Basic Information | |
---|---|
Family ID | F045449 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 153 |
Average Sequence Length | 42 residues |
Representative Sequence | AVGLWLLRSELPNDLRRRKAAYPAVAEGESKEILGAGTQP |
Number of Associated Samples | 129 |
Number of Associated Scaffolds | 153 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.65 % |
% of genes near scaffold ends (potentially truncated) | 99.35 % |
% of genes from short scaffolds (< 2000 bps) | 88.24 % |
Associated GOLD sequencing projects | 121 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.29 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (86.275 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.765 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.837 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.673 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 153 Family Scaffolds |
---|---|---|
PF05995 | CDO_I | 28.76 |
PF04519 | Bactofilin | 6.54 |
PF07722 | Peptidase_C26 | 5.88 |
PF13781 | DoxX_3 | 5.88 |
PF02604 | PhdYeFM_antitox | 3.27 |
PF13545 | HTH_Crp_2 | 2.61 |
PF01850 | PIN | 1.96 |
PF13761 | DUF4166 | 1.96 |
PF02739 | 5_3_exonuc_N | 1.96 |
PF13432 | TPR_16 | 1.31 |
PF02630 | SCO1-SenC | 1.31 |
PF05050 | Methyltransf_21 | 1.31 |
PF02810 | SEC-C | 0.65 |
PF07719 | TPR_2 | 0.65 |
PF03852 | Vsr | 0.65 |
PF13391 | HNH_2 | 0.65 |
PF03992 | ABM | 0.65 |
PF00115 | COX1 | 0.65 |
PF14559 | TPR_19 | 0.65 |
PF01435 | Peptidase_M48 | 0.65 |
PF01339 | CheB_methylest | 0.65 |
PF05168 | HEPN | 0.65 |
PF00481 | PP2C | 0.65 |
PF06983 | 3-dmu-9_3-mt | 0.65 |
PF04343 | DUF488 | 0.65 |
COG ID | Name | Functional Category | % Frequency in 153 Family Scaffolds |
---|---|---|---|
COG5553 | Predicted metal-dependent enzyme of the double-stranded beta helix superfamily | General function prediction only [R] | 28.76 |
COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 6.54 |
COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 3.27 |
COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 3.27 |
COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 1.96 |
COG1225 | Peroxiredoxin | Posttranslational modification, protein turnover, chaperones [O] | 1.31 |
COG1999 | Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family | Posttranslational modification, protein turnover, chaperones [O] | 1.31 |
COG2201 | Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains | Signal transduction mechanisms [T] | 1.31 |
COG0631 | Serine/threonine protein phosphatase PrpC | Signal transduction mechanisms [T] | 0.65 |
COG1895 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.65 |
COG2250 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.65 |
COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.65 |
COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 0.65 |
COG3727 | G:T-mismatch repair DNA endonuclease Vsr, very short patch repair protein | Replication, recombination and repair [L] | 0.65 |
COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.65 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 86.27 % |
Unclassified | root | N/A | 13.73 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000567|JGI12270J11330_10098303 | Not Available | 1289 | Open in IMG/M |
3300000789|JGI1027J11758_12170621 | Not Available | 668 | Open in IMG/M |
3300001356|JGI12269J14319_10351035 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300003219|JGI26341J46601_10068928 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
3300004080|Ga0062385_10890499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 590 | Open in IMG/M |
3300004476|Ga0068966_1247562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
3300005332|Ga0066388_106536697 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300005533|Ga0070734_10255315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1005 | Open in IMG/M |
3300005534|Ga0070735_10834219 | Not Available | 542 | Open in IMG/M |
3300005537|Ga0070730_10656495 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300005541|Ga0070733_10218446 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
3300005541|Ga0070733_11092397 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300005542|Ga0070732_10238288 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
3300005563|Ga0068855_100639188 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
3300005712|Ga0070764_10060036 | All Organisms → cellular organisms → Bacteria | 1966 | Open in IMG/M |
3300005712|Ga0070764_10230512 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
3300005712|Ga0070764_10234223 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
3300005712|Ga0070764_10378609 | Not Available | 832 | Open in IMG/M |
3300005921|Ga0070766_10847275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 624 | Open in IMG/M |
3300006028|Ga0070717_11240080 | Not Available | 678 | Open in IMG/M |
3300006050|Ga0075028_100140517 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
3300006052|Ga0075029_100399712 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
3300006052|Ga0075029_101224019 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300006059|Ga0075017_100149525 | All Organisms → cellular organisms → Bacteria | 1661 | Open in IMG/M |
3300006086|Ga0075019_10119614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1525 | Open in IMG/M |
3300006102|Ga0075015_100916192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
3300006162|Ga0075030_100061909 | All Organisms → cellular organisms → Bacteria | 3101 | Open in IMG/M |
3300006162|Ga0075030_100441344 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
3300006173|Ga0070716_100036568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2708 | Open in IMG/M |
3300006174|Ga0075014_100172848 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
3300006800|Ga0066660_10239702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1411 | Open in IMG/M |
3300006893|Ga0073928_10049840 | All Organisms → cellular organisms → Bacteria | 3787 | Open in IMG/M |
3300006954|Ga0079219_11946214 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300009012|Ga0066710_104219072 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300009523|Ga0116221_1043759 | All Organisms → cellular organisms → Bacteria | 2126 | Open in IMG/M |
3300009623|Ga0116133_1164276 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300009623|Ga0116133_1171505 | Not Available | 575 | Open in IMG/M |
3300010043|Ga0126380_11074609 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300010043|Ga0126380_11621780 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300010048|Ga0126373_10597724 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
3300010341|Ga0074045_10098125 | All Organisms → cellular organisms → Bacteria | 2031 | Open in IMG/M |
3300010341|Ga0074045_10102102 | All Organisms → cellular organisms → Bacteria | 1983 | Open in IMG/M |
3300010358|Ga0126370_10664207 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
3300010361|Ga0126378_11132544 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
3300010366|Ga0126379_10160614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2109 | Open in IMG/M |
3300010379|Ga0136449_101101326 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
3300010398|Ga0126383_10249467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1741 | Open in IMG/M |
3300010401|Ga0134121_10493312 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
3300011120|Ga0150983_11817378 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1010 | Open in IMG/M |
3300011271|Ga0137393_10211987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1637 | Open in IMG/M |
3300012200|Ga0137382_11185182 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300012203|Ga0137399_10070871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2614 | Open in IMG/M |
3300012354|Ga0137366_10238304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1351 | Open in IMG/M |
3300012357|Ga0137384_10440178 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
3300012924|Ga0137413_11273485 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300012927|Ga0137416_10519191 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
3300013297|Ga0157378_11637509 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300014168|Ga0181534_10020122 | All Organisms → cellular organisms → Bacteria | 3385 | Open in IMG/M |
3300014169|Ga0181531_10214682 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
3300014200|Ga0181526_10888538 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300014201|Ga0181537_10038802 | All Organisms → cellular organisms → Bacteria | 3258 | Open in IMG/M |
3300014495|Ga0182015_10800297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus | 592 | Open in IMG/M |
