NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F045188

Metagenome / Metatranscriptome Family F045188

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F045188
Family Type Metagenome / Metatranscriptome
Number of Sequences 153
Average Sequence Length 45 residues
Representative Sequence MGSVGIVLTVLVVALLWVAAVAFGRDSREDGDRRSGSDHRDRPLRL
Number of Associated Samples 131
Number of Associated Scaffolds 153

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 78.43 %
% of genes near scaffold ends (potentially truncated) 28.10 %
% of genes from short scaffolds (< 2000 bps) 84.97 %
Associated GOLD sequencing projects 125
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.660 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil
(12.418 % of family members)
Environment Ontology (ENVO) Unclassified
(26.144 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Subsurface (non-saline)
(29.412 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 45.95%    β-sheet: 0.00%    Coil/Unstructured: 54.05%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 153 Family Scaffolds
PF03575Peptidase_S51 15.69
PF11706zf-CGNR 15.03
PF01769MgtE 1.31
PF07336ABATE 1.31
PF01548DEDD_Tnp_IS110 0.65
PF01544CorA 0.65
PF01435Peptidase_M48 0.65
PF08445FR47 0.65
PF02786CPSase_L_D2 0.65
PF08245Mur_ligase_M 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 153 Family Scaffolds
COG1824Permease, similar to cation transportersInorganic ion transport and metabolism [P] 1.31
COG2239Mg/Co/Ni transporter MgtE (contains CBS domain)Inorganic ion transport and metabolism [P] 1.31
COG5516Uncharacterized conserved protein containing a Zn-ribbon-like motif, possibly RNA-bindingGeneral function prediction only [R] 1.31
COG0598Mg2+ and Co2+ transporter CorAInorganic ion transport and metabolism [P] 0.65
COG3547TransposaseMobilome: prophages, transposons [X] 0.65


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.66 %
UnclassifiedrootN/A16.34 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090015|GPICI_8738923All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1161Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101601947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2595Open in IMG/M
3300000550|F24TB_10311970Not Available594Open in IMG/M
3300000891|JGI10214J12806_10171807Not Available507Open in IMG/M
3300000956|JGI10216J12902_119830236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria596Open in IMG/M
3300001431|F14TB_100460721Not Available863Open in IMG/M
3300001976|JGI24752J21851_1007265All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1445Open in IMG/M
3300004114|Ga0062593_100836749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria921Open in IMG/M
3300004156|Ga0062589_101136239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria742Open in IMG/M
3300004479|Ga0062595_101753442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria587Open in IMG/M
3300004643|Ga0062591_101447651All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria684Open in IMG/M
3300005093|Ga0062594_100316253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1200Open in IMG/M
3300005093|Ga0062594_102061806Not Available612Open in IMG/M
3300005168|Ga0066809_10001221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3864Open in IMG/M
3300005329|Ga0070683_101916542Not Available569Open in IMG/M
3300005331|Ga0070670_100707990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria906Open in IMG/M
3300005336|Ga0070680_101799858Not Available531Open in IMG/M
3300005339|Ga0070660_101440049All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria585Open in IMG/M
3300005444|Ga0070694_100072025All Organisms → cellular organisms → Bacteria2383Open in IMG/M
3300005518|Ga0070699_100997252Not Available768Open in IMG/M
3300005546|Ga0070696_100836140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria760Open in IMG/M
3300005577|Ga0068857_100304539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1469Open in IMG/M
3300005615|Ga0070702_100898564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria693Open in IMG/M
3300005937|Ga0081455_10031365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4810Open in IMG/M
3300006049|Ga0075417_10079355All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1463Open in IMG/M
