| Basic Information | |
|---|---|
| Family ID | F045188 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 153 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MGSVGIVLTVLVVALLWVAAVAFGRDSREDGDRRSGSDHRDRPLRL |
| Number of Associated Samples | 131 |
| Number of Associated Scaffolds | 153 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 78.43 % |
| % of genes near scaffold ends (potentially truncated) | 28.10 % |
| % of genes from short scaffolds (< 2000 bps) | 84.97 % |
| Associated GOLD sequencing projects | 125 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.660 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil (12.418 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.144 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) (29.412 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 45.95% β-sheet: 0.00% Coil/Unstructured: 54.05% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 153 Family Scaffolds |
|---|---|---|
| PF03575 | Peptidase_S51 | 15.69 |
| PF11706 | zf-CGNR | 15.03 |
| PF01769 | MgtE | 1.31 |
| PF07336 | ABATE | 1.31 |
| PF01548 | DEDD_Tnp_IS110 | 0.65 |
| PF01544 | CorA | 0.65 |
| PF01435 | Peptidase_M48 | 0.65 |
| PF08445 | FR47 | 0.65 |
| PF02786 | CPSase_L_D2 | 0.65 |
| PF08245 | Mur_ligase_M | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 153 Family Scaffolds |
|---|---|---|---|
| COG1824 | Permease, similar to cation transporters | Inorganic ion transport and metabolism [P] | 1.31 |
| COG2239 | Mg/Co/Ni transporter MgtE (contains CBS domain) | Inorganic ion transport and metabolism [P] | 1.31 |
| COG5516 | Uncharacterized conserved protein containing a Zn-ribbon-like motif, possibly RNA-binding | General function prediction only [R] | 1.31 |
| COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 0.65 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.66 % |
| Unclassified | root | N/A | 16.34 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090015|GPICI_8738923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1161 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101601947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2595 | Open in IMG/M |
| 3300000550|F24TB_10311970 | Not Available | 594 | Open in IMG/M |
| 3300000891|JGI10214J12806_10171807 | Not Available | 507 | Open in IMG/M |
| 3300000956|JGI10216J12902_119830236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 596 | Open in IMG/M |
| 3300001431|F14TB_100460721 | Not Available | 863 | Open in IMG/M |
| 3300001976|JGI24752J21851_1007265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1445 | Open in IMG/M |
| 3300004114|Ga0062593_100836749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 921 | Open in IMG/M |
| 3300004156|Ga0062589_101136239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 742 | Open in IMG/M |
| 3300004479|Ga0062595_101753442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 587 | Open in IMG/M |
| 3300004643|Ga0062591_101447651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 684 | Open in IMG/M |
| 3300005093|Ga0062594_100316253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1200 | Open in IMG/M |
| 3300005093|Ga0062594_102061806 | Not Available | 612 | Open in IMG/M |
| 3300005168|Ga0066809_10001221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3864 | Open in IMG/M |
| 3300005329|Ga0070683_101916542 | Not Available | 569 | Open in IMG/M |
| 3300005331|Ga0070670_100707990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 906 | Open in IMG/M |
| 3300005336|Ga0070680_101799858 | Not Available | 531 | Open in IMG/M |
| 3300005339|Ga0070660_101440049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 585 | Open in IMG/M |
| 3300005444|Ga0070694_100072025 | All Organisms → cellular organisms → Bacteria | 2383 | Open in IMG/M |
| 3300005518|Ga0070699_100997252 | Not Available | 768 | Open in IMG/M |
| 3300005546|Ga0070696_100836140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 760 | Open in IMG/M |
| 3300005577|Ga0068857_100304539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1469 | Open in IMG/M |
| 3300005615|Ga0070702_100898564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 693 | Open in IMG/M |
| 3300005937|Ga0081455_10031365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4810 | Open in IMG/M |
| 3300006049|Ga0075417_10079355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1463 | Open in IMG/M |