3300015195|Ga0167658_1042341 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
3300015241|Ga0137418_10505842 | Not Available | 965 | Open in IMG/M |
3300017822|Ga0187802_10171394 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
3300017934|Ga0187803_10337139 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300017938|Ga0187854_10204565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 871 | Open in IMG/M |
3300017943|Ga0187819_10278887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia | 974 | Open in IMG/M |
3300017970|Ga0187783_10259187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1271 | Open in IMG/M |
3300017975|Ga0187782_10798687 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
3300017988|Ga0181520_10845803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
3300017995|Ga0187816_10135854 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
3300018042|Ga0187871_10206511 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
3300018085|Ga0187772_10083741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 2027 | Open in IMG/M |
3300018085|Ga0187772_10156298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1511 | Open in IMG/M |
3300018085|Ga0187772_10524710 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
3300018468|Ga0066662_11196252 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300019158|Ga0184580_116995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 785 | Open in IMG/M |
3300019256|Ga0181508_1087731 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300019260|Ga0181506_1138755 | Not Available | 849 | Open in IMG/M |
3300019888|Ga0193751_1034797 | All Organisms → cellular organisms → Bacteria | 2316 | Open in IMG/M |
3300019890|Ga0193728_1352864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
3300020579|Ga0210407_10293926 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris | 1268 | Open in IMG/M |
3300020580|Ga0210403_10140725 | All Organisms → cellular organisms → Bacteria | 1970 | Open in IMG/M |
3300020580|Ga0210403_10340182 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
3300020580|Ga0210403_10852865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
3300020582|Ga0210395_10050732 | All Organisms → cellular organisms → Bacteria | 3039 | Open in IMG/M |
3300020582|Ga0210395_11204658 | Not Available | 556 | Open in IMG/M |
3300020583|Ga0210401_10039423 | All Organisms → cellular organisms → Bacteria | 4482 | Open in IMG/M |
3300021171|Ga0210405_10717457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 771 | Open in IMG/M |
3300021181|Ga0210388_11504079 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300021404|Ga0210389_10136984 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 1895 | Open in IMG/M |
3300021405|Ga0210387_11063539 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300021432|Ga0210384_11327458 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300021478|Ga0210402_10281081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1539 | Open in IMG/M |
3300022522|Ga0242659_1064084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 673 | Open in IMG/M |
3300022557|Ga0212123_10155722 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris | 1756 | Open in IMG/M |
3300022557|Ga0212123_10190324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1533 | Open in IMG/M |
3300022730|Ga0224570_107693 | Not Available | 665 | Open in IMG/M |
3300023046|Ga0233356_1018636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB60 | 800 | Open in IMG/M |
3300025320|Ga0209171_10102801 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia maris | 1745 | Open in IMG/M |
3300025498|Ga0208819_1068163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 790 | Open in IMG/M |
3300025812|Ga0208457_1087548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
3300025906|Ga0207699_11186966 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300025928|Ga0207700_10277165 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1441 | Open in IMG/M |
3300025929|Ga0207664_11348063 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300025929|Ga0207664_11497138 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300025939|Ga0207665_10129964 | All Organisms → cellular organisms → Bacteria | 1787 | Open in IMG/M |
3300025949|Ga0207667_10812173 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
3300026467|Ga0257154_1021107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