3300006196|Ga0075422_10129135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria994Open in IMG/M
3300006576|Ga0074047_11913314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria913Open in IMG/M
3300006580|Ga0074049_13065022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria928Open in IMG/M
3300006845|Ga0075421_101057578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria915Open in IMG/M
3300009081|Ga0105098_10072978All Organisms → cellular organisms → Bacteria1437Open in IMG/M
3300009094|Ga0111539_10465211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1472Open in IMG/M
3300009147|Ga0114129_12330864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria642Open in IMG/M
3300009156|Ga0111538_10054096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5135Open in IMG/M
3300009157|Ga0105092_10422047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria760Open in IMG/M
3300009168|Ga0105104_10584273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria634Open in IMG/M
3300009553|Ga0105249_10251813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1751Open in IMG/M
3300009553|Ga0105249_11659186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria712Open in IMG/M
3300009789|Ga0126307_10003787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria10416Open in IMG/M
3300009799|Ga0105075_1049633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria539Open in IMG/M
3300009801|Ga0105056_1009362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1078Open in IMG/M
3300009809|Ga0105089_1044067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria675Open in IMG/M
3300009811|Ga0105084_1009446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1474Open in IMG/M
3300009811|Ga0105084_1028687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria943Open in IMG/M
3300009811|Ga0105084_1067151Not Available649Open in IMG/M
3300009815|Ga0105070_1009562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1586Open in IMG/M
3300009817|Ga0105062_1005836All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1799Open in IMG/M
3300009822|Ga0105066_1045629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria913Open in IMG/M
3300009837|Ga0105058_1124997Not Available614Open in IMG/M
3300009837|Ga0105058_1193707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria506Open in IMG/M
3300009840|Ga0126313_10417096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1067Open in IMG/M
3300010029|Ga0105074_1057162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria695Open in IMG/M
3300010038|Ga0126315_10040590All Organisms → cellular organisms → Bacteria2478Open in IMG/M
3300010041|Ga0126312_10049954All Organisms → cellular organisms → Bacteria2801Open in IMG/M
3300010041|Ga0126312_10472704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria895Open in IMG/M
3300010166|Ga0126306_11026781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria673Open in IMG/M
3300010400|Ga0134122_10496359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1103Open in IMG/M
3300010403|Ga0134123_12846992Not Available552Open in IMG/M
3300011412|Ga0137424_1068753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria685Open in IMG/M
3300011439|Ga0137432_1056184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1190Open in IMG/M
3300012022|Ga0120191_10084030Not Available627Open in IMG/M
3300012204|Ga0137374_10099627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2745Open in IMG/M
3300012353|Ga0137367_10020942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5113Open in IMG/M
3300012355|Ga0137369_10212107All Organisms → cellular organisms → Bacteria1489Open in IMG/M
3300012355|Ga0137369_10277317Not Available1254Open in IMG/M
3300012358|Ga0137368_10599347Not Available700Open in IMG/M
3300012360|Ga0137375_11374912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria527Open in IMG/M
3300012532|Ga0137373_10299742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1278Open in IMG/M
3300012672|Ga0137317_1017845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria659Open in IMG/M
3300015371|Ga0132258_10464609All Organisms → cellular organisms → Bacteria3157Open in IMG/M
3300015372|Ga0132256_102574894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria609Open in IMG/M
3300017965|Ga0190266_10060256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1390Open in IMG/M
3300018028|Ga0184608_10179085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria923Open in IMG/M
3300018028|Ga0184608_10206716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria860Open in IMG/M
3300018031|Ga0184634_10049864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1727Open in IMG/M
3300018054|Ga0184621_10011545All Organisms → cellular organisms → Bacteria2569Open in IMG/M
3300018054|Ga0184621_10364565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria508Open in IMG/M
3300018067|Ga0184611_1281169All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300018072|Ga0184635_10072635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1344Open in IMG/M
3300018072|Ga0184635_10100824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1142Open in IMG/M
3300018073|Ga0184624_10044074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1781Open in IMG/M
3300018073|Ga0184624_10437810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria575Open in IMG/M
3300018074|Ga0184640_10351026Not Available669Open in IMG/M
3300018078|Ga0184612_10392985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria698Open in IMG/M
3300018081|Ga0184625_10212412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1014Open in IMG/M
3300018081|Ga0184625_10612995Not Available532Open in IMG/M
3300018084|Ga0184629_10389994All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria732Open in IMG/M
3300018466|Ga0190268_10510135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria820Open in IMG/M
3300018469|Ga0190270_11055567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria842Open in IMG/M
3300018469|Ga0190270_12642927Not Available564Open in IMG/M
3300018476|Ga0190274_10012932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5245Open in IMG/M
3300019259|Ga0184646_1174930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria790Open in IMG/M
3300019269|Ga0184644_1647707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria580Open in IMG/M
3300020005|Ga0193697_1002395All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4968Open in IMG/M
3300021081|Ga0210379_10306570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria695Open in IMG/M
3300021082|Ga0210380_10117827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1181Open in IMG/M
3300021344|Ga0193719_10047129All Organisms → cellular organisms → Bacteria → Terrabacteria group1867Open in IMG/M
3300022195|Ga0222625_1319869Not Available545Open in IMG/M
3300022195|Ga0222625_1492802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria866Open in IMG/M
3300022756|Ga0222622_10063070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2148Open in IMG/M
3300025885|Ga0207653_10001788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6875Open in IMG/M
3300025908|Ga0207643_10000487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria25547Open in IMG/M
3300025926|Ga0207659_10482733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1047Open in IMG/M
3300025926|Ga0207659_10975829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria729Open in IMG/M
3300025932|Ga0207690_10131446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1833Open in IMG/M
3300025937|Ga0207669_11384613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria599Open in IMG/M
3300025972|Ga0207668_11998804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria522Open in IMG/M
3300026118|Ga0207675_101147418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria797Open in IMG/M
3300026878|Ga0208891_1006686Not Available506Open in IMG/M
3300027006|Ga0209896_1001055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2394Open in IMG/M
3300027056|Ga0209879_1004102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2172Open in IMG/M
3300027163|Ga0209878_1004094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2120Open in IMG/M
3300027277|Ga0209846_1032598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria828Open in IMG/M
3300027561|Ga0209887_1025217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1399Open in IMG/M
3300027577|Ga0209874_1026876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1596Open in IMG/M
(restricted) 3300027799|Ga0233416_10144577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria815Open in IMG/M
3300027907|Ga0207428_10002047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria20349Open in IMG/M
3300027909|Ga0209382_12197294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria522Open in IMG/M
3300028587|Ga0247828_10303624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria882Open in IMG/M
3300028589|Ga0247818_10161433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1464Open in IMG/M
3300028589|Ga0247818_10678561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria713Open in IMG/M
3300028592|Ga0247822_10289212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1250Open in IMG/M
3300028592|Ga0247822_11290133All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria612Open in IMG/M
3300028596|Ga0247821_10361212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria899Open in IMG/M
3300028596|Ga0247821_10944357Not Available575Open in IMG/M
3300028708|Ga0307295_10143355Not Available661Open in IMG/M
3300028719|Ga0307301_10329820All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria501Open in IMG/M
3300028722|Ga0307319_10020548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2022Open in IMG/M
3300028771|Ga0307320_10178396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria827Open in IMG/M
3300028791|Ga0307290_10039215All Organisms → cellular organisms → Bacteria1695Open in IMG/M
3300028809|Ga0247824_10644732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria641Open in IMG/M
3300028828|Ga0307312_10295653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1054Open in IMG/M
3300028828|Ga0307312_10908082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria584Open in IMG/M
3300028875|Ga0307289_10193537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria836Open in IMG/M
3300028878|Ga0307278_10272109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria750Open in IMG/M
3300028885|Ga0307304_10236391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria792Open in IMG/M
3300028889|Ga0247827_10666860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria674Open in IMG/M
3300030336|Ga0247826_10224273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1302Open in IMG/M
3300030336|Ga0247826_11244471Not Available598Open in IMG/M
3300031199|Ga0307495_10026949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1025Open in IMG/M
3300031226|Ga0307497_10743935Not Available510Open in IMG/M
3300031740|Ga0307468_100014810All Organisms → cellular organisms → Bacteria3224Open in IMG/M
3300031740|Ga0307468_101415211Not Available640Open in IMG/M
3300031908|Ga0310900_10661473Not Available832Open in IMG/M
3300031943|Ga0310885_10341124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria785Open in IMG/M
3300032003|Ga0310897_10391289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria656Open in IMG/M
3300032075|Ga0310890_10949588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria689Open in IMG/M
3300032174|Ga0307470_10574849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria838Open in IMG/M
3300032179|Ga0310889_10527453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria602Open in IMG/M
3300032211|Ga0310896_10052677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1651Open in IMG/M
3300033407|Ga0214472_11306514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria628Open in IMG/M
3300033551|Ga0247830_11386839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria562Open in IMG/M
3300033551|Ga0247830_11492144Not Available541Open in IMG/M
3300034820|Ga0373959_0079385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria754Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil12.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil12.42%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand11.76%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment9.80%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.23%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.58%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment3.92%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil3.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.92%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.61%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.96%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.96%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.96%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.31%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.31%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.31%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.31%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.31%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.31%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.65%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.65%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.65%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.65%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.65%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.65%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.65%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.65%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.65%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090015Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300001976Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7Host-AssociatedOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009799Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30EnvironmentalOpen in IMG/M
3300009801Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30EnvironmentalOpen in IMG/M
3300009809Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40EnvironmentalOpen in IMG/M
3300009811Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30EnvironmentalOpen in IMG/M
3300009815Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10EnvironmentalOpen in IMG/M
3300009817Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20EnvironmentalOpen in IMG/M
3300009822Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40EnvironmentalOpen in IMG/M
3300009837Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010029Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011412Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2EnvironmentalOpen in IMG/M
3300011439Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2EnvironmentalOpen in IMG/M
3300012022Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6EnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012672Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT266_2EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019259Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019269Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300022195Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026878Soil and rhizosphere microbial communities from Laval, Canada - mgHPC (SPAdes)EnvironmentalOpen in IMG/M
3300027006Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027056Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027163Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes)EnvironmentalOpen in IMG/M
3300027277Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027561Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300027577Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027799 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MGEnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028596Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14EnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300033407Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
GPICI_011405402088090015SoilMGSVGIVLTVLVVALLWVAAVAFGRDSREDGDRRSGSDQRDRPLRL
INPhiseqgaiiFebDRAFT_10160194743300000364SoilMGSVGIVLTVLVVALLWVAAVAFGRDSREDGDRRSGSDPLDRPLRL*
F24TB_1031197023300000550SoilMGSVGIVLTVLVVALLWVAAVAFGRDSREGDRRSGSDHRDRPLRL*
JGI10214J12806_1017180723300000891SoilMSAIGIALTILVVVLVWVAAVAFGRDSRDGTERRSGPDPRDRFLRL*
JGI10216J12902_11983023623300000956SoilVLTVFVVALLWVAAVAFGRDSREDGQRRSGPDRPLRL*
F14TB_10046072133300001431SoilMGSIEIALTVLIVVLLWVAAVAFGRDSRAGSDRRDRFLRL*
JGI24752J21851_100726513300001976Corn, Switchgrass And Miscanthus RhizosphereGLMGSIGLALTVLVVVLLWVAAVAFGRDSREGSERRFGPDRRDRSLRL*
Ga0062593_10083674923300004114SoilMGSVGIVLTVLVVALLWVAAVAFGRDSREDGDRRSAGDRPLRL*
Ga0062589_10113623923300004156SoilMGAIGIALTVLVVVLVWVAAVAFGRDSREGTERRSGPDQRDRFLRL*
Ga0062595_10175344213300004479SoilMGSIGLALTVLVVVLLWVAAVAFGSDSREGSERRFGPDRRDRSLRL*
Ga0062591_10144765123300004643SoilMGSIGLALTVLVVVLLWVAAVAFARDSREGSERRFGPDRRDRSLRL*
Ga0062594_10031625333300005093SoilMGAIGIALTVLVVVLVWVAAVAFGRDSREGTERRSDPDQRDRFLRL*
Ga0062594_10206180633300005093SoilMGSIEIALTVLVVVLLWVAAVAFGRDSREDSYRRSGSDVRDRFLRL*
Ga0066809_1000122163300005168SoilMGSVGIVLTILVVALLWVAAVAFGGDSREDGDRRSGCDRPDRPLRL*
Ga0070683_10191654223300005329Corn RhizosphereMGSIGLALTVLVVVLLWVAAVAFGRDSREGSERRFGPDRRDRSLRL*
Ga0070670_10070799023300005331Switchgrass RhizosphereMGSVGIVLTVLVVALLWVAAVAFGRDSREDGDRRSGSDHRDRPLRL*
Ga0070680_10179985823300005336Corn RhizosphereMGSIEIALTVLVVVLLWVAAVAFGRDSREGSYRRSGSDVRDRFLRL*
Ga0070660_10144004923300005339Corn RhizosphereMGSIEVVLTILVVALLWVAAVAFGRDSREDGERRSAGDPPLRL*
Ga0070694_10007202533300005444Corn, Switchgrass And Miscanthus RhizosphereMGSIGLALTVLVVVLLWVAAVAFGRDSREGSERRFGPDRGDRSLRL*
Ga0070699_10099725233300005518Corn, Switchgrass And Miscanthus RhizosphereMGSIEIVLTILVVALLWVAAVAFGRDSREDGERRSAGDPPLRL*
Ga0070696_10083614023300005546Corn, Switchgrass And Miscanthus RhizosphereMGSIGLALTVLVVVLLWVAAVAFGRDSREGTERRSGPDQRDRFLRL*
Ga0068857_10030453933300005577Corn RhizosphereMGSVGIVLTVLVVALLWVAAVAFGRDSREDGERRSAGDPPLRL*
Ga0070702_10089856423300005615Corn, Switchgrass And Miscanthus RhizosphereMGSIGLALTVLVVVLLWVAAVAFGRDSREGTERRSDPDQRDRFLRL*
Ga0081455_1003136563300005937Tabebuia Heterophylla RhizosphereMGSVGIVLTVFVLALLWVAAVAFGRDSRDDGDRRSAGDRPLRL*
Ga0075417_1007935533300006049Populus RhizosphereMGSIEIVLTILVVALLWVAAVAFGRDSREDGERRSAGDRPLRL*
Ga0075422_1012913513300006196Populus RhizosphereMGSIGIALTVLVVVLLWVAAVAFGRDSREGSERRFGPDQHERFLRL*
Ga0074047_1191331413300006576SoilVLTILVVALLWVAAVAFGGDSREDGDRRSGCDRPDRPLRL*
Ga0074049_1306502233300006580SoilLVVALLWVAAVAFGGDSREDGDRRSGCDRPDRPLRL*
Ga0075421_10105757823300006845Populus RhizosphereMGSVGIVLTVLVVASLWVAAVAFGRDSREDGDRRSWSDHRDRPLRL*
Ga0105098_1007297833300009081Freshwater SedimentMGSVGIVLTVFVVALLWVAAVAFGRDSREVGDRRSGDDRPLRL*
Ga0111539_1046521143300009094Populus RhizosphereMGSIGIALTVLVVVLLWVAAVAFGLDSREGSERRFGPDQHERFLRL*
Ga0114129_1233086413300009147Populus RhizosphereGLMGSIEIVLTILVVALLWVAAVAFGRDSREDGDRRSWSDHRDRPLRL*
Ga0111538_1005409643300009156Populus RhizosphereMGSIGIALTVLVVVLLWVAAVAFGRDSREASERRFGPDQHERFLRL*
Ga0105092_1042204723300009157Freshwater SedimentMGSVGIVLTVFVVALLWVAPVAFGRDSREVGDRRSGDDRPLRL*
Ga0105104_1058427313300009168Freshwater SedimentMGSVGIVLTLLVVAMLWVAAVAFGRDSREDGDRRSRSDHRDRPLRL*
Ga0105249_1025181333300009553Switchgrass RhizosphereMGSVGIVLTVFVVALLWVAAVAFGRDSREDGDRRSGSDRRDRPLRL*
Ga0105249_1165918623300009553Switchgrass RhizosphereMGSIEIALTVLFVVLLWVAAVAFGRDSREGSYRRSGSDVRDRFLRL*
Ga0126307_10003787123300009789Serpentine SoilMGSVGIVLTVLVVTLLWVAAVAFGRDSREVGDRRSGSDRPLRL*
Ga0105075_104963323300009799Groundwater SandMGSVGIVLTLFVVALLWVAAVAFGRDSREGGDRRSAGDGPLRL*
Ga0105056_100936223300009801Groundwater SandMGSVGIVLMVLVVALLWVAAVAFGRDSREGGDRRSAGDRPLRL*
Ga0105089_104406723300009809Groundwater SandMETVEIVLTVLVVALLWVAAVAFGRDSREDGERRSGGDRRDRALRL*
Ga0105084_100944643300009811Groundwater SandMETVEIVLTVLVVALLWVAAVAFGRDSREDGERRSGGDRRD
Ga0105084_102868723300009811Groundwater SandMGSVGIVLTVFVVALLWVAAVAFGRDSRENGDRRSGGDRPLRL*
Ga0105084_106715133300009811Groundwater SandMGSVGIALTVLVVALLWVAAVAFGRDSREDGDLRSGSDHRDRPLRL*
Ga0105070_100956223300009815Groundwater SandMETVEIVLTVLVVALLWVAAVAFGRDSREDGERRSGGDRRDRPLRL*
Ga0105062_100583623300009817Groundwater SandMGSVGIVLTLFVVALLWVAAVAFGRDSREDGDGRSAGDRPLRL*
Ga0105066_104562913300009822Groundwater SandARGGLMGSVGIVLTVLVVALLWVAAVAFGRDSREGGDRRSGSDRRDRPLRL*
Ga0105058_112499733300009837Groundwater SandMGSVGIVLTVLVVALLWVAAVAFGRDSREGGDRRSGSDRRDRPLR
Ga0105058_119370723300009837Groundwater SandTVLVVALLWVAAVAFGRDSREDGDLRSGSDHRDRPLRL*
Ga0126313_1041709633300009840Serpentine SoilMGSVEIVLTLLVVALLWVAAVAFGRDSREDGDRRSGNDRPLRL*
Ga0105074_105716213300010029Groundwater SandMGSVGIVLTVLVVALLWVAAVAFGRDSREDGERRSGGDRRDRALRL*
Ga0126315_1004059043300010038Serpentine SoilMGSVGIVLTVLVVTLLWVAAVAFGRDSREDGERRSGSDRPLRL*
Ga0126312_1004995433300010041Serpentine SoilMGSVGIVLTVLVVALLSVAAVAFGRDSREDAERRSGSDRPLRL*
Ga0126312_1047270423300010041Serpentine SoilMDTIGIVLTVLLVALLWVAAVAFGRDSREGGDWPSADRPEGPQRP*
Ga0126306_1102678133300010166Serpentine SoilMGSVGIVLTVLVVALLWVAAVAFGRDSREDAERRSGSDRPLRL*
Ga0134122_1049635933300010400Terrestrial SoilMGSIEIALTVLVVVLLWVAAVAFGRDSREGAYRRSGPDARDRLLRL*
Ga0134123_1284699223300010403Terrestrial SoilMGSIEIALTVLVVVLLWVAAVAFGRDSREGSYRRSGSDVRDRFLG*
Ga0137424_106875313300011412SoilMGSIEIALTALVVVLLWVAAVAFGRDSREGSYRRSGPDARDRFLRL*
Ga0137432_105618413300011439SoilLVVVLLWVAAVAFGRDSREGSDRRSGPDQRDRFLRL*
Ga0120191_1008403033300012022TerrestrialPFSVGIVLTVLVVALLWVAAVAFGRDSREAGDRRSGSDRDRPLRL*
Ga0137374_1009962713300012204Vadose Zone SoilTVLVVALLWVAAVAFGCVSREDGVRRSGGDRRDRSLRL*
Ga0137367_1002094243300012353Vadose Zone SoilMGSVEIVLTVLVVALLWVAAVVFGRDSRQEGDRRSGSDRPLRL*
Ga0137369_1021210713300012355Vadose Zone SoilMDSIGIALTVLVVVLLWVAAVAFGRDSREGSDRPVGTDRRDRFLRL*
Ga0137369_1027731713300012355Vadose Zone SoilGIVLTVLVVALLWVAAVAFGRDSREDGDRRSGSDHRERPLRL*
Ga0137368_1059934723300012358Vadose Zone SoilMGSVGIVLTVLVVALLWVAAVAFGRDSREDGDRRSGSDHRERPLRL*
Ga0137375_1137491223300012360Vadose Zone SoilVVALLWVAAVAFGRDSREDGDRRSGSDHRDRPLRL*
Ga0137373_1029974223300012532Vadose Zone SoilMGSVEIVLTVLVVALLWVAAVVFGRDSRQDGDRRSGGDRPLRL*
Ga0137317_101784513300012672SoilRGGLMGSIGVALTILVVILLWVAAVAFGRDSREGSDRRSGPDLRDRFLRL*
Ga0132258_1046460933300015371Arabidopsis RhizosphereMGSIGLALTVLVVVLLWVAAVAFGRDSREGSERRFGPDRRERSLRL*
Ga0132256_10257489413300015372Arabidopsis RhizosphereMGSIGLALTVLVVVLLWVAAVAFGRDSREGSERRFGPDQHERFLRL*
Ga0190266_1006025633300017965SoilMGSIEIALTVLVVVLLWVAAVAFGRDSRDGSDRRDRFLRL
Ga0184608_1017908523300018028Groundwater SedimentMGSVGIVLMVLVVALLWVAAVAFGRDSREDGDRRSGSDRPLRL
Ga0184608_1020671633300018028Groundwater SedimentMGSVGIVLTVLVVALLWVAAVAFGRDSREEGDRRSGSDHRDRPLRL
Ga0184634_1004986443300018031Groundwater SedimentMGSVGIVLTVLVVALLWVAAVAFGRDSREEGNRRSGSVHRDRPLRL
Ga0184621_1001154543300018054Groundwater SedimentMGSVGIVLTVLVVALLWVAAVAFGRDSREDGDRRSGSEHRDRPLRL
Ga0184621_1036456523300018054Groundwater SedimentGGLMGSVGIVLTVLVVALLWVAAVAFGRDSREEGDRRSGSDHRDRPLRL
Ga0184611_128116923300018067Groundwater SedimentMGSVGIVLTVLVVALLWVAAVAFGRDSREGGDRRSAGDRPLRL
Ga0184635_1007263533300018072Groundwater SedimentMGSVGIVLTVFVVALLWVAAVAFGRDSREGGDRRSAGDRPLRL
Ga0184635_1010082423300018072Groundwater SedimentMGSVGIVLTVLVVALLWVAAVAFGRDSREDGDRRSGSDHRDRPLRL
Ga0184624_1004407423300018073Groundwater SedimentMGSVGIVLMVLVVALLWVAAVAFGRDSREGGDRRSAGDRPLRL
Ga0184624_1043781013300018073Groundwater SedimentMGSIEIALTVLVVVLLWVAAVAFGRDSRDGSDQRSGPDLRDRFLRL
Ga0184640_1035102633300018074Groundwater SedimentMGSVGIVLTVLVVALLWVAAVAFGRDSREDGDRRCGSDHRDRPLRL
Ga0184612_1039298513300018078Groundwater SedimentIVLTVLVVALLWVAAVAFGRDSREDGDRRSGSDHRDRPLRL
Ga0184625_1021241233300018081Groundwater SedimentLTVLVVALLWVAAVAFGRDSREDGDRRSGSDHRDRPLRL
Ga0184625_1061299533300018081Groundwater SedimentMGSVGIVLTVLVVALLWVAAVAFGRDSREDGDRRSGSDHR
Ga0184629_1038999413300018084Groundwater SedimentMGSMGIALTVLVVVLLWVAAVAFGRDSREGSGRPLGTDRRDRFLRL
Ga0190268_1051013533300018466SoilMGSVGIVLTVLVVTLLWVAAVAFGRDSREDGERRSGSDGPLRL
Ga0190270_1105556723300018469SoilMETVEIVLTVLVVALLWVAAVAFGRDSREDGVRRSGGDRRDRALRL
Ga0190270_1264292723300018469SoilMGSIEIALTVLVVVLLWVAAVAFGRDSREGAGRRSGPDLRDRFLRL
Ga0190274_1001293263300018476SoilMGSVGIVLTVLVVALLWVAAVAFGLDSREHGERRSGSDRPLRL
Ga0184646_117493013300019259Groundwater SedimentNGGGGIEPAGGLMGSIGIVLTILVVALLWVAAVAFGRDSREDGDRRSGSEHRDRPLRL
Ga0184644_164770723300019269Groundwater SedimentAARGGLMGSVGIVLTVLVVALLWVAAVAFGRDSREDGDRRSGSDHRDRPLRL
Ga0193697_100239553300020005SoilMGSIGVALTILVVILLWVAAVAFGRDSREGSDRRSGPDLRDRFLRL
Ga0210379_1030657013300021081Groundwater SedimentAIGIALTVLVVVLLWVAAVAFGRDSREGSDRPLGNDRRDRFLRL
Ga0210380_1011782723300021082Groundwater SedimentMGSIGIALTVLVVILLWVAAVAFGRDSREGSERRFGPGQRDRSLRL
Ga0193719_1004712913300021344SoilMGSMGIALTVLVVVLLWVAAVAFGRDSREGFDRRSGPDPRDRFLRL
Ga0222625_131986923300022195Groundwater SedimentMGSVGIVLTVLVVALLWVAAVAFGRDSREDGNRRSGGDHRDRPLRL
Ga0222625_149280213300022195Groundwater SedimentMGSIGIVLTILVVALLWVAAVAFGRDSREDGDRRSGSDHRDRPLRL
Ga0222622_1006307053300022756Groundwater SedimentMGSVGIVLTVLVVALLWVAAVAFGRDSREEGDRRS
Ga0207653_1000178873300025885Corn, Switchgrass And Miscanthus RhizosphereMGSIGLALTVLVVVLLWVAAVAFARDSREGSERRFGPDRRDRSLRL
Ga0207643_10000487113300025908Miscanthus RhizosphereMGSIGLALTVLVVVLLWVAAVAFGRDSREGSERRFGPDRRDRSLRL
Ga0207659_1048273333300025926Miscanthus RhizosphereMGSIEIVLTILVVALLWVAAVAFGRDSREDGERRSAGDPPLRL
Ga0207659_1097582913300025926Miscanthus RhizosphereMGSVGIVLTVLVVALLWVAAVAFGRDSREDGDGRSGSDHRERPLRL
Ga0207690_1013144643300025932Corn RhizosphereMGSIEVVLTILVVALLWVAAVAFGRDSREDGERRSAGDPPLRL
Ga0207669_1138461323300025937Miscanthus RhizosphereMGAIGIALTVLVVVLVWVAAVAFGRDSREGTERRSDPDQRDRFLRL
Ga0207668_1199880413300025972Switchgrass RhizosphereLMGSIEIALTVLVVVLLWVAAVAFGRDSREGSYRRSGSDVRDRFLRL
Ga0207675_10114741813300026118Switchgrass RhizospherePPAARGGLMGSIEIALTVLVVVLLWVAAVAFGRDSREGSYRRSGSDVRDRFLRL
Ga0208891_100668623300026878SoilMGSVGIVLTILVVALLWVAAVAFGGDSREDGDRRSGCDRPDRPLRL
Ga0209896_100105543300027006Groundwater SandMGSVGIVLTVFVVALLWVAAVAFGRDSREDGERRSGGDRRDRALRL
Ga0209879_100410243300027056Groundwater SandMETVEIVLTVLVVALLWVAAVAFGRDSREDGERRSGGDRRDRALRL
Ga0209878_100409413300027163Groundwater SandLTVLVVALLWVAAVAFGRDSREDGERRSGGDRRDRPLRL
Ga0209846_103259823300027277Groundwater SandMETVEIVLTVLVVALLWVAAVAFGRDSREDGDGRSAGDRPLRL
Ga0209887_102521733300027561Groundwater SandMGSVGIVLTVFVVALLWVAAVAFGRDSRENGDRRSGGDRPLRL
Ga0209874_102687623300027577Groundwater SandMGSVGIALTVLVVALLWVAAVAFGRDSREDGDLRSGSDHRDRPLRL
(restricted) Ga0233416_1014457733300027799SedimentMDIAFTVVLLVLLWVAAVAFGRDSREGGDWRSGTDP
Ga0207428_1000204763300027907Populus RhizosphereMGSIEIVLTILVVALLWVAAVAFGRDSREDGERRSAGDRPLRL
Ga0209382_1219729413300027909Populus RhizosphereRLPLAARGGLMGSVGIVLTVLVVALLWVAAVAFGRDSREDADGRSGSDHRERPLRL
Ga0247828_1030362413300028587SoilMGSIEIALTVLVVVLLWVAAVAFGRDSREGSYRRSGSDVRDRFL
Ga0247818_1016143313300028589SoilMGSIGIALTVLVVVLLWVAAVAFGRDSREGSDRRFGPDQHERFLRL
Ga0247818_1067856113300028589SoilMGSIEIALTVLVVVLLWVAAVAFGRDSREGSYRRSGSDVRDRFLRL
Ga0247822_1028921223300028592SoilMGSIEIVLTILVVALLWVAAVAFGRDSREDGDRRSAGDRPLRL
Ga0247822_1129013323300028592SoilMGSIEIALTVLVVVLLWVAAVAFGRDSREGSYRRSGSDMRDRFLRL
Ga0247821_1036121213300028596SoilAARGGLMGSIEIALTVLVVVLLWVAAVAFGRDSREGSYRRSGSDVRDRFLRL
Ga0247821_1094435723300028596SoilMGSIGIALTVVVVVLLWVAAVAFGRDSREGSERRFGPDQHERFLRL
Ga0307295_1014335523300028708SoilMGSIGIALTVLVVVLLWVAAVAFGRDSREGSDRRSGPDPRDRFLRL
Ga0307301_1032982023300028719SoilRGGLMGSIGIALTVLVVVLLWVAAVAFGRDSREGSDRRSGPDPRDRFLRL
Ga0307319_1002054843300028722SoilMGSVEIVLTLLVVALLWVAAVAFGRDSREDGDRRSGNDPPLRL
Ga0307320_1017839613300028771SoilMGSIGVALVILVVILLWVAAVAFGRDSRDGSDQRSGPDLRDRFL
Ga0307290_1003921533300028791SoilMGSVGIVLMVLVVALLWVAAVAFGRDSREGGDRRSAGERPLRL
Ga0247824_1064473213300028809SoilMGSIGIALTVLVVVLLWVAAVAFGRDSREGSERRFGPDQHERFLRL
Ga0307312_1029565313300028828SoilMGSVGIVLTVLVVALLWVAAVAFGRDSREDGDRRSGSDHRDRPL
Ga0307312_1090808223300028828SoilRGGLMGSVGIVLTVLVVALLWVAAVAFGRDSREDGDRRSGSEHRDRPLRL
Ga0307289_1019353733300028875SoilLMGSVGIVLTVLVVALLWVAAVAFGRDSREDGDRRSGSDHRDRPLRL
Ga0307278_1027210913300028878SoilMGSVGIVLTVLVVALLWVAAVAFGRDSREDGDRRSGSDHRDRALRL
Ga0307304_1023639113300028885SoilAARGGLMGSVGIVLTVLVVALLWVAAVAFGRDSREDGDRRSGGDHRDRPLRL
Ga0247827_1066686013300028889SoilGVPPAARGGLMDSIGIALTVLVVVLLWVAAVAFGRDSREGSERRFGPDQHERFLRL
Ga0247826_1022427313300030336SoilMGPVGIVLTLLVVALLWVAAVAFGRDSRENGDRRSGGDRPLRL
Ga0247826_1124447123300030336SoilMGSIEIALTVLVVVLLWVAAVAFARDSREGAYRRSGPDARDRLLRL
Ga0307495_1002694913300031199SoilMGSIGIALTVLVVILLWVAAVAFGRDSRDGSDRRDRFLRL
Ga0307497_1074393523300031226SoilMGAIGIALTLLVVVLLWVAAVAFGRDSREGSERRFGADQRDRFLR
Ga0307468_10001481043300031740Hardwood Forest SoilMGSVGIVLTVLVVALLWVAAVAFGRDSREKGDRRSGGDRPLRL
Ga0307468_10141521123300031740Hardwood Forest SoilMGAIGIALTVLVVVLVWVAAVAFGRDSREGTERRSGPDQRVRFLRL
Ga0310900_1066147313300031908SoilMGSIGLALTVLVVVLLWVAAVAFGRDSREGSERRFGPDRRERSLRL
Ga0310885_1034112433300031943SoilERRVPPAARGGLMGSIGLALTVLVVVLLWVAAVAFGRDSREGAERRSGPDQRDRVLRL
Ga0310897_1039128933300032003SoilPAARGGLMGSIGIALTVLVVVLLWVAAVAFGRDSREGSERRFGPDQHERFLRL
Ga0310890_1094958833300032075SoilGLMGSIEIALTVLVVVLLWVAAVAFGRDSREGSYRRSGSDVRDRFLRL
Ga0307470_1057484913300032174Hardwood Forest SoilMGSVGIVLTVLVVALLWVAAVAFGRDSRENGDRRSGGDRPLRL
Ga0310889_1052745313300032179SoilMGSIEIALTVLVVILLWVAAVAFGRDSREGSERRFGPDRRERSLRL
Ga0310896_1005267733300032211SoilMGSIGIALTVLVVVLLWVAAVAFGRDSREGSERRFGPDRRERSLRL
Ga0214472_1130651433300033407SoilTVLVVALLWVAAVAFGLDSREHGERRSGSDRPLRL
Ga0247830_1138683923300033551SoilMGSIEIALTVLVVVLLWVTAVAFGRDSREGSYRRSGSDVRDRFLRL
Ga0247830_1149214413300033551SoilMEAIGIAFTVLVVVLLWVAAVAFGRDSREGSDRPVGTDPRDRFLRL
Ga0373959_0079385_310_4503300034820Rhizosphere SoilMGSIGIALTVLVVVLLWVAAVAFGRDSRERSERRFGPDQHERFLRL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.