_499 | 3300034818 | Rhizosphere Soil | QALWYRADEHPDGAEPDYQAFTQLDVLNVAQRLAT |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |