NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F045255

Metagenome Family F045255

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F045255
Family Type Metagenome
Number of Sequences 153
Average Sequence Length 44 residues
Representative Sequence MLWACLLFPSLPLDVFARAQTPDDAAHPFVVSSGGHYPRVVA
Number of Associated Samples 130
Number of Associated Scaffolds 153

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 33.99 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 92.81 %
Associated GOLD sequencing projects 117
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.732 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen
(10.457 % of family members)
Environment Ontology (ENVO) Unclassified
(45.098 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(47.712 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 31.43%    β-sheet: 8.57%    Coil/Unstructured: 60.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 153 Family Scaffolds
PF05163DinB 53.59
PF00903Glyoxalase 9.15
PF03846SulA 3.27
PF13560HTH_31 1.96
PF08450SGL 1.31
PF12681Glyoxalase_2 1.31
PF09361Phasin_2 1.31
PF03724META 0.65
PF01381HTH_3 0.65
PF15919HicB_lk_antitox 0.65
PF00154RecA 0.65
PF02653BPD_transp_2 0.65
PF07099DUF1361 0.65
PF01726LexA_DNA_bind 0.65
PF13409GST_N_2 0.65
PF01398JAB 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 153 Family Scaffolds
COG2318Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)Secondary metabolites biosynthesis, transport and catabolism [Q] 53.59
COG5404Cell division inhibitor SulA, prevents FtsZ ring assemblyCell cycle control, cell division, chromosome partitioning [D] 3.27
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 1.31
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 1.31
COG0468RecA/RadA recombinaseReplication, recombination and repair [L] 0.65
COG3187Heat shock protein HslJPosttranslational modification, protein turnover, chaperones [O] 0.65
COG4330Uncharacterized membrane protein, DUF1361 domainFunction unknown [S] 0.65

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.73 %
UnclassifiedrootN/A3.27 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005328|Ga0070676_10934180All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300005335|Ga0070666_11136743All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium581Open in IMG/M
3300005365|Ga0070688_100711874All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria778Open in IMG/M
3300005406|Ga0070703_10297788All Organisms → cellular organisms → Bacteria → Proteobacteria671Open in IMG/M
3300005435|Ga0070714_100852746All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium883Open in IMG/M
3300005457|Ga0070662_101794811Not Available530Open in IMG/M
3300005458|Ga0070681_10239886All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1726Open in IMG/M
3300005543|Ga0070672_101671485All Organisms → cellular organisms → Bacteria → Proteobacteria572Open in IMG/M
3300005549|Ga0070704_101317369All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300005564|Ga0070664_100763106All Organisms → cellular organisms → Bacteria → Proteobacteria903Open in IMG/M
3300005616|Ga0068852_100211880All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1838Open in IMG/M
3300005616|Ga0068852_102383558All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria550Open in IMG/M
3300005617|Ga0068859_100233459All Organisms → cellular organisms → Bacteria → Proteobacteria1928Open in IMG/M
3300005617|Ga0068859_100416628All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1439Open in IMG/M
3300005719|Ga0068861_102197600All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300005764|Ga0066903_108457080All Organisms → cellular organisms → Bacteria → Proteobacteria525Open in IMG/M
3300005840|Ga0068870_10568896All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria766Open in IMG/M
3300005841|Ga0068863_102712980All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300005842|Ga0068858_101373365All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300005843|Ga0068860_102354784All Organisms → cellular organisms → Bacteria → Proteobacteria553Open in IMG/M
3300006047|Ga0075024_100547142All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria614Open in IMG/M
3300006175|Ga0070712_100714371All Organisms → cellular organisms → Bacteria → Proteobacteria855Open in IMG/M