| 3300006196|Ga0075422_10129135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 994 | Open in IMG/M |
| 3300006576|Ga0074047_11913314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 913 | Open in IMG/M |
| 3300006580|Ga0074049_13065022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 928 | Open in IMG/M |
| 3300006845|Ga0075421_101057578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 915 | Open in IMG/M |
| 3300009081|Ga0105098_10072978 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
| 3300009094|Ga0111539_10465211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1472 | Open in IMG/M |
| 3300009147|Ga0114129_12330864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 642 | Open in IMG/M |
| 3300009156|Ga0111538_10054096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5135 | Open in IMG/M |
| 3300009157|Ga0105092_10422047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 760 | Open in IMG/M |
| 3300009168|Ga0105104_10584273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 634 | Open in IMG/M |
| 3300009553|Ga0105249_10251813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1751 | Open in IMG/M |
| 3300009553|Ga0105249_11659186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 712 | Open in IMG/M |
| 3300009789|Ga0126307_10003787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10416 | Open in IMG/M |
| 3300009799|Ga0105075_1049633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
| 3300009801|Ga0105056_1009362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1078 | Open in IMG/M |
| 3300009809|Ga0105089_1044067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 675 | Open in IMG/M |
| 3300009811|Ga0105084_1009446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1474 | Open in IMG/M |
| 3300009811|Ga0105084_1028687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 943 | Open in IMG/M |
| 3300009811|Ga0105084_1067151 | Not Available | 649 | Open in IMG/M |
| 3300009815|Ga0105070_1009562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1586 | Open in IMG/M |
| 3300009817|Ga0105062_1005836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1799 | Open in IMG/M |
| 3300009822|Ga0105066_1045629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 913 | Open in IMG/M |
| 3300009837|Ga0105058_1124997 | Not Available | 614 | Open in IMG/M |
| 3300009837|Ga0105058_1193707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 506 | Open in IMG/M |
| 3300009840|Ga0126313_10417096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1067 | Open in IMG/M |
| 3300010029|Ga0105074_1057162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 695 | Open in IMG/M |
| 3300010038|Ga0126315_10040590 | All Organisms → cellular organisms → Bacteria | 2478 | Open in IMG/M |
| 3300010041|Ga0126312_10049954 | All Organisms → cellular organisms → Bacteria | 2801 | Open in IMG/M |
| 3300010041|Ga0126312_10472704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 895 | Open in IMG/M |
| 3300010166|Ga0126306_11026781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 673 | Open in IMG/M |
| 3300010400|Ga0134122_10496359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1103 | Open in IMG/M |
| 3300010403|Ga0134123_12846992 | Not Available | 552 | Open in IMG/M |
| 3300011412|Ga0137424_1068753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 685 | Open in IMG/M |
| 3300011439|Ga0137432_1056184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1190 | Open in IMG/M |
| 3300012022|Ga0120191_10084030 | Not Available | 627 | Open in IMG/M |
| 3300012204|Ga0137374_10099627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2745 | Open in IMG/M |
| 3300012353|Ga0137367_10020942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5113 | Open in IMG/M |
| 3300012355|Ga0137369_10212107 | All Organisms → cellular organisms → Bacteria | 1489 | Open in IMG/M |
| 3300012355|Ga0137369_10277317 | Not Available | 1254 | Open in IMG/M |
| 3300012358|Ga0137368_10599347 | Not Available | 700 | Open in IMG/M |
| 3300012360|Ga0137375_11374912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 527 | Open in IMG/M |
| 3300012532|Ga0137373_10299742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1278 | Open in IMG/M |
| 3300012672|Ga0137317_1017845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 659 | Open in IMG/M |
| 3300015371|Ga0132258_10464609 | All Organisms → cellular organisms → Bacteria | 3157 | Open in IMG/M |
| 3300015372|Ga0132256_102574894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 609 | Open in IMG/M |
| 3300017965|Ga0190266_10060256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1390 | Open in IMG/M |
| 3300018028|Ga0184608_10179085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 923 | Open in IMG/M |
| 3300018028|Ga0184608_10206716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 860 | Open in IMG/M |
| 3300018031|Ga0184634_10049864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1727 | Open in IMG/M |
| 3300018054|Ga0184621_10011545 | All Organisms → cellular organisms → Bacteria | 2569 | Open in IMG/M |
| 3300018054|Ga0184621_10364565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 508 | Open in IMG/M |
| 3300018067|Ga0184611_1281169 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300018072|Ga0184635_10072635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1344 | Open in IMG/M |
| 3300018072|Ga0184635_10100824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1142 | Open in IMG/M |
| 3300018073|Ga0184624_10044074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1781 | Open in IMG/M |
| 3300018073|Ga0184624_10437810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 575 | Open in IMG/M |
| 3300018074|Ga0184640_10351026 | Not Available | 669 | Open in IMG/M |
| 3300018078|Ga0184612_10392985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 698 | Open in IMG/M |
| 3300018081|Ga0184625_10212412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1014 | Open in IMG/M |
| 3300018081|Ga0184625_10612995 | Not Available | 532 | Open in IMG/M |
| 3300018084|Ga0184629_10389994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 732 | Open in IMG/M |
| 3300018466|Ga0190268_10510135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 820 | Open in IMG/M |
| 3300018469|Ga0190270_11055567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 842 | Open in IMG/M |
| 3300018469|Ga0190270_12642927 | Not Available | 564 | Open in IMG/M |
| 3300018476|Ga0190274_10012932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5245 | Open in IMG/M |
| 3300019259|Ga0184646_1174930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 790 | Open in IMG/M |
| 3300019269|Ga0184644_1647707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 580 | Open in IMG/M |
| 3300020005|Ga0193697_1002395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4968 | Open in IMG/M |
| 3300021081|Ga0210379_10306570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 695 | Open in IMG/M |
| 3300021082|Ga0210380_10117827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1181 | Open in IMG/M |
| 3300021344|Ga0193719_10047129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1867 | Open in IMG/M |
| 3300022195|Ga0222625_1319869 | Not Available | 545 | Open in IMG/M |
| 3300022195|Ga0222625_1492802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 866 | Open in IMG/M |
| 3300022756|Ga0222622_10063070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2148 | Open in IMG/M |
| 3300025885|Ga0207653_10001788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6875 | Open in IMG/M |
| 3300025908|Ga0207643_10000487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 25547 | Open in IMG/M |
| 3300025926|Ga0207659_10482733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1047 | Open in IMG/M |
| 3300025926|Ga0207659_10975829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 729 | Open in IMG/M |
| 3300025932|Ga0207690_10131446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1833 | Open in IMG/M |
| 3300025937|Ga0207669_11384613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 599 | Open in IMG/M |
| 3300025972|Ga0207668_11998804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
| 3300026118|Ga0207675_101147418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 797 | Open in IMG/M |
| 3300026878|Ga0208891_1006686 | Not Available | 506 | Open in IMG/M |
| 3300027006|Ga0209896_1001055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2394 | Open in IMG/M |
| 3300027056|Ga0209879_1004102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2172 | Open in IMG/M |
| 3300027163|Ga0209878_1004094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2120 | Open in IMG/M |
| 3300027277|Ga0209846_1032598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 828 | Open in IMG/M |
| 3300027561|Ga0209887_1025217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1399 | Open in IMG/M |
| 3300027577|Ga0209874_1026876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1596 | Open in IMG/M |
| (restricted) 3300027799|Ga0233416_10144577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 815 | Open in IMG/M |
| 3300027907|Ga0207428_10002047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 20349 | Open in IMG/M |
| 3300027909|Ga0209382_12197294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
| 3300028587|Ga0247828_10303624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 882 | Open in IMG/M |
| 3300028589|Ga0247818_10161433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1464 | Open in IMG/M |
| 3300028589|Ga0247818_10678561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 713 | Open in IMG/M |
| 3300028592|Ga0247822_10289212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1250 | Open in IMG/M |
| 3300028592|Ga0247822_11290133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 612 | Open in IMG/M |
| 3300028596|Ga0247821_10361212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 899 | Open in IMG/M |
| 3300028596|Ga0247821_10944357 | Not Available | 575 | Open in IMG/M |
| 3300028708|Ga0307295_10143355 | Not Available | 661 | Open in IMG/M |
| 3300028719|Ga0307301_10329820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
| 3300028722|Ga0307319_10020548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2022 | Open in IMG/M |
| 3300028771|Ga0307320_10178396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 827 | Open in IMG/M |
| 3300028791|Ga0307290_10039215 | All Organisms → cellular organisms → Bacteria | 1695 | Open in IMG/M |
| 3300028809|Ga0247824_10644732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 641 | Open in IMG/M |
| 3300028828|Ga0307312_10295653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1054 | Open in IMG/M |
| 3300028828|Ga0307312_10908082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 584 | Open in IMG/M |
| 3300028875|Ga0307289_10193537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 836 | Open in IMG/M |
| 3300028878|Ga0307278_10272109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 750 | Open in IMG/M |
| 3300028885|Ga0307304_10236391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 792 | Open in IMG/M |
| 3300028889|Ga0247827_10666860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 674 | Open in IMG/M |
| 3300030336|Ga0247826_10224273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1302 | Open in IMG/M |
| 3300030336|Ga0247826_11244471 | Not Available | 598 | Open in IMG/M |
| 3300031199|Ga0307495_10026949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1025 | Open in IMG/M |
| 3300031226|Ga0307497_10743935 | Not Available | 510 | Open in IMG/M |
| 3300031740|Ga0307468_100014810 | All Organisms → cellular organisms → Bacteria | 3224 | Open in IMG/M |
| 3300031740|Ga0307468_101415211 | Not Available | 640 | Open in IMG/M |
| 3300031908|Ga0310900_10661473 | Not Available | 832 | Open in IMG/M |
| 3300031943|Ga0310885_10341124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 785 | Open in IMG/M |
| 3300032003|Ga0310897_10391289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 656 | Open in IMG/M |
| 3300032075|Ga0310890_10949588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 689 | Open in IMG/M |
| 3300032174|Ga0307470_10574849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 838 | Open in IMG/M |
| 3300032179|Ga0310889_10527453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 602 | Open in IMG/M |
| 3300032211|Ga0310896_10052677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1651 | Open in IMG/M |
| 3300033407|Ga0214472_11306514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 628 | Open in IMG/M |
| 3300033551|Ga0247830_11386839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
| 3300033551|Ga0247830_11492144 | Not Available | 541 | Open in IMG/M |
| 3300034820|Ga0373959_0079385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 754 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 12.42% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 11.76% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 9.80% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.23% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.58% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 3.92% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.61% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.96% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.96% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.31% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.31% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.31% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.31% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.65% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.65% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.65% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.65% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.65% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.65% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009799 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 | Environmental | Open in IMG/M |
| 3300009801 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 | Environmental | Open in IMG/M |
| 3300009809 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 | Environmental | Open in IMG/M |
| 3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
| 3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010029 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
| 3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
| 3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012672 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT266_2 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026878 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPC (SPAdes) | Environmental | Open in IMG/M |
| 3300027006 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027163 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027277 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027799 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MG | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPICI_01140540 | 2088090015 | Soil | MGSVGIVLTVLVVALLWVAAVAFGRDSREDGDRRSGSDQRDRPLRL |
| INPhiseqgaiiFebDRAFT_1016019474 | 3300000364 | Soil | MGSVGIVLTVLVVALLWVAAVAFGRDSREDGDRRSGSDPLDRPLRL* |
| F24TB_103119702 | 3300000550 | Soil | MGSVGIVLTVLVVALLWVAAVAFGRDSREGDRRSGSDHRDRPLRL* |
| JGI10214J12806_101718072 | 3300000891 | Soil | MSAIGIALTILVVVLVWVAAVAFGRDSRDGTERRSGPDPRDRFLRL* |
| JGI10216J12902_1198302362 | 3300000956 | Soil | VLTVFVVALLWVAAVAFGRDSREDGQRRSGPDRPLRL* |
| F14TB_1004607213 | 3300001431 | Soil | MGSIEIALTVLIVVLLWVAAVAFGRDSRAGSDRRDRFLRL* |
| JGI24752J21851_10072651 | 3300001976 | Corn, Switchgrass And Miscanthus Rhizosphere | GLMGSIGLALTVLVVVLLWVAAVAFGRDSREGSERRFGPDRRDRSLRL* |
| Ga0062593_1008367492 | 3300004114 | Soil | MGSVGIVLTVLVVALLWVAAVAFGRDSREDGDRRSAGDRPLRL* |
| Ga0062589_1011362392 | 3300004156 | Soil | MGAIGIALTVLVVVLVWVAAVAFGRDSREGTERRSGPDQRDRFLRL* |
| Ga0062595_1017534421 | 3300004479 | Soil | MGSIGLALTVLVVVLLWVAAVAFGSDSREGSERRFGPDRRDRSLRL* |
| Ga0062591_1014476512 | 3300004643 | Soil | MGSIGLALTVLVVVLLWVAAVAFARDSREGSERRFGPDRRDRSLRL* |
| Ga0062594_1003162533 | 3300005093 | Soil | MGAIGIALTVLVVVLVWVAAVAFGRDSREGTERRSDPDQRDRFLRL* |
| Ga0062594_1020618063 | 3300005093 | Soil | MGSIEIALTVLVVVLLWVAAVAFGRDSREDSYRRSGSDVRDRFLRL* |
| Ga0066809_100012216 | 3300005168 | Soil | MGSVGIVLTILVVALLWVAAVAFGGDSREDGDRRSGCDRPDRPLRL* |
| Ga0070683_1019165422 | 3300005329 | Corn Rhizosphere | MGSIGLALTVLVVVLLWVAAVAFGRDSREGSERRFGPDRRDRSLRL* |
| Ga0070670_1007079902 | 3300005331 | Switchgrass Rhizosphere | MGSVGIVLTVLVVALLWVAAVAFGRDSREDGDRRSGSDHRDRPLRL* |
| Ga0070680_1017998582 | 3300005336 | Corn Rhizosphere | MGSIEIALTVLVVVLLWVAAVAFGRDSREGSYRRSGSDVRDRFLRL* |
| Ga0070660_1014400492 | 3300005339 | Corn Rhizosphere | MGSIEVVLTILVVALLWVAAVAFGRDSREDGERRSAGDPPLRL* |
| Ga0070694_1000720253 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MGSIGLALTVLVVVLLWVAAVAFGRDSREGSERRFGPDRGDRSLRL* |
| Ga0070699_1009972523 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MGSIEIVLTILVVALLWVAAVAFGRDSREDGERRSAGDPPLRL* |
| Ga0070696_1008361402 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MGSIGLALTVLVVVLLWVAAVAFGRDSREGTERRSGPDQRDRFLRL* |
| Ga0068857_1003045393 | 3300005577 | Corn Rhizosphere | MGSVGIVLTVLVVALLWVAAVAFGRDSREDGERRSAGDPPLRL* |
| Ga0070702_1008985642 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MGSIGLALTVLVVVLLWVAAVAFGRDSREGTERRSDPDQRDRFLRL* |