3300026467|Ga0257154_1073455 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300026557|Ga0179587_11092894 | Not Available | 525 | Open in IMG/M |
3300027072|Ga0208238_1009747 | Not Available | 806 | Open in IMG/M |
3300027565|Ga0209219_1015023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1846 | Open in IMG/M |
3300027867|Ga0209167_10722168 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300027867|Ga0209167_10737755 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300027869|Ga0209579_10558046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 622 | Open in IMG/M |
3300027898|Ga0209067_10208170 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
3300027898|Ga0209067_10358045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 811 | Open in IMG/M |
3300027986|Ga0209168_10570928 | Not Available | 542 | Open in IMG/M |
3300028012|Ga0265346_102921 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Frigoriglobus → Frigoriglobus tundricola | 617 | Open in IMG/M |
3300028047|Ga0209526_10720996 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300028776|Ga0302303_10328297 | Not Available | 513 | Open in IMG/M |
3300028906|Ga0308309_10360828 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
3300029882|Ga0311368_10700374 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300029903|Ga0247271_100603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9881 | Open in IMG/M |
3300029908|Ga0311341_10297762 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 960 | Open in IMG/M |
3300029999|Ga0311339_10057280 | All Organisms → cellular organisms → Bacteria | 5155 | Open in IMG/M |
3300030020|Ga0311344_11373876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
3300030058|Ga0302179_10329048 | Not Available | 673 | Open in IMG/M |
3300030509|Ga0302183_10129510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 993 | Open in IMG/M |
3300030730|Ga0307482_1103799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 781 | Open in IMG/M |
3300031234|Ga0302325_13344430 | Not Available | 507 | Open in IMG/M |
3300031258|Ga0302318_10408486 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 685 | Open in IMG/M |
3300031474|Ga0170818_103535256 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300031525|Ga0302326_10099052 | All Organisms → cellular organisms → Bacteria | 5231 | Open in IMG/M |
3300031708|Ga0310686_100444819 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300031708|Ga0310686_112780781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
3300031718|Ga0307474_11048088 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300031754|Ga0307475_10230826 | Not Available | 1482 | Open in IMG/M |
3300031754|Ga0307475_11446289 | Not Available | 529 | Open in IMG/M |
3300031823|Ga0307478_10061264 | All Organisms → cellular organisms → Bacteria | 2818 | Open in IMG/M |
3300031823|Ga0307478_10625967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 900 | Open in IMG/M |
3300031823|Ga0307478_11808686 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300031897|Ga0318520_10857655 | Not Available | 571 | Open in IMG/M |
3300031962|Ga0307479_10769492 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
3300032160|Ga0311301_12936997 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
3300032515|Ga0348332_10875672 | Not Available | 621 | Open in IMG/M |
3300032515|Ga0348332_14603568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 898 | Open in IMG/M |
3300032783|Ga0335079_10093629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3407 | Open in IMG/M |
3300032829|Ga0335070_11343959 | Not Available | 653 | Open in IMG/M |
3300033412|Ga0310810_10723123 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