3300006237|Ga0097621_101030722All Organisms → cellular organisms → Bacteria → Proteobacteria770Open in IMG/M
3300006755|Ga0079222_11958124All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300006881|Ga0068865_100858361All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300006904|Ga0075424_100738164All Organisms → cellular organisms → Bacteria → Proteobacteria1051Open in IMG/M
3300009012|Ga0066710_100498605All Organisms → cellular organisms → Bacteria1835Open in IMG/M
3300009081|Ga0105098_10652242All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium554Open in IMG/M
3300009094|Ga0111539_12654568All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium581Open in IMG/M
3300009101|Ga0105247_10586978All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium824Open in IMG/M
3300009101|Ga0105247_11505281All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300009111|Ga0115026_11648470All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300009147|Ga0114129_10637969All Organisms → cellular organisms → Bacteria1376Open in IMG/M
3300009147|Ga0114129_12109088All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300009156|Ga0111538_11021668All Organisms → cellular organisms → Bacteria1046Open in IMG/M
3300009156|Ga0111538_12935645All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300009167|Ga0113563_12730116All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium598Open in IMG/M
3300009177|Ga0105248_11273371All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300009545|Ga0105237_11037953All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium827Open in IMG/M
3300009551|Ga0105238_12726312Not Available531Open in IMG/M
3300010376|Ga0126381_104240237Not Available556Open in IMG/M
3300010400|Ga0134122_11502268All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium693Open in IMG/M
3300010401|Ga0134121_13081347All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300012680|Ga0136612_10449050All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300012989|Ga0164305_10142459All Organisms → cellular organisms → Bacteria → Proteobacteria1614Open in IMG/M
3300012989|Ga0164305_11817128All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium551Open in IMG/M
3300013104|Ga0157370_10656145All Organisms → cellular organisms → Bacteria959Open in IMG/M
3300013296|Ga0157374_11183668All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium785Open in IMG/M
3300013296|Ga0157374_11613355All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium673Open in IMG/M
3300013306|Ga0163162_11674691All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium726Open in IMG/M
3300013306|Ga0163162_12645227All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium577Open in IMG/M
3300013308|Ga0157375_10165853All Organisms → cellular organisms → Bacteria → Proteobacteria2354Open in IMG/M
3300013770|Ga0120123_1125360All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium599Open in IMG/M
3300014296|Ga0075344_1105986All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300014324|Ga0075352_1246622All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300014969|Ga0157376_12260040All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300015259|Ga0180085_1176227All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300015373|Ga0132257_102436533All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300015374|Ga0132255_104226218All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300016270|Ga0182036_10761770All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300016341|Ga0182035_10061664All Organisms → cellular organisms → Bacteria → Proteobacteria2596Open in IMG/M
3300017993|Ga0187823_10315880Not Available547Open in IMG/M
3300018083|Ga0184628_10570758All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300018469|Ga0190270_12674138All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300025899|Ga0207642_10272984All Organisms → cellular organisms → Bacteria → Terrabacteria group969Open in IMG/M
3300025901|Ga0207688_10742500All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300025903|Ga0207680_10327671All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1072Open in IMG/M
3300025907|Ga0207645_10024526All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3908Open in IMG/M
3300025907|Ga0207645_10838688All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300025907|Ga0207645_11169526All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae517Open in IMG/M
3300025914|Ga0207671_10723511All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium791Open in IMG/M
3300025916|Ga0207663_11575198All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300025923|Ga0207681_10266310All Organisms → cellular organisms → Bacteria1343Open in IMG/M
3300025923|Ga0207681_10759728All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300025926|Ga0207659_11202863All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300025928|Ga0207700_11033059All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium735Open in IMG/M
3300025929|Ga0207664_10035954All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3825Open in IMG/M
3300025930|Ga0207701_10090907All Organisms → cellular organisms → Bacteria → Proteobacteria2746Open in IMG/M
3300025931|Ga0207644_11613420All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300025932|Ga0207690_10365882All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1143Open in IMG/M
3300025933|Ga0207706_10840211All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300025938|Ga0207704_11242194All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300025941|Ga0207711_12035663All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300025945|Ga0207679_10175347All Organisms → cellular organisms → Bacteria1769Open in IMG/M
3300025949|Ga0207667_11684855All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300025960|Ga0207651_10459592All Organisms → cellular organisms → Bacteria → Proteobacteria1094Open in IMG/M
3300025986|Ga0207658_11861671All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium548Open in IMG/M
3300026023|Ga0207677_10253446All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1431Open in IMG/M
3300026035|Ga0207703_10062496All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3050Open in IMG/M
3300026061|Ga0208541_1004342Not Available1221Open in IMG/M
3300026067|Ga0207678_10302614All Organisms → cellular organisms → Bacteria → Proteobacteria1374Open in IMG/M
3300026088|Ga0207641_11765434All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300026121|Ga0207683_10704498All Organisms → cellular organisms → Bacteria936Open in IMG/M
3300026142|Ga0207698_11632147All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium660Open in IMG/M
3300027787|Ga0209074_10511299All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300027885|Ga0209450_10593861All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300027890|Ga0209496_10653480All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium572Open in IMG/M
3300027899|Ga0209668_10246230All Organisms → cellular organisms → Bacteria1130Open in IMG/M
3300027900|Ga0209253_10232435All Organisms → cellular organisms → Bacteria1459Open in IMG/M
3300027900|Ga0209253_10793393All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300027902|Ga0209048_10435926All Organisms → cellular organisms → Bacteria894Open in IMG/M
3300028381|Ga0268264_11754122All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300028764|Ga0302260_1065805All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300028774|Ga0302208_10100027All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300028802|Ga0307503_10322660All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300028856|Ga0302295_1114417All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300028861|Ga0302259_1005163All Organisms → cellular organisms → Bacteria2740Open in IMG/M
3300028861|Ga0302259_1045456All Organisms → cellular organisms → Bacteria1033Open in IMG/M
3300028868|Ga0302163_10094145All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300028869|Ga0302263_10056526All Organisms → cellular organisms → Bacteria1548Open in IMG/M
3300029987|Ga0311334_11287353All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300030943|Ga0311366_10656025All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria912Open in IMG/M
3300030943|Ga0311366_11332524All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300031548|Ga0307408_100027604All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3914Open in IMG/M
3300031561|Ga0318528_10508438All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300031707|Ga0315291_11634774All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium500Open in IMG/M
3300031722|Ga0311351_10425332All Organisms → cellular organisms → Bacteria1006Open in IMG/M
3300031726|Ga0302321_100290620All Organisms → cellular organisms → Bacteria1745Open in IMG/M
3300031726|Ga0302321_101298524All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300031726|Ga0302321_102898177All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300031797|Ga0318550_10235917All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300031873|Ga0315297_10118747All Organisms → cellular organisms → Bacteria → Proteobacteria2117Open in IMG/M
3300031873|Ga0315297_10769816All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium804Open in IMG/M
3300031892|Ga0310893_10154312All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium895Open in IMG/M
3300031903|Ga0307407_10525859All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300031918|Ga0311367_10013536All Organisms → cellular organisms → Bacteria → Proteobacteria8929Open in IMG/M
3300031918|Ga0311367_11954242All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300031938|Ga0308175_101089303All Organisms → cellular organisms → Bacteria → Proteobacteria885Open in IMG/M
3300031940|Ga0310901_10372828All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium616Open in IMG/M
3300031995|Ga0307409_102795967All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300031997|Ga0315278_10021442All Organisms → cellular organisms → Bacteria → Proteobacteria6122Open in IMG/M
3300031997|Ga0315278_11324724All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300031997|Ga0315278_11593887All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300032000|Ga0310903_10684568All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300032018|Ga0315272_10302654All Organisms → cellular organisms → Bacteria → Proteobacteria777Open in IMG/M
3300032035|Ga0310911_10843111All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300032053|Ga0315284_10814800All Organisms → cellular organisms → Bacteria1078Open in IMG/M
3300032118|Ga0315277_10358465All Organisms → cellular organisms → Bacteria1512Open in IMG/M
3300032256|Ga0315271_10565503All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300032256|Ga0315271_11338424All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300032256|Ga0315271_11357828All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300032397|Ga0315287_11494303All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300032401|Ga0315275_11242557All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium809Open in IMG/M
3300032516|Ga0315273_10930907All Organisms → cellular organisms → Bacteria1119Open in IMG/M
3300033413|Ga0316603_10642851All Organisms → cellular organisms → Bacteria987Open in IMG/M
3300033433|Ga0326726_11524406All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300033482|Ga0316627_101893698All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium616Open in IMG/M
3300033487|Ga0316630_11739093All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300033488|Ga0316621_11069870All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300033488|Ga0316621_11401694All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300033513|Ga0316628_100812506All Organisms → cellular organisms → Bacteria → Proteobacteria1233Open in IMG/M
3300033521|Ga0316616_100446013All Organisms → cellular organisms → Bacteria1457Open in IMG/M
3300033557|Ga0316617_100815009All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium895Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen10.46%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment9.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere5.88%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.23%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere4.58%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere3.