| Ga0081455_100313656 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MGSVGIVLTVFVLALLWVAAVAFGRDSRDDGDRRSAGDRPLRL* |
| Ga0075417_100793553 | 3300006049 | Populus Rhizosphere | MGSIEIVLTILVVALLWVAAVAFGRDSREDGERRSAGDRPLRL* |
| Ga0075422_101291351 | 3300006196 | Populus Rhizosphere | MGSIGIALTVLVVVLLWVAAVAFGRDSREGSERRFGPDQHERFLRL* |
| Ga0074047_119133141 | 3300006576 | Soil | VLTILVVALLWVAAVAFGGDSREDGDRRSGCDRPDRPLRL* |
| Ga0074049_130650223 | 3300006580 | Soil | LVVALLWVAAVAFGGDSREDGDRRSGCDRPDRPLRL* |
| Ga0075421_1010575782 | 3300006845 | Populus Rhizosphere | MGSVGIVLTVLVVASLWVAAVAFGRDSREDGDRRSWSDHRDRPLRL* |
| Ga0105098_100729783 | 3300009081 | Freshwater Sediment | MGSVGIVLTVFVVALLWVAAVAFGRDSREVGDRRSGDDRPLRL* |
| Ga0111539_104652114 | 3300009094 | Populus Rhizosphere | MGSIGIALTVLVVVLLWVAAVAFGLDSREGSERRFGPDQHERFLRL* |
| Ga0114129_123308641 | 3300009147 | Populus Rhizosphere | GLMGSIEIVLTILVVALLWVAAVAFGRDSREDGDRRSWSDHRDRPLRL* |
| Ga0111538_100540964 | 3300009156 | Populus Rhizosphere | MGSIGIALTVLVVVLLWVAAVAFGRDSREASERRFGPDQHERFLRL* |
| Ga0105092_104220472 | 3300009157 | Freshwater Sediment | MGSVGIVLTVFVVALLWVAPVAFGRDSREVGDRRSGDDRPLRL* |
| Ga0105104_105842731 | 3300009168 | Freshwater Sediment | MGSVGIVLTLLVVAMLWVAAVAFGRDSREDGDRRSRSDHRDRPLRL* |
| Ga0105249_102518133 | 3300009553 | Switchgrass Rhizosphere | MGSVGIVLTVFVVALLWVAAVAFGRDSREDGDRRSGSDRRDRPLRL* |
| Ga0105249_116591862 | 3300009553 | Switchgrass Rhizosphere | MGSIEIALTVLFVVLLWVAAVAFGRDSREGSYRRSGSDVRDRFLRL* |
| Ga0126307_1000378712 | 3300009789 | Serpentine Soil | MGSVGIVLTVLVVTLLWVAAVAFGRDSREVGDRRSGSDRPLRL* |
| Ga0105075_10496332 | 3300009799 | Groundwater Sand | MGSVGIVLTLFVVALLWVAAVAFGRDSREGGDRRSAGDGPLRL* |
| Ga0105056_10093622 | 3300009801 | Groundwater Sand | MGSVGIVLMVLVVALLWVAAVAFGRDSREGGDRRSAGDRPLRL* |
| Ga0105089_10440672 | 3300009809 | Groundwater Sand | METVEIVLTVLVVALLWVAAVAFGRDSREDGERRSGGDRRDRALRL* |
| Ga0105084_10094464 | 3300009811 | Groundwater Sand | METVEIVLTVLVVALLWVAAVAFGRDSREDGERRSGGDRRD |
| Ga0105084_10286872 | 3300009811 | Groundwater Sand | MGSVGIVLTVFVVALLWVAAVAFGRDSRENGDRRSGGDRPLRL* |
| Ga0105084_10671513 | 3300009811 | Groundwater Sand | MGSVGIALTVLVVALLWVAAVAFGRDSREDGDLRSGSDHRDRPLRL* |
| Ga0105070_10095622 | 3300009815 | Groundwater Sand | METVEIVLTVLVVALLWVAAVAFGRDSREDGERRSGGDRRDRPLRL* |
| Ga0105062_10058362 | 3300009817 | Groundwater Sand | MGSVGIVLTLFVVALLWVAAVAFGRDSREDGDGRSAGDRPLRL* |
| Ga0105066_10456291 | 3300009822 | Groundwater Sand | ARGGLMGSVGIVLTVLVVALLWVAAVAFGRDSREGGDRRSGSDRRDRPLRL* |
| Ga0105058_11249973 | 3300009837 | Groundwater Sand | MGSVGIVLTVLVVALLWVAAVAFGRDSREGGDRRSGSDRRDRPLR |
| Ga0105058_11937072 | 3300009837 | Groundwater Sand | TVLVVALLWVAAVAFGRDSREDGDLRSGSDHRDRPLRL* |
| Ga0126313_104170963 | 3300009840 | Serpentine Soil | MGSVEIVLTLLVVALLWVAAVAFGRDSREDGDRRSGNDRPLRL* |
| Ga0105074_10571621 | 3300010029 | Groundwater Sand | MGSVGIVLTVLVVALLWVAAVAFGRDSREDGERRSGGDRRDRALRL* |
| Ga0126315_100405904 | 3300010038 | Serpentine Soil | MGSVGIVLTVLVVTLLWVAAVAFGRDSREDGERRSGSDRPLRL* |
| Ga0126312_100499543 | 3300010041 | Serpentine Soil | MGSVGIVLTVLVVALLSVAAVAFGRDSREDAERRSGSDRPLRL* |
| Ga0126312_104727042 | 3300010041 | Serpentine Soil | MDTIGIVLTVLLVALLWVAAVAFGRDSREGGDWPSADRPEGPQRP* |
| Ga0126306_110267813 | 3300010166 | Serpentine Soil | MGSVGIVLTVLVVALLWVAAVAFGRDSREDAERRSGSDRPLRL* |
| Ga0134122_104963593 | 3300010400 | Terrestrial Soil | MGSIEIALTVLVVVLLWVAAVAFGRDSREGAYRRSGPDARDRLLRL* |
| Ga0134123_128469922 | 3300010403 | Terrestrial Soil | MGSIEIALTVLVVVLLWVAAVAFGRDSREGSYRRSGSDVRDRFLG* |
| Ga0137424_10687531 | 3300011412 | Soil | MGSIEIALTALVVVLLWVAAVAFGRDSREGSYRRSGPDARDRFLRL* |
| Ga0137432_10561841 | 3300011439 | Soil | LVVVLLWVAAVAFGRDSREGSDRRSGPDQRDRFLRL* |
| Ga0120191_100840303 | 3300012022 | Terrestrial | PFSVGIVLTVLVVALLWVAAVAFGRDSREAGDRRSGSDRDRPLRL* |
| Ga0137374_100996271 | 3300012204 | Vadose Zone Soil | TVLVVALLWVAAVAFGCVSREDGVRRSGGDRRDRSLRL* |
| Ga0137367_100209424 | 3300012353 | Vadose Zone Soil | MGSVEIVLTVLVVALLWVAAVVFGRDSRQEGDRRSGSDRPLRL* |
| Ga0137369_102121071 | 3300012355 | Vadose Zone Soil | MDSIGIALTVLVVVLLWVAAVAFGRDSREGSDRPVGTDRRDRFLRL* |
| Ga0137369_102773171 | 3300012355 | Vadose Zone Soil | GIVLTVLVVALLWVAAVAFGRDSREDGDRRSGSDHRERPLRL* |
| Ga0137368_105993472 | 3300012358 | Vadose Zone Soil | MGSVGIVLTVLVVALLWVAAVAFGRDSREDGDRRSGSDHRERPLRL* |
| Ga0137375_113749122 | 3300012360 | Vadose Zone Soil | VVALLWVAAVAFGRDSREDGDRRSGSDHRDRPLRL* |