3300034163|Ga0370515_0154882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 982 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.76% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 7.19% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 6.54% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.88% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.23% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.58% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.58% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.92% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.92% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.92% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.27% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.27% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.27% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.61% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.61% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.61% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.61% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.61% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.96% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.31% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.31% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.31% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.31% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.31% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.31% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.31% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.31% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.65% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.65% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.65% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.65% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.65% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.65% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.65% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.65% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.65% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.65% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.65% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004476 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300015195 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019158 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSI1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019256 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019260 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU2 | Host-Associated | Open in IMG/M |
3300023046 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS | Environmental | Open in IMG/M |
3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025498 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes) | Environmental | Open in IMG/M |
3300025812 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027072 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF013 (SPAdes) | Environmental | Open in IMG/M |
3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028012 | Plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE4 | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029903 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703 | Environmental | Open in IMG/M |
3300029908 | II_Bog_E1 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12270J11330_100983031 | 3300000567 | Peatlands Soil | AAATAGGLWLLRSQLPDDLRRRKATAYPGVAQGQSGEILGSGTQP* |
JGI1027J11758_121706211 | 3300000789 | Soil | TGAVAVGLWLLKSELPRDLRRRKQAAYPAVAEGESKEILGAGR* |
JGI12269J14319_103510351 | 3300001356 | Peatlands Soil | AVAAGLWLLRSELPGDLRRRKGAVYPVVAQGQSQEISDAGREP* |
JGI26341J46601_100689281 | 3300003219 | Bog Forest Soil | LVSVTWLAAVAAGLWLLRSELPGDLRHRKGAVYPVVAQGQSQEISDAGREP* |
Ga0062385_108904992 | 3300004080 | Bog Forest Soil | AAAVGLWLLKSQLPNDLRRRKATAYPAVAEGESKEILGSGTQP* |
Ga0068966_12475621 | 3300004476 | Peatlands Soil | VGLWLLRSQLPNDLRRRKATAYPAVAEGESKEIMGAGTQP* |
Ga0066388_1065366971 | 3300005332 | Tropical Forest Soil | ITWAAAAAAGLWMLKSELPRDLRRRKAAAYPAVAQAESKEILAGGREP* |
Ga0070734_102553151 | 3300005533 | Surface Soil | RSELPGDLRRRKRAAYPSVAQGESKEILGAGTEP* |
Ga0070735_108342191 | 3300005534 | Surface Soil | LWLLKSELPRDLRRRKQAAYPAVAEGESKEIMSAGR* |
Ga0070730_106564951 | 3300005537 | Surface Soil | LGLVSVTWAAAVAVGLWLLRSELPGDLRRRRGAVYPEVAQVETREILGAGK* |
Ga0070733_102184461 | 3300005541 | Surface Soil | TAVGLWLLRSQLPNDLRRRKTAYPAVAEGESKEIMGAGTQP* |
Ga0070733_110923972 | 3300005541 | Surface Soil | AAAVAAGLWLLRSELPQDLRRKKGTAVYPSVAQGEAKEILGAGREA* |
Ga0070732_102382881 | 3300005542 | Surface Soil | WLLRSELPRDLRQRKTAAYPAVAQDESREIMGAGR* |
Ga0068855_1006391883 | 3300005563 | Corn Rhizosphere | WAAAALAGLWLLRSELPRDLRRRKAAAYPVVAHDESKEILGAGR* |
Ga0070764_100600364 | 3300005712 | Soil | AAGLWLLKSQLPNDLRRRKATAYPAVAEGESKEILGSGTRP* |
Ga0070764_102305123 | 3300005712 | Soil | GLWLVGSELPGDLRRRKGAVYPAVAAGETKEILGAGREP* |