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.92%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment3.27%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.27%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.61%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.96%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.96%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.96%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland1.31%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.31%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.31%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.31%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.31%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.31%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.65%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.65%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.65%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.65%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.65%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.65%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.65%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.65%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.65%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.65%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.65%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.65%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.65%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012680Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06)EnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013770Permafrost microbial communities from Nunavut, Canada - A15_5cm_18MEnvironmentalOpen in IMG/M
3300014296Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300014324Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1EnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015259Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10DEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026061Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300027890Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028764Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E1_4EnvironmentalOpen in IMG/M
3300028774Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_3EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028856Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_4EnvironmentalOpen in IMG/M
3300028861Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_4EnvironmentalOpen in IMG/M
3300028868Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_3EnvironmentalOpen in IMG/M
3300028869Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4EnvironmentalOpen in IMG/M
3300029987I_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030943III_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031722II_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032018Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middleEnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032118Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15EnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033413Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCTEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033487Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_AEnvironmentalOpen in IMG/M
3300033488Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_CEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070676_1093418013300005328Miscanthus RhizosphereMLWICLLLPSLPLDVYARAQAPADSAKAFAVTTGGHYPRIVVGNA
Ga0070666_1113674313300005335Switchgrass RhizosphereMLWACLLFPSLPLDVFVRALTPAEAARPLVITNGGHYPHVVAAN
Ga0070688_10071187413300005365Switchgrass RhizosphereMLWACLLLPSLPLDVFARGHSPADAAKPFAVTSGGRVPRIVGA
Ga0070703_1029778813300005406Corn, Switchgrass And Miscanthus RhizosphereMLWACILLPSLPLDVFARAAPDDAQQPFVVASGGHYPRVV
Ga0070714_10085274623300005435Agricultural SoilMLWACLLLPSLPLDVFARALAPDSIGRPFVVASGGHYPRVVAANAGA
Ga0070662_10179481123300005457Corn RhizosphereMPLWVCLRMAALPLDVFARAVTPDDGARPFVVSSGGHYPRVVDANARARAAG
Ga0070681_1023988633300005458Corn RhizosphereMLWIALWLPSLPLDVFARGLDPRANAGPFAVTSGGHYPQV
Ga0070672_10167148513300005543Miscanthus RhizosphereMLWACLLLPSLPLDVFARAAAPDDTQHPFVVASGGHYPRV
Ga0070704_10131736913300005549Corn, Switchgrass And Miscanthus RhizosphereMLWACLLFPSLPLDVFARAIAPDDTRPFVVASGGHYPRVV
Ga0070664_10076310613300005564Corn RhizosphereMLWTCVLLPSLALDVFARAAPDDSQRPFVVASGGHYPRVVAANGCANAAGIR
Ga0068852_10021188013300005616Corn RhizosphereMTLWACLLFPTLPLDVFARAQSPDDAHRPFVVGSGGHY