| Ga0137373_102997422 | 3300012532 | Vadose Zone Soil | MGSVEIVLTVLVVALLWVAAVVFGRDSRQDGDRRSGGDRPLRL* |
| Ga0137317_10178451 | 3300012672 | Soil | RGGLMGSIGVALTILVVILLWVAAVAFGRDSREGSDRRSGPDLRDRFLRL* |
| Ga0132258_104646093 | 3300015371 | Arabidopsis Rhizosphere | MGSIGLALTVLVVVLLWVAAVAFGRDSREGSERRFGPDRRERSLRL* |
| Ga0132256_1025748941 | 3300015372 | Arabidopsis Rhizosphere | MGSIGLALTVLVVVLLWVAAVAFGRDSREGSERRFGPDQHERFLRL* |
| Ga0190266_100602563 | 3300017965 | Soil | MGSIEIALTVLVVVLLWVAAVAFGRDSRDGSDRRDRFLRL |
| Ga0184608_101790852 | 3300018028 | Groundwater Sediment | MGSVGIVLMVLVVALLWVAAVAFGRDSREDGDRRSGSDRPLRL |
| Ga0184608_102067163 | 3300018028 | Groundwater Sediment | MGSVGIVLTVLVVALLWVAAVAFGRDSREEGDRRSGSDHRDRPLRL |
| Ga0184634_100498644 | 3300018031 | Groundwater Sediment | MGSVGIVLTVLVVALLWVAAVAFGRDSREEGNRRSGSVHRDRPLRL |
| Ga0184621_100115454 | 3300018054 | Groundwater Sediment | MGSVGIVLTVLVVALLWVAAVAFGRDSREDGDRRSGSEHRDRPLRL |
| Ga0184621_103645652 | 3300018054 | Groundwater Sediment | GGLMGSVGIVLTVLVVALLWVAAVAFGRDSREEGDRRSGSDHRDRPLRL |
| Ga0184611_12811692 | 3300018067 | Groundwater Sediment | MGSVGIVLTVLVVALLWVAAVAFGRDSREGGDRRSAGDRPLRL |
| Ga0184635_100726353 | 3300018072 | Groundwater Sediment | MGSVGIVLTVFVVALLWVAAVAFGRDSREGGDRRSAGDRPLRL |
| Ga0184635_101008242 | 3300018072 | Groundwater Sediment | MGSVGIVLTVLVVALLWVAAVAFGRDSREDGDRRSGSDHRDRPLRL |
| Ga0184624_100440742 | 3300018073 | Groundwater Sediment | MGSVGIVLMVLVVALLWVAAVAFGRDSREGGDRRSAGDRPLRL |
| Ga0184624_104378101 | 3300018073 | Groundwater Sediment | MGSIEIALTVLVVVLLWVAAVAFGRDSRDGSDQRSGPDLRDRFLRL |
| Ga0184640_103510263 | 3300018074 | Groundwater Sediment | MGSVGIVLTVLVVALLWVAAVAFGRDSREDGDRRCGSDHRDRPLRL |
| Ga0184612_103929851 | 3300018078 | Groundwater Sediment | IVLTVLVVALLWVAAVAFGRDSREDGDRRSGSDHRDRPLRL |
| Ga0184625_102124123 | 3300018081 | Groundwater Sediment | LTVLVVALLWVAAVAFGRDSREDGDRRSGSDHRDRPLRL |
| Ga0184625_106129953 | 3300018081 | Groundwater Sediment | MGSVGIVLTVLVVALLWVAAVAFGRDSREDGDRRSGSDHR |
| Ga0184629_103899941 | 3300018084 | Groundwater Sediment | MGSMGIALTVLVVVLLWVAAVAFGRDSREGSGRPLGTDRRDRFLRL |
| Ga0190268_105101353 | 3300018466 | Soil | MGSVGIVLTVLVVTLLWVAAVAFGRDSREDGERRSGSDGPLRL |
| Ga0190270_110555672 | 3300018469 | Soil | METVEIVLTVLVVALLWVAAVAFGRDSREDGVRRSGGDRRDRALRL |
| Ga0190270_126429272 | 3300018469 | Soil | MGSIEIALTVLVVVLLWVAAVAFGRDSREGAGRRSGPDLRDRFLRL |
| Ga0190274_100129326 | 3300018476 | Soil | MGSVGIVLTVLVVALLWVAAVAFGLDSREHGERRSGSDRPLRL |
| Ga0184646_11749301 | 3300019259 | Groundwater Sediment | NGGGGIEPAGGLMGSIGIVLTILVVALLWVAAVAFGRDSREDGDRRSGSEHRDRPLRL |
| Ga0184644_16477072 | 3300019269 | Groundwater Sediment | AARGGLMGSVGIVLTVLVVALLWVAAVAFGRDSREDGDRRSGSDHRDRPLRL |
| Ga0193697_10023955 | 3300020005 | Soil | MGSIGVALTILVVILLWVAAVAFGRDSREGSDRRSGPDLRDRFLRL |
| Ga0210379_103065701 | 3300021081 | Groundwater Sediment | AIGIALTVLVVVLLWVAAVAFGRDSREGSDRPLGNDRRDRFLRL |
| Ga0210380_101178272 | 3300021082 | Groundwater Sediment | MGSIGIALTVLVVILLWVAAVAFGRDSREGSERRFGPGQRDRSLRL |
| Ga0193719_100471291 | 3300021344 | Soil | MGSMGIALTVLVVVLLWVAAVAFGRDSREGFDRRSGPDPRDRFLRL |
| Ga0222625_13198692 | 3300022195 | Groundwater Sediment | MGSVGIVLTVLVVALLWVAAVAFGRDSREDGNRRSGGDHRDRPLRL |
| Ga0222625_14928021 | 3300022195 | Groundwater Sediment | MGSIGIVLTILVVALLWVAAVAFGRDSREDGDRRSGSDHRDRPLRL |
| Ga0222622_100630705 | 3300022756 | Groundwater Sediment | MGSVGIVLTVLVVALLWVAAVAFGRDSREEGDRRS |
| Ga0207653_100017887 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MGSIGLALTVLVVVLLWVAAVAFARDSREGSERRFGPDRRDRSLRL |
| Ga0207643_1000048711 | 3300025908 | Miscanthus Rhizosphere | MGSIGLALTVLVVVLLWVAAVAFGRDSREGSERRFGPDRRDRSLRL |
| Ga0207659_104827333 | 3300025926 | Miscanthus Rhizosphere | MGSIEIVLTILVVALLWVAAVAFGRDSREDGERRSAGDPPLRL |
| Ga0207659_109758291 | 3300025926 | Miscanthus Rhizosphere | MGSVGIVLTVLVVALLWVAAVAFGRDSREDGDGRSGSDHRERPLRL |
| Ga0207690_101314464 | 3300025932 | Corn Rhizosphere | MGSIEVVLTILVVALLWVAAVAFGRDSREDGERRSAGDPPLRL |
| Ga0207669_113846132 | 3300025937 | Miscanthus Rhizosphere | MGAIGIALTVLVVVLVWVAAVAFGRDSREGTERRSDPDQRDRFLRL |
| Ga0207668_119988041 | 3300025972 | Switchgrass Rhizosphere | LMGSIEIALTVLVVVLLWVAAVAFGRDSREGSYRRSGSDVRDRFLRL |
| Ga0207675_1011474181 | 3300026118 | Switchgrass Rhizosphere | PPAARGGLMGSIEIALTVLVVVLLWVAAVAFGRDSREGSYRRSGSDVRDRFLRL |
| Ga0208891_10066862 | 3300026878 | Soil | MGSVGIVLTILVVALLWVAAVAFGGDSREDGDRRSGCDRPDRPLRL |