Ga0070764_102342232 | 3300005712 | Soil | AAGLWLLKSQLPNDLRRRKATAYPAVAEGESKEILGSGTQP* |
Ga0070764_103786092 | 3300005712 | Soil | WGAAAALGLWLLKSQLPGDLRRRKQVAYPAVAQNETKEIMGAGTQP* |
Ga0070766_108472751 | 3300005921 | Soil | SVTWAAATALGLWLLKSELPRDLRRRKQAAYPAVAEGESKEILGAGR* |
Ga0070717_112400802 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | AAATAVGLWLLRSQLPNDLRRRKTAYPAVAEGESKEIMGAGTQP* |
Ga0075028_1001405171 | 3300006050 | Watersheds | LLKSDLPRALRRRKGAVYPAVAQNESKEILGAGR* |
Ga0075029_1003997122 | 3300006052 | Watersheds | TWAAAAAAGLWLLKSELPRDLRRRRAAAYPAVAQAESKEILGAGREP* |
Ga0075029_1012240191 | 3300006052 | Watersheds | AAVAAGLWLLKSDLPRDLRRRKGAVYPAVAQGESKEILGAGREP* |
Ga0075017_1001495251 | 3300006059 | Watersheds | LGLITVTWAAAVAGGLWLLRSELPGDLRRRKAAAYPAVAQGETKEILGAGREP* |
Ga0075019_101196141 | 3300006086 | Watersheds | AAAAGLWLLKSELPRDLRRRRAAAYPAVAQAESKEILGAGREP* |
Ga0075015_1009161922 | 3300006102 | Watersheds | GLWLLRSDLPRELRRRKGAVYPAVAQGETKEILGAGTQP* |
Ga0075030_1000619093 | 3300006162 | Watersheds | MVQSELPGELRRKKAAAYPAVAQDGSKEIMGSGTQP* |
Ga0075030_1004413441 | 3300006162 | Watersheds | LGLWLLKSELPRDLRRRRAAAYPAVAQAESKEIMGAGREP* |
Ga0070716_1000365685 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | WAAAVAAGLWLLKSELPRDIRRRRKTAAYPAVAEGESKEILGAGR* |
Ga0075014_1001728481 | 3300006174 | Watersheds | LWLLRSELPGDLRRRKGAVYPAVAQGGSKEILGAGTQP* |
Ga0066660_102397023 | 3300006800 | Soil | VTWAAATALGLWLLKSELPRDLRRRRAAAYPAVAQAQSKEIMSAGREP* |
Ga0073928_100498405 | 3300006893 | Iron-Sulfur Acid Spring | WLLRSELPGDLRRRKVTAYPGVAEGQSKEILGAGTQP* |
Ga0079219_119462142 | 3300006954 | Agricultural Soil | TWMAAAMAGLWLMRSELPRDLRRRKAAAYPVVAHDESKEILGAGR* |
Ga0066710_1042190721 | 3300009012 | Grasslands Soil | AAAVAAGLWLLRSELPADLRRRKGAVYPVVAQGQTKEISEAGTQP |
Ga0116221_10437593 | 3300009523 | Peatlands Soil | WAAATAGGLWLLRSQLPDDLRRRKATAYPGVAQGQSGEILGSGTQP* |
Ga0116133_11642762 | 3300009623 | Peatland | TQLALVSLTWAAAVAAGLWLLRSELPADLRRRKGAVYPSVAQGEAKEILDAGREP* |
Ga0116133_11715052 | 3300009623 | Peatland | AAGLWLLRSELPGDLRRRKVTAYPGVAEGQSKEILGAGTQP* |
Ga0126380_110746092 | 3300010043 | Tropical Forest Soil | VAAGLWLVNSELPRDLRRRRAAAYPAVAQGQSKEILGAGR* |
Ga0126380_116217802 | 3300010043 | Tropical Forest Soil | ATWAAGAAAGLWLLKSELPRDLRRRRVTAYPAVAQDESNEILGAGREP* |
Ga0126373_105977243 | 3300010048 | Tropical Forest Soil | WLLGSELPRDLRRRRQTAYPAVAQAESKEIMGAGREP* |
Ga0074045_100981251 | 3300010341 | Bog Forest Soil | AVGLWLLRSELPGDLRRRKGAVYPAVAQGGSKEILGSGREP* |
Ga0074045_101021024 | 3300010341 | Bog Forest Soil | VAAGLWLLGSELPLDLRRRKGAVYPAVAQGGSREILGSGREP* |
Ga0126370_106642071 | 3300010358 | Tropical Forest Soil | TWTAAVAAGLWLLKSELPRDLRRRRAAAYPAVAQTESKEILGAGREP* |
Ga0126378_111325441 | 3300010361 | Tropical Forest Soil | AAAAAGLWLLRSELPRDLRRRRAAAYPAVAQDQSKEILGAGK* |
Ga0126379_101606144 | 3300010366 | Tropical Forest Soil | AWAAAAWAGLWLLGSELPRDLRRRRRTAYPAVAHAESKEIMGAGREP* |
Ga0136449_1011013263 | 3300010379 | Peatlands Soil | WLAAVAAGLWLLRSELPGDLRRRKGAVYPVVAQGQSKEISDAGREP* |
Ga0126383_102494674 | 3300010398 | Tropical Forest Soil | GLWLLKSELPGDLRRRRAAAYPAVAQAQSKEILDVGREP* |
Ga0134121_104933123 | 3300010401 | Terrestrial Soil | LWLLRSELPGDLRRRKGAVYPVVAQGESKEISDAGTQP* |
Ga0150983_118173781 | 3300011120 | Forest Soil | TWAAAVAAGLWLLRSDLPRALRRRKGAVYPAVAQGETKEILGAGTQP* |
Ga0137393_102119873 | 3300011271 | Vadose Zone Soil | AGLWLLRSELPKDLWRRRVAEYPAVAGVQPEETRGAGAHP* |
Ga0137382_111851822 | 3300012200 | Vadose Zone Soil | VAAGLWLLRSELPADLRRRKGAVYPVVAQGQTKEISEAGTQP* |
Ga0137399_100708714 | 3300012203 | Vadose Zone Soil | WAAAVAGGLWLLRSRLPLDLRRRKATAYPGVAQGESTEIIRTGGQP* |
Ga0137366_102383041 | 3300012354 | Vadose Zone Soil | SLTWAAAVAAGLWLLRSELPRDLRRRKGAVYPVVAQGQSKEMSEAGTQP* |
Ga0137384_104401781 | 3300012357 | Vadose Zone Soil | LRSELPGDLRRRKGAVYPSVAQGQSKEILGAGTQP* |
Ga0137413_112734852 | 3300012924 | Vadose Zone Soil | AAAAVAAGLWLLRSELPGDLRRRKTAVHPSVAHGESKEILGAGREP* |
Ga0137416_105191912 | 3300012927 | Vadose Zone Soil | GLWLLRSRLPLDLRRRKATAYPGVAQGESTEIIRTGAQP* |
Ga0157378_116375091 | 3300013297 | Miscanthus Rhizosphere | TGTWAAAVAAALWLLRAELPGDLRRRKGAVYPVVAQGESKEISDAGTQP* |
Ga0181534_100201225 | 3300014168 | Bog | AGLWLTRSELPGDLRRRKVTAYPGVAEGQSKEILGAGREP* |
Ga0181531_102146823 | 3300014169 | Bog | AAVAAGLWLLRSELPADLRRRKGAVYPSVAQGESKEILGAGREP* |
Ga0181526_108885382 | 3300014200 | Bog | LWLLRSELPGDLRRRKGAVYPVVAQGQSKEISDAGREP* |