Ga0068852_10238355813300005616Corn RhizosphereMLWACLLFPSLPLDVFARAIAPDDARPFVVASGGHYPRVVAANAAAR
Ga0068859_10023345923300005617Switchgrass RhizosphereMIWVSVLLPSLPLDVFARMHEPENVERPFVVASGGHYPRVVAGNAAARAAGIRSGQLISA
Ga0068859_10041662813300005617Switchgrass RhizosphereMVAKGALWACLLFPSLPLDVFARAQSPDDALRPFVVGSGGHYPRV
Ga0068861_10219760023300005719Switchgrass RhizosphereMNHALWACLLFPSLPLDVFARAQSSSDAQRPFVVGSGGH
Ga0066903_10845708023300005764Tropical Forest SoilMLWACLLLPSLPLDVFTRSLPPVDAARPLAVTSGGHYPRIVAAN
Ga0068870_1056889613300005840Miscanthus RhizosphereMLWVCILLPSLPLDVFARAHSPADAVKPFAVTSGGRTPR
Ga0068863_10271298013300005841Switchgrass RhizosphereMLWTCLSLPSLSLDVFVRGQTPADAARPFAVTTGGHYPRV
Ga0068858_10137336523300005842Switchgrass RhizosphereMTLWACLLFPTLPLDVFARAQSPDDAHRPFVVGSGGHYP
Ga0068860_10235478413300005843Switchgrass RhizosphereMLWACLLLPALPLDVFARGWSADDAMRRFVVASGGNGPRVVAMNAAA
Ga0075024_10054714213300006047WatershedsMLWICLFLPALPLDVFARAQDPAGAARPFAVATGGHYPRIVAANAAANEAGIRTAHL
Ga0070712_10071437113300006175Corn, Switchgrass And Miscanthus RhizosphereMLWACLIFPSLPLDVFARAQSPDDAAHPFVVSSGGHYPRVVAANAAAHEAGIR
Ga0097621_10103072213300006237Miscanthus RhizosphereMLWTCLLLPSLPVDVFTRGRSPADAAKPFAVTTGGRT
Ga0079222_1195812423300006755Agricultural SoilMLWASLYFPALALDVYARARSAADAAQPFAVASGGNA
Ga0068865_10085836113300006881Miscanthus RhizosphereVIEKQVSLWACLLFPSLPLDVFTRAGSPEDAARPLVIGSGGHY
Ga0075424_10073816413300006904Populus RhizosphereMSRGMLWACLLLPSLSLDVFARAAPPNARAFVVASGGHHPRVVAAN
Ga0066710_10049860543300009012Grasslands SoilMLWACLLLPSLPLDVFARSLSTPDAARPFAVTTGGHYPRIVAANAAAQIVASRGD
Ga0105098_1065224213300009081Freshwater SedimentMRWIALLFPSLPLDVFERALRPDDARAPLVVHGDGRAPRVVAANA
Ga0111539_1265456813300009094Populus RhizosphereMLWACLLFPSLPLDVFARALTPAEAAHPFVVTSGGHYPCVVAANAAARAAGIRR
Ga0105247_1058697813300009101Switchgrass RhizosphereMLWACILLPSLPLDVFARAAPDDAQRPFVVASGGHYPRVVAANGCAR
Ga0105247_1150528123300009101Switchgrass RhizosphereMLWACLIFPSLPLDVFARSQAPADAARPFAVTTGGHYPHIIAANAAALDAA
Ga0115026_1164847013300009111WetlandMLWTCLIFPSLPLDVFARAAAPADAARSFVVGSGGHYPRVVAADAV
Ga0114129_1063796913300009147Populus RhizosphereMLWTCLLFPSLPLDVFARAIAPDDARPFVVASGGHYPRVVV
Ga0114129_1210908813300009147Populus RhizosphereMLWVCIQLPSLPLDVFARAIAPEDAARPFVVGSGG
Ga0111538_1102166813300009156Populus RhizosphereVNRMLWACLLLPALPLDVFARGWSADDAMRRFVVASGGNGPRVVAMNAAARTA
Ga0111538_1293564513300009156Populus RhizosphereMLWVCVFLPSLPLEVFARAHSPADAVKPFAVTSGGRRPRIVDANAV
Ga0113563_1273011613300009167Freshwater WetlandsMLWACLHLPSLPLDVFARAQCSDAPIRPFAVTSGGHVPRIVAANAGARDA
Ga0105248_1127337123300009177Switchgrass RhizosphereMLWICLLLPSLPLDVYARAQAPADSAKPFAVTTGGHYPRIVVGNAA
Ga0105237_1103795313300009545Corn RhizosphereMLWACLLLPSLPLDVFARALAPDSIGRPFVVASGGH
Ga0105238_1272631223300009551Corn RhizosphereMLWACLLLPSLPLDVFARAQEADTPFVVTTGGHHPRIVAASDAARIA
Ga0126381_10424023723300010376Tropical Forest SoilMLWACLLLPSLPLDVFARAQDADTPFVVATGGHHPRVVEASDAARVSGIRREQPI
Ga0134122_1150226823300010400Terrestrial SoilMLWACILLPSLPLDVFARAAPDDAQQPFVVASGGH
Ga0134121_1308134713300010401Terrestrial SoilMLWACLLLPSLPLDVFARGHSPADAAKPFAVTSGGRVPRIVGANAVA
Ga0136612_1044905013300012680Polar Desert SandMLWACLLFPTLPLDVFARAQSPEQGTQPFAVVTAGHY
Ga0164305_1014245933300012989SoilMLWICVLMPSLPLDVFARALAPHDAARPFVVTSGGHYPRV
Ga0164305_1181712813300012989SoilMLWACLLLPSLPLDVFARAAAPDGAQNPFVVASGGHY
Ga0157370_1065614533300013104Corn RhizosphereMTLWACLLFPSLPLDVFARAQSPDDVHRPFVVASGGHYPRVV
Ga0157374_1118366823300013296Miscanthus RhizosphereMLWTCVLLPSLALDVFARAAPDDTQRPFVVASGGHYPRVV
Ga0157374_1161335513300013296Miscanthus RhizosphereMIWVSVLLPSLPLDVFARMHEPENVERPFVVASGGHYPRVVAGNAAARAAGI
Ga0163162_1167469113300013306Switchgrass RhizosphereMIWVSVLLPYLPLDVFARMHEPENVERPFVVASGGHYPRVVAGNAAARAAG
Ga0163162_1264522713300013306Switchgrass RhizosphereMIWVSVLLPSLPLDVFARMHEPENVERPFVVASGGHYPRVVAGNAAARAAG
Ga0157375_1016585353300013308Miscanthus RhizosphereMTLWACLLFPTLPLDVFARAQSPDDAHRPFVVGSGGHYPRVVAA
Ga0120123_112536023300013770PermafrostMLWACLLLPSLPLDVFARATAAEDAARPFVVASGGHYPRVIAANAS
Ga0075344_110598623300014296Natural And Restored WetlandsMLWCALLLPSLPLDVFARAWTGGDASRRFVVASGGNA
Ga0075352_124662213300014324Natural And Restored WetlandsMLWACLILPSLPLDVFARAQGPGAQARPFAVATGGH
Ga0157376_1226004013300014969Miscanthus RhizosphereMTLWACLLFPTLPLDVFARAQSPDDAHRPFVVGSGGHYPRVVAAN