| Ga0209896_10010554 | 3300027006 | Groundwater Sand | MGSVGIVLTVFVVALLWVAAVAFGRDSREDGERRSGGDRRDRALRL |
| Ga0209879_10041024 | 3300027056 | Groundwater Sand | METVEIVLTVLVVALLWVAAVAFGRDSREDGERRSGGDRRDRALRL |
| Ga0209878_10040941 | 3300027163 | Groundwater Sand | LTVLVVALLWVAAVAFGRDSREDGERRSGGDRRDRPLRL |
| Ga0209846_10325982 | 3300027277 | Groundwater Sand | METVEIVLTVLVVALLWVAAVAFGRDSREDGDGRSAGDRPLRL |
| Ga0209887_10252173 | 3300027561 | Groundwater Sand | MGSVGIVLTVFVVALLWVAAVAFGRDSRENGDRRSGGDRPLRL |
| Ga0209874_10268762 | 3300027577 | Groundwater Sand | MGSVGIALTVLVVALLWVAAVAFGRDSREDGDLRSGSDHRDRPLRL |
| (restricted) Ga0233416_101445773 | 3300027799 | Sediment | MDIAFTVVLLVLLWVAAVAFGRDSREGGDWRSGTDP |
| Ga0207428_100020476 | 3300027907 | Populus Rhizosphere | MGSIEIVLTILVVALLWVAAVAFGRDSREDGERRSAGDRPLRL |
| Ga0209382_121972941 | 3300027909 | Populus Rhizosphere | RLPLAARGGLMGSVGIVLTVLVVALLWVAAVAFGRDSREDADGRSGSDHRERPLRL |
| Ga0247828_103036241 | 3300028587 | Soil | MGSIEIALTVLVVVLLWVAAVAFGRDSREGSYRRSGSDVRDRFL |
| Ga0247818_101614331 | 3300028589 | Soil | MGSIGIALTVLVVVLLWVAAVAFGRDSREGSDRRFGPDQHERFLRL |
| Ga0247818_106785611 | 3300028589 | Soil | MGSIEIALTVLVVVLLWVAAVAFGRDSREGSYRRSGSDVRDRFLRL |
| Ga0247822_102892122 | 3300028592 | Soil | MGSIEIVLTILVVALLWVAAVAFGRDSREDGDRRSAGDRPLRL |
| Ga0247822_112901332 | 3300028592 | Soil | MGSIEIALTVLVVVLLWVAAVAFGRDSREGSYRRSGSDMRDRFLRL |
| Ga0247821_103612121 | 3300028596 | Soil | AARGGLMGSIEIALTVLVVVLLWVAAVAFGRDSREGSYRRSGSDVRDRFLRL |
| Ga0247821_109443572 | 3300028596 | Soil | MGSIGIALTVVVVVLLWVAAVAFGRDSREGSERRFGPDQHERFLRL |
| Ga0307295_101433552 | 3300028708 | Soil | MGSIGIALTVLVVVLLWVAAVAFGRDSREGSDRRSGPDPRDRFLRL |
| Ga0307301_103298202 | 3300028719 | Soil | RGGLMGSIGIALTVLVVVLLWVAAVAFGRDSREGSDRRSGPDPRDRFLRL |
| Ga0307319_100205484 | 3300028722 | Soil | MGSVEIVLTLLVVALLWVAAVAFGRDSREDGDRRSGNDPPLRL |
| Ga0307320_101783961 | 3300028771 | Soil | MGSIGVALVILVVILLWVAAVAFGRDSRDGSDQRSGPDLRDRFL |
| Ga0307290_100392153 | 3300028791 | Soil | MGSVGIVLMVLVVALLWVAAVAFGRDSREGGDRRSAGERPLRL |
| Ga0247824_106447321 | 3300028809 | Soil | MGSIGIALTVLVVVLLWVAAVAFGRDSREGSERRFGPDQHERFLRL |
| Ga0307312_102956531 | 3300028828 | Soil | MGSVGIVLTVLVVALLWVAAVAFGRDSREDGDRRSGSDHRDRPL |
| Ga0307312_109080822 | 3300028828 | Soil | RGGLMGSVGIVLTVLVVALLWVAAVAFGRDSREDGDRRSGSEHRDRPLRL |
| Ga0307289_101935373 | 3300028875 | Soil | LMGSVGIVLTVLVVALLWVAAVAFGRDSREDGDRRSGSDHRDRPLRL |
| Ga0307278_102721091 | 3300028878 | Soil | MGSVGIVLTVLVVALLWVAAVAFGRDSREDGDRRSGSDHRDRALRL |
| Ga0307304_102363911 | 3300028885 | Soil | AARGGLMGSVGIVLTVLVVALLWVAAVAFGRDSREDGDRRSGGDHRDRPLRL |
| Ga0247827_106668601 | 3300028889 | Soil | GVPPAARGGLMDSIGIALTVLVVVLLWVAAVAFGRDSREGSERRFGPDQHERFLRL |
| Ga0247826_102242731 | 3300030336 | Soil | MGPVGIVLTLLVVALLWVAAVAFGRDSRENGDRRSGGDRPLRL |
| Ga0247826_112444712 | 3300030336 | Soil | MGSIEIALTVLVVVLLWVAAVAFARDSREGAYRRSGPDARDRLLRL |
| Ga0307495_100269491 | 3300031199 | Soil | MGSIGIALTVLVVILLWVAAVAFGRDSRDGSDRRDRFLRL |
| Ga0307497_107439352 | 3300031226 | Soil | MGAIGIALTLLVVVLLWVAAVAFGRDSREGSERRFGADQRDRFLR |
| Ga0307468_1000148104 | 3300031740 | Hardwood Forest Soil | MGSVGIVLTVLVVALLWVAAVAFGRDSREKGDRRSGGDRPLRL |
| Ga0307468_1014152112 | 3300031740 | Hardwood Forest Soil | MGAIGIALTVLVVVLVWVAAVAFGRDSREGTERRSGPDQRVRFLRL |
| Ga0310900_106614731 | 3300031908 | Soil | MGSIGLALTVLVVVLLWVAAVAFGRDSREGSERRFGPDRRERSLRL |
| Ga0310885_103411243 | 3300031943 | Soil | ERRVPPAARGGLMGSIGLALTVLVVVLLWVAAVAFGRDSREGAERRSGPDQRDRVLRL |
| Ga0310897_103912893 | 3300032003 | Soil | PAARGGLMGSIGIALTVLVVVLLWVAAVAFGRDSREGSERRFGPDQHERFLRL |
| Ga0310890_109495883 | 3300032075 | Soil | GLMGSIEIALTVLVVVLLWVAAVAFGRDSREGSYRRSGSDVRDRFLRL |
| Ga0307470_105748491 | 3300032174 | Hardwood Forest Soil | MGSVGIVLTVLVVALLWVAAVAFGRDSRENGDRRSGGDRPLRL |
| Ga0310889_105274531 | 3300032179 | Soil | MGSIEIALTVLVVILLWVAAVAFGRDSREGSERRFGPDRRERSLRL |
| Ga0310896_100526773 | 3300032211 | Soil | MGSIGIALTVLVVVLLWVAAVAFGRDSREGSERRFGPDRRERSLRL |
| Ga0214472_113065143 | 3300033407 | Soil | TVLVVALLWVAAVAFGLDSREHGERRSGSDRPLRL |
| Ga0247830_113868392 | 3300033551 | Soil | MGSIEIALTVLVVVLLWVTAVAFGRDSREGSYRRSGSDVRDRFLRL |
| Ga0247830_114921441 | 3300033551 | Soil | MEAIGIAFTVLVVVLLWVAAVAFGRDSREGSDRPVGTDPRDRFLRL |
| Ga0373959_0079385_310_450 | 3300034820 | Rhizosphere Soil | MGSIGIALTVLVVVLLWVAAVAFGRDSRERSERRFGPDQHERFLRL |
| ⦗Top⦘ |