Ga0181537_100388024 | 3300014201 | Bog | LWLLRSELPQDLRRRKGAVYPAGAQGESKEILSAGR* |
Ga0182015_108002972 | 3300014495 | Palsa | VLKSQLPNELRPRKKIAYPAVAQSEGKEILDAGTQP* |
Ga0167658_10423411 | 3300015195 | Glacier Forefield Soil | AVGLWLLRSQLPNDLRRRKATAYPAVAEGESKEIMGAGTQP* |
Ga0137418_105058421 | 3300015241 | Vadose Zone Soil | VFRARQWLLRSQLPNDLRRRKTAYPAVAEGESKEIMGAGTQP* |
Ga0187802_101713941 | 3300017822 | Freshwater Sediment | AVLAGLWLLRSELPRDLRRRRQTAYPAVAQVESKEIMGAGRD |
Ga0187803_103371391 | 3300017934 | Freshwater Sediment | GLWLLKSELPRDLRRRRAAAYPSVAQAESKEILGAGREP |
Ga0187854_102045651 | 3300017938 | Peatland | TWAAATLAGLWLLKSQLPSDLRRRKQIAYPAVAHNEGKEILGAGTEP |
Ga0187819_102788871 | 3300017943 | Freshwater Sediment | AAVAAGLWLLRSELPGDLRRRKGAVYPAVAQGGSREILGSGREP |
Ga0187783_102591874 | 3300017970 | Tropical Peatland | WLLRSELPADLRRRKGAVYPAVAQGGSKEILGAGTQP |
Ga0187782_107986873 | 3300017975 | Tropical Peatland | VAAGLWLLKSDLPRDLRRRKGAVYPAVAQGESNEILDAGREP |
Ga0181520_108458032 | 3300017988 | Bog | AAAALLGLWLLRSQLPNDLRRRKKTAYPGVAEGESKEIMGAGREP |
Ga0187816_101358544 | 3300017995 | Freshwater Sediment | LLRSELPQALRRRKGAVYPAVAQGGSREIVGSGREP |
Ga0187871_102065111 | 3300018042 | Peatland | AGLWLTRSELPGDLRRRKATAYPGVAEGQGEEIMDAGREP |
Ga0187772_100837414 | 3300018085 | Tropical Peatland | GLRLLRSQLPNDLRRRKAAYPAVAEGEGKEILGAGTQP |
Ga0187772_101562981 | 3300018085 | Tropical Peatland | GLWLLGSELPRDLRRRKGAVYPAVAQGGSREILGSGREP |
Ga0187772_105247102 | 3300018085 | Tropical Peatland | GLWLLGSELPQDLRRRKGAVYPAVAQGGSREILGSGTQP |
Ga0066662_111962521 | 3300018468 | Grasslands Soil | MAGLWLMRSELAGDLRRRNAAAYPAVAQDESREILGAGR |
Ga0184580_1169952 | 3300019158 | Soil | AVAVGLWLLRSQLPNDLRRRKKTAYPGVAEGESKEIMGAGTQP |
Ga0181508_10877312 | 3300019256 | Peatland | VAAGLWLLRSELPQDLRRRKGAVYPAVAQGESKEILSAGR |
Ga0181506_11387551 | 3300019260 | Peatland | LRSQLPNDLRRRKATAYPAVAQVEGKEIMGAGTQP |
Ga0193751_10347971 | 3300019888 | Soil | VAGGLWLLGSELPGDLRRRKGAVYPSVAQGETKEILGAGTQP |
Ga0193728_13528641 | 3300019890 | Soil | AVGLWLLKSQLPNDLRRRKAAYPAVAEGESKEILGAGTQP |
Ga0210407_102939263 | 3300020579 | Soil | ATAVGLWLLKSQLPNDLRRRKTAYPAVAEGESKEIMGAGTQP |
Ga0210403_101407251 | 3300020580 | Soil | GRVSITGLAAVAAGLWLLRSELPGDLRRRKGAVFPAVAQGGGKEILGAGREP |
Ga0210403_103401821 | 3300020580 | Soil | LVSLTWLAAVAAGLWLLGSELPGDLRRRKGAVYPSVAAGETKEILGAGREP |
Ga0210403_108528652 | 3300020580 | Soil | VTWAAATALGLWLLRSELPRDLRRRKQAAYPAVAEGESKEILGAGR |
Ga0210395_100507325 | 3300020582 | Soil | GLWLLKSELPRDLRRRKQAAYPAVAEGESKEILGAGR |
Ga0210395_112046581 | 3300020582 | Soil | LLRSELPGDLRRRKETAYPGVAEGESKEILGAGREP |
Ga0210401_100394231 | 3300020583 | Soil | AATGVGLRLLKSQLPNELRPRKKIAYPAVAQSEGKEILDAGTQP |
Ga0210405_107174571 | 3300021171 | Soil | AVGLWLLRSELPNDLRRRKAAYPAVAEGESKEILGAGTQP |
Ga0210388_115040791 | 3300021181 | Soil | VAGLWLLKSELPGDLRRKRQVAYPAAAHRGTGEILETGREP |
Ga0210389_101369844 | 3300021404 | Soil | VGLGLLKSQLPNDLRRRKTAYPAVAEGESKEIMGAGTQP |
Ga0210387_110635391 | 3300021405 | Soil | LKSELPRDLRRRRAAAYPALAQAQSKEIMGAGREP |
Ga0210384_113274581 | 3300021432 | Soil | LVSVTWAAAVAAGLWLLRSELPGDLRRRKGAVYPEVAQGQTKEISDAGTQP |
Ga0210402_102810814 | 3300021478 | Soil | WAAAVAAGLWLLRSELPGDLRRRKGAVYPAVAQGESKEILGAGREP |
Ga0242659_10640842 | 3300022522 | Soil | AAAAVGLWLLRSRLPNDLRRRKVTAYPAVAEGESKEILGSGTQP |
Ga0212123_101557223 | 3300022557 | Iron-Sulfur Acid Spring | AVAAGLWLLRSELPGDLRRRKVTAYPGVAEGQSKEILGAGTQP |
Ga0212123_101903244 | 3300022557 | Iron-Sulfur Acid Spring | LKSQLPNDLRRRKQIAYPAVAHNEGKEILGAGTEP |
Ga0224570_1076931 | 3300022730 | Rhizosphere | GAVGLWLLRSQLPNDLRRRKATAYPAVAEGESKEILGSGTQP |
Ga0233356_10186361 | 3300023046 | Soil | WLLRSQLPNDLRRRRTAYPAVAEGESKEIMGAGTQP |
Ga0209171_101028013 | 3300025320 | Iron-Sulfur Acid Spring | GLWLLRSELPGDLRRRKVTAYPGVAEGQSKEILGAGTQP |
Ga0208819_10681633 | 3300025498 | Peatland | VTWAAATLAGLWLLKSQLPSDLRRRKQIAYPAVAHNEGKEILGAGTEP |
Ga0208457_10875482 | 3300025812 | Peatland | LKSQLPNDLRRRRKIAYPAVAEAEGKEIMGAGTQP |
Ga0207699_111869661 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LGLVSVTWAAAVAAGLWLLRSELPGDLRRRKAAVYPSVAHGGSKEILGAGREP |
Ga0207700_102771653 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LALVSLTWAAATASGLWLLRSELPGDLRRRKGAVYPAVAQGEAKEILGAGR |
Ga0207664_113480633 | 3300025929 | Agricultural Soil | AQLALVSITWAAAVAAGLWVLRSELPRDLRRRKGAVYPAVAQGESKEILGAGR |