Ga0180085_117622723300015259SoilMLWACLLLPSLPLDVYARALSPTDAARPFAVTTGGHYPRIVV
Ga0132257_10243653313300015373Arabidopsis RhizosphereMLWIAFHFPSLPLDVFARALAPGDAARAFAVTTGGHYP
Ga0132255_10422621813300015374Arabidopsis RhizosphereMSRGMLWACLLLPSLSLDVFARAAPPNARAFVVASGGPHPRGV
Ga0182036_1076177023300016270SoilMMLWACLLLPSLALDVFARALPPADAAKPFAIATGGRTPRIVGANVG
Ga0182035_1006166453300016341SoilMWSALLFPSLALDVFARAFTGDDHGRPFVVTSGGHYPRVVVANAAARGA
Ga0187823_1031588013300017993Freshwater SedimentMPWVCVLLPSLPLDVFERMHAGGNMAGPFVVSSGGHYPRVVAANDAARDAGIRRDQLVS
Ga0184628_1057075813300018083Groundwater SedimentMLWACLFLPALPVDIFTRGRSPADDAKPFAVTTGGRTPRII
Ga0190270_1267413823300018469SoilMKHALWACLLFPSLPLDVFARAQSSSDAHRPFAVGSGGHYPRVV
Ga0207642_1027298423300025899Miscanthus RhizosphereACLLFPSLPLDVFARGWHADAAARPFAVASGGHYPQVVAANANGGCTSL
Ga0207688_1074250013300025901Corn, Switchgrass And Miscanthus RhizosphereMNHALWACLLFPSLPLDVFARAQSSSDAQRPFVVGSGGHYPRVVAANRVARDAGIRDEQL
Ga0207680_1032767133300025903Switchgrass RhizosphereMTLWACLLFPTLPLDAFARAQSPDDAHRPFVVGSGGHYPRV
Ga0207645_1002452613300025907Miscanthus RhizosphereMLWACLLLPSLPLDVFARGHSPADAAKPFAVTSGGRAPRIVGAN
Ga0207645_1083868813300025907Miscanthus RhizosphereMLWVCILLPSLPLDVFARAHSPADAVKPFAVTSGGRTPRIVDANAVA
Ga0207645_1116952613300025907Miscanthus RhizosphereMLWTCLLFPSLPLDVFARGWHADAAARPFAVASGGHYPHVVAANTAARAAG
Ga0207671_1072351113300025914Corn RhizosphereMLWACLLLPSLPLDVFARALAPDSIGRPFVVASGGHYPRVVA
Ga0207663_1157519813300025916Corn, Switchgrass And Miscanthus RhizosphereMSLWACLDIPTLAVDVFARAWSADDHARPFVVSSGGHYPRVVGMNDAAARAG
Ga0207681_1026631013300025923Switchgrass RhizosphereMLWACILLPSLPLDVFARAAPDDAQRPFVVASGGHYPRVVAANGCARA
Ga0207681_1075972823300025923Switchgrass RhizosphereMLWTCLLFPSLPLDVFARGWHADAAARPFAVASGG
Ga0207659_1120286313300025926Miscanthus RhizosphereMTLWACLLFPTLPLDVFARAQSPDDAHRPFVVGSGGHYPRVVAANRAAR
Ga0207700_1103305913300025928Corn, Switchgrass And Miscanthus RhizosphereMLWACLLLPSLPLDVFARALAPDSIGRPFVVASGGHYPRVVAANAGARAAGIHRDQL
Ga0207664_1003595463300025929Agricultural SoilMLWACLLLPSLPLDVFARALAPDSIGRPFVVASGGHYPRVVAANAGARAAGI
Ga0207701_1009090713300025930Corn, Switchgrass And Miscanthus RhizosphereMNHALWACLLFPSLPLDVFARAQSSSDAQRPFVVGSGGHYPRVVAANRVARDAGIRDEQLIAG
Ga0207644_1161342023300025931Switchgrass RhizosphereMLWACLLLPSLPLDVFARAAAPDEAPHPFVVASGGHYPHVVAANASARAAGIR
Ga0207690_1036588213300025932Corn RhizosphereMLWTCLLLPSLSRDVFARASAAGDATTPFVVTSGGHHPRVVAAN
Ga0207706_1084021113300025933Corn RhizosphereMPLWVCLRMAALPLDVFARAVTPDDGARPFVVSSGGHYPRVVDANARARAAGI
Ga0207704_1124219413300025938Miscanthus RhizosphereVIEKQVSLWACLLFPSLPLDVFTRAGSPEDAARPLVIGSGGHYPRVVAANAAAR
Ga0207711_1203566313300025941Switchgrass RhizosphereMLWSCLLLPSLPLDVYTRAQSPADAAKPFAVATGGRTP
Ga0207679_1017534743300025945Corn RhizosphereMLWTCVLLPTLALDVFARAAPDDTQRPFVVASGGH
Ga0207667_1168485523300025949Corn RhizosphereMLWACLLLPSLSLDVFARASAAADAARPFVVASGGH
Ga0207651_1045959233300025960Switchgrass RhizosphereMLWACLLLPSLPLDVFARAAAPDDTQHPFVVASGGHYPRVV
Ga0207658_1186167123300025986Switchgrass RhizosphereMLWACILLPSLPLDVFARAAPDDAQRPFVVASGGHYPRVVAAHG
Ga0207677_1025344633300026023Miscanthus RhizosphereMLWVCILLPSLPLDVFARAHSPADAVKPFAVTSGGRTPRIVDANAVACD
Ga0207703_1006249663300026035Switchgrass RhizosphereMLWACLLFPSLPLDVFARAIAPDDARPFVVASGGHYPRVVAA
Ga0208541_100434213300026061Natural And Restored WetlandsMLWACLLLPSLPLDVFARAASPADAAKPFAVGSGGRTPR
Ga0207678_1030261433300026067Corn RhizosphereMLWTCLLLPSLSRDVFARASAAGDATTPFVVTSGGH
Ga0207641_1176543423300026088Switchgrass RhizosphereMLWACLLLPSLPLDVFARGHSPADAAKPFAVTTGGR
Ga0207683_1070449813300026121Miscanthus RhizosphereMTLWACLLFPTLPLDVFARAQSPDDAHRPFVIGSGGHYP
Ga0207698_1163214713300026142Corn RhizosphereMLWACILLPSLPLDVFARAAPDDAQRPFVVATGGHYPRVVAANGCAR
Ga0209074_1051129913300027787Agricultural SoilMPLWVCLRMAALPLDVFARAVTPDDGARPFVVSSGGHYPRVVDAN
Ga0209450_1059386133300027885Freshwater Lake SedimentMLWTCLIFPSLPLDVFARAAAPADATRPFVVGSGG
Ga0209496_1065348023300027890WetlandMLWACLLLPRLPLDVFARAAPPGDDAAARPFAVTTGGHHPRV
Ga0209668_1024623013300027899Freshwater Lake SedimentMLWTCLIFPSLPLDVFARAAAPADATRPFVVGSGGHYPRVVVANAVARDAG
Ga0209253_1023243543300027900Freshwater Lake SedimentMLWTCLIFPSLPLDVFARAAAPADATRPFVVGSGGHYP
Ga0209253_1079339323300027900Freshwater Lake SedimentMLWVCLLLPSLPLDVFARAQSAADSARPFAVASGG
Ga0209048_1043592623300027902Freshwater Lake SedimentMLWACLIFPSLPLDVFVRAQAPEGVAHPFVVSSGGHYPRVVAANAAARATGI