Ga0207664_114971382 | 3300025929 | Agricultural Soil | AAVAAGLWLLRSELPGDLRRRKAAVYPSVAHGESKEILGAGREP |
Ga0207665_101299643 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | WAGGVAGGLWILRSTLLADLRRRKVTAYPHVAEQQAEEISGGVKP |
Ga0207667_108121731 | 3300025949 | Corn Rhizosphere | LAGLWLLRSELPRDLRRRKAAAYPVVAHDESKEILGAGR |
Ga0257154_10211072 | 3300026467 | Soil | LRLLKSQLPNELRPRKKIAYPAVAQREGKEIVDAGTQP |
Ga0257154_10734552 | 3300026467 | Soil | AAVAAGLWLLRSELPGDLRRRKRAAYPEVAHRESKEILGAGTQL |
Ga0179587_110928942 | 3300026557 | Vadose Zone Soil | WLLRSQLPNDLRRRRKATAYPAVAQGESKEIMDAGTQP |
Ga0208238_10097471 | 3300027072 | Forest Soil | WLLKSQLPGDLRRRKQVAYPAVAQNETKEIMGAGTQP |
Ga0209219_10150231 | 3300027565 | Forest Soil | GLWLLRSRLPLDLRRHKATAYPGVAQGESTEIMRTGAQP |
Ga0209167_107221682 | 3300027867 | Surface Soil | TAVGLWLLRSQLPNDLRRRKTAYPAVAEGESKEIMGAGTQP |
Ga0209167_107377552 | 3300027867 | Surface Soil | AAAVAAGLWLLRSELPQDLRRKKGTAVYPSVAQGEAKEILGAGREA |
Ga0209579_105580462 | 3300027869 | Surface Soil | TWAAAAALGLWLLKSQLPGDLRRRRQASYPAVAQGESKEIMSAGREP |
Ga0209067_102081703 | 3300027898 | Watersheds | LWLLKSELPHDLRRRRTAAYPAVAQAESREIMGAGREP |
Ga0209067_103580451 | 3300027898 | Watersheds | AAAAGLWLLKSELPRDLRRRRAAAYPAVAQAESKEILGAGREP |
Ga0209168_105709281 | 3300027986 | Surface Soil | LWLLKSELPRDLRRRKQAAYPAVAEGESKEIMSAGR |
Ga0265346_1029212 | 3300028012 | Plant Litter | AAAVAAGLWLLRSDLPRALRRRKGAVYPAVAQGGPKKY |
Ga0209526_107209962 | 3300028047 | Forest Soil | LLRSDLPGDLRRRKGAVYPAVAQGESKEILGAGTQP |
Ga0302303_103282971 | 3300028776 | Palsa | GLWLLRSELPGDLRRRKATAYPGVAEGQGEEIMGSGTQP |
Ga0308309_103608281 | 3300028906 | Soil | GLWLLKSQLPNDLRRRKATAYPAVAEGESKEILGSGTRP |
Ga0311368_107003741 | 3300029882 | Palsa | AAAVAAGLWLLRSELPGDLRRRKRAAYPVVAQGGAKEILGAGREP |
Ga0247271_1006039 | 3300029903 | Soil | GLWLLRSELPGDLRRRKGAVYPAVAQSGSKEILEAGTQP |
Ga0311341_102977621 | 3300029908 | Bog | ATALGLWLLRSQLPNDLRRRKATAYPAVAQGEGKEILAAGTQP |
Ga0311339_100572804 | 3300029999 | Palsa | AAGLWLLRSELPGDLRRRKVTAYPGVAEGQSKEILGAGTQP |
Ga0311344_113738762 | 3300030020 | Bog | ALGLWLLRSQLPRDLRRRKVTAYPAVAQGEGKEILAAGTQP |
Ga0302179_103290481 | 3300030058 | Palsa | AAGLWLLRSELPGDLRRRKATAYPGVAEGQGEEIMGSGTQP |
Ga0302183_101295101 | 3300030509 | Palsa | LRSQLPSDLRRRKATAYPAVAEGEGKEIMGAGVQP |
Ga0307482_11037991 | 3300030730 | Hardwood Forest Soil | LWLLRSQLPNDLRRRKTVAYPAVAEGESKEILGSGTQP |
Ga0302325_133444301 | 3300031234 | Palsa | SAGLWLTRSQLPGDLRRRKRQAYPAVAQGEAAEILGAGTKP |
Ga0302318_104084861 | 3300031258 | Bog | ALGLWLLRSQLPNDLRRRKATAYPAVAQGEGKEILAAGTQP |
Ga0170818_1035352563 | 3300031474 | Forest Soil | AGLWLLRSELPGDLRRRKGAGYPSVAQGQSKEILGAGTQP |
Ga0302326_100990524 | 3300031525 | Palsa | WAAAVAAGLWLLRSELPGDLRRRKVTAYPGVAEGQSKEILGAGTQP |
Ga0310686_1004448192 | 3300031708 | Soil | LGLVSVTWLAAVAAGLWLLGSELPGDLRRRKGAVYPVVAQGQAKEISDAGRQP |
Ga0310686_1127807812 | 3300031708 | Soil | GLWLLKSQLPNDLRRPKVTAYPAVAEGEGKEILGAGTQP |
Ga0307474_110480882 | 3300031718 | Hardwood Forest Soil | LRLLKSQLPNELRPRKGISYPAVAQSEGKEILDAGTQP |
Ga0307475_102308262 | 3300031754 | Hardwood Forest Soil | VTWAAATAVGLWLLKSQLPNDLRRRKTAYPAVAEGESKEIMGAGTQP |
Ga0307475_114462891 | 3300031754 | Hardwood Forest Soil | TAVGLWLLKSQLPNDLRRRKTAYPAVAEGESKEIMGAGTQP |
Ga0307478_100612645 | 3300031823 | Hardwood Forest Soil | WGAATALGLVLLKSQLPNDLRRRKQSPFPAVAHGETKEILGAGTKP |
Ga0307478_106259673 | 3300031823 | Hardwood Forest Soil | WGAATALGLVLLKSQLPNDLRRRKQSPFPAVAHGETKEILGAGTQP |
Ga0307478_118086861 | 3300031823 | Hardwood Forest Soil | LLRSDLPRDLRRRKGAVYPSVAQGEGKEILSVGTQP |
Ga0318520_108576552 | 3300031897 | Soil | ALVSLTWLAAAAAGLWLLKSELPRDLRRRKQAAYPGVAEGESKEILGAGR |
Ga0307479_107694921 | 3300031962 | Hardwood Forest Soil | GLWLLRSRLPLDLRRRKATAYPGVAQGESTEIIRTGAQP |
Ga0311301_129369972 | 3300032160 | Peatlands Soil | WLLRSELPRDLRRRKGTVYPAVAQGESKEILAAGTQP |
Ga0348332_108756721 | 3300032515 | Plant Litter | AAATAVGLWLLKSQLPNDLRRRKATAYPAVAEGESKEIMGAGTQP |
Ga0348332_146035682 | 3300032515 | Plant Litter | LRSQLPNDLRRRKATAYPGIAEGESKEIMRAGTQP |
Ga0335079_100936291 | 3300032783 | Soil | AAAVAAGLWLLRSELPGDLRRRRGAVYPVVAQGQSKEISDTGTEP |
Ga0335070_113439592 | 3300032829 | Soil | TWAGAVAAGLWLLKSELPAELRQRRKAAYPAVAQAESKEILGSGTQP |
Ga0310810_107231231 | 3300033412 | Soil | TWMAAAMAGLWLMRSELPRDLRRRKAAAYPAVAQDESREILGAGR |
Ga0370515_0154882_844_981 | 3300034163 | Untreated Peat Soil | WAAATALGLWLLKSQLPNDLRRRKTAYPAVAEGESKEIMGAGTQP |
⦗Top⦘ |