Ga0268264_1175412213300028381Switchgrass RhizosphereMLWACLLLPALPLDVFARGWSADDAMRRFVVASGGNGPRVVAMNAAARKAGIREGQPIS
Ga0302260_106580513300028764FenMLWACLIFPSLPLDVFARAQSPDGAAHPFVVSSGGHYPRVV
Ga0302208_1010002713300028774FenMLWACLIFPSLPLDVFARAQSPDEAARPFVVSSGGHYPRVV
Ga0307503_1032266013300028802SoilMLWACLLLPSLPLDVFARALSPADAAQPFAVTTGGHYPRIVAANAAAC
Ga0302295_111441723300028856FenMLWACLIFPSLPLDVFARAQAPDEAAHPFVVSSGGHY
Ga0302259_100516353300028861FenMLWACLIFPSLPLDVFARAQAPDEAAHPFVVSSGG
Ga0302259_104545613300028861FenVAPIFPTSMLWACLIFPSLPLDVFARMQSPEDAAQPFVVSSGGHYPRVIAPNAAARATGIRAGQLIS
Ga0302163_1009414513300028868FenMLWACLIFPSLPLDVFARAQSPDEAARPFVVSSGGHYPRVVA
Ga0302263_1005652633300028869FenMLWACLIFPSLPLDVFARAQAPDEAAHPFVVSSGGHYPCVVAA
Ga0311334_1128735313300029987FenMLWACLLFPSLPLDVFARALSPADAAHPFVVSSGGHYPRVVAANAAARDT
Ga0311366_1065602513300030943FenMLWACLLFPSLPLDVFVRAQSPDEAAHPFVVGSGGHYPRVVAANAAARETG
Ga0311366_1133252423300030943FenMLWACLLFPSLPLDVFARALSPADAAHPFVVSSGGHYPRV
Ga0307408_10002760413300031548RhizosphereMLWACLLFPSLPLDVFARALTPAEAAHPFVVTSGGHYPCVVAANAA
Ga0318528_1050843823300031561SoilMLWACLLLPSLALDVFARALPPADAAKPFAIATGG
Ga0315291_1163477423300031707SedimentMLWACLLLPSLPLDVFARAASPADAAKPFAVGSGGRAPRIVSAN
Ga0311351_1042533213300031722FenMLWACLIFPSLPLDVFARAQSPDEAARPFVVSSGGHYPRVVAANVA
Ga0302321_10029062013300031726FenMLWACLLFPSLPLDVFVRAQSPDEAAHPFVVGSGGHYPR
Ga0302321_10129852433300031726FenMLWACLLLPSLPLDVFARSLSPADAARPFAVASGGHY
Ga0302321_10289817723300031726FenMLWACLIFPSLPLDVFARAQSPEEAAHPFVVSSGGHYPRVVAANAAARETGI
Ga0318550_1023591723300031797SoilMLWACLLLPSLALDVFARALPPADAAKPFAIATGGRTPRIV
Ga0315297_1011874753300031873SedimentMNATMLWACLIFPSLPLDVFARAQSPDDAAHPFVVSSGGHYPRVVAANAAARE
Ga0315297_1076981623300031873SedimentMLWACLLLPSLPLDVFARAASPADAAKPFAVDSGGRTPR
Ga0310893_1015431223300031892SoilMLWACILLPSLPLDVFARAAPDDAQRPFVVASGGHYPRVVAAN
Ga0307407_1052585923300031903RhizosphereMTLWACMLFPSLSLDVFARAQSPDDAHRPFVVGSGGHYPRVVAANGAARNAGIRDDQLISGALA
Ga0311367_10013536173300031918FenMLWACLIFPSLPLEVFARAQAPEDAAHPFVVSSGGH
Ga0311367_1195424223300031918FenMLWACLLFPSLPLDVFARAQAPDDAARPFVVGSGGHYPRVVAANMAARAA
Ga0308175_10108930333300031938SoilMLWACLRLPLLSLDVFSRATGASADAPFVVTSGGHYPRVVAANAAAR
Ga0310901_1037282813300031940SoilMLWACLLFPSLPLDVFARALTPAKAAHPLVVTSGGHYPRVV
Ga0307409_10279596723300031995RhizosphereMTTLWLCLRVPTLPVDVFARAWSAADAARPFVVASGGHYPRVVGTNAA
Ga0315278_1002144213300031997SedimentMLWTCLLLPSLPLDVFARAQTPADAARPFAVTTGGHYPRIVAANAAASDAG
Ga0315278_1132472423300031997SedimentMLWTCLLLPSLPLDVFARAQTPADAARPFAVTTGGHYPRIVAANA
Ga0315278_1159388713300031997SedimentMLWACLLFPSLPLDVFARAQTPDDAAHPFVVSSGGHYPRVIAANA
Ga0310903_1068456823300032000SoilMLWASLFLPSLPVDVFARGHSPADAAKPFAVTTGGRTPRI
Ga0315272_1030265413300032018SedimentMLWACLLFPSLPLDVFARAQSADEAAHPFAVSSGGHYPRVVAANAAARE
Ga0310911_1084311113300032035SoilMWSALLFPSLALDVFARAFTGDDHGRPFVVTSGGHYPRVVVANAAARGAG
Ga0315284_1081480013300032053SedimentMLWARLLLPSLPLDVFARAASPAEAAKPLAVGSGGRTPRIVSANTGARD
Ga0315277_1035846533300032118SedimentMLWACLLLPSLPLDIFARAQSPADAAKPFAVATGGR
Ga0315271_1056550313300032256SedimentMLWACLLLPSLPLDVFARATSPADAAKPFAVGSGGRTPRIVSANAGARDAGIH
Ga0315271_1133842423300032256SedimentMLWACLLFPSLPLDVFARAQTPDDAAHPFVVSSGGHYPRVVA
Ga0315271_1135782813300032256SedimentMLWACLLLPSLPLDVFARAASPADAAKPFAVGSGGR
Ga0315287_1149430313300032397SedimentMLWTCLLLPSLPLDVFARAQTPADAARPFAVTTGG
Ga0315275_1124255713300032401SedimentMLWACLLLPSLPLDVFARAASPAEALMPFAVGSGGRTP
Ga0315273_1093090713300032516SedimentMLWACLLFPSLPLDVFARAQTPDDAAHPFVVSSGGHYPHVV
Ga0316603_1064285113300033413SoilMLWTCLIFPSLPLDVFARAAAPADATRPFVVGSGGHYPRVV
Ga0326726_1152440613300033433Peat SoilMLWICLLFPSLPLDVFARARAPDDDAHPFVVSSGGHYP
Ga0316627_10189369813300033482SoilMLWACLHLPSLPLDVFTRAQCSEAPIRPFAVTSGGHVPR
Ga0316630_1173909323300033487SoilMLWACLILPSLPLDVYARAQGPEAQARPFAVTTGGHYPRIVAANAAAR
Ga0316621_1106987023300033488SoilMLWACLILPSLPLDVFVRAQAPADAGTAFAVATGGHYPRIVIANAAALQAGI
Ga0316621_1140169413300033488SoilMRNRPTKSQDPMLWTCLLLPSLPLEVFARAQAPTDAMRPFAVTAGGHYARVVVAN
Ga0316628_10081250633300033513SoilMLWACLLLPSLSLDVFTRAVAPGSHERPLVVASGGHY
Ga0316616_10044601313300033521SoilMLWTCLLLPALPLEVFTRAQAPADAARPFAVTAGGHPP
Ga0316617_10081500913300033557SoilMLWACLHLPSLPLDVFARAQCSDVPIRPFAVTSGG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.