| Basic Information | |
|---|---|
| Family ID | F044694 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 154 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MKKLKEILDQIATGIKNKLGLDGSFAGNYQMAVIRLKHK |
| Number of Associated Samples | 121 |
| Number of Associated Scaffolds | 154 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 25.32 % |
| % of genes near scaffold ends (potentially truncated) | 21.43 % |
| % of genes from short scaffolds (< 2000 bps) | 88.31 % |
| Associated GOLD sequencing projects | 110 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (55.195 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (7.792 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.753 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (55.844 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.37% β-sheet: 11.94% Coil/Unstructured: 62.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 154 Family Scaffolds |
|---|---|---|
| PF14771 | DUF4476 | 33.77 |
| PF02629 | CoA_binding | 2.60 |
| PF00549 | Ligase_CoA | 1.95 |
| PF10670 | DUF4198 | 1.30 |
| PF01835 | MG2 | 1.30 |
| PF07494 | Reg_prop | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 154 Family Scaffolds |
|---|---|---|---|
| COG0045 | Succinyl-CoA synthetase, beta subunit | Energy production and conversion [C] | 1.95 |
| COG0074 | Succinyl-CoA synthetase, alpha subunit | Energy production and conversion [C] | 1.95 |
| COG2373 | Uncharacterized conserved protein YfaS, alpha-2-macroglobulin family | General function prediction only [R] | 1.30 |
| COG3292 | Periplasmic ligand-binding sensor domain | Signal transduction mechanisms [T] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 55.19 % |
| All Organisms | root | All Organisms | 44.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090001|CNB_F6ESG4R02FX251 | Not Available | 587 | Open in IMG/M |
| 2228664022|INPgaii200_c0774119 | Not Available | 1012 | Open in IMG/M |
| 3300000043|ARcpr5yngRDRAFT_c020855 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 555 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101567909 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 999 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101568509 | Not Available | 562 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101569797 | Not Available | 568 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101570403 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 524 | Open in IMG/M |
| 3300000559|F14TC_100204679 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3262 | Open in IMG/M |
| 3300000559|F14TC_102171009 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1393 | Open in IMG/M |
| 3300000579|AP72_2010_repI_A01DRAFT_1001327 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 5082 | Open in IMG/M |
| 3300000955|JGI1027J12803_101345457 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Elateriformia → Elateroidea → Lampyridae → Luciolinae → Abscondita → Abscondita terminalis | 1104 | Open in IMG/M |
| 3300002099|JGI24808J26613_1014263 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 1405 | Open in IMG/M |
| 3300002100|JGI24809J26612_1019236 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales | 1213 | Open in IMG/M |
| 3300002100|JGI24809J26612_1066402 | Not Available | 537 | Open in IMG/M |
| 3300003453|ERB_1005152 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 10000 | Open in IMG/M |
| 3300004114|Ga0062593_100018100 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 3617 | Open in IMG/M |
| 3300004114|Ga0062593_100908375 | Not Available | 891 | Open in IMG/M |
| 3300004463|Ga0063356_100107811 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 3046 | Open in IMG/M |
| 3300004479|Ga0062595_101177491 | Not Available | 678 | Open in IMG/M |
| 3300004479|Ga0062595_101465302 | Not Available | 627 | Open in IMG/M |
| 3300004643|Ga0062591_101852415 | Not Available | 617 | Open in IMG/M |
| 3300005175|Ga0066673_10861517 | Not Available | 516 | Open in IMG/M |
| 3300005184|Ga0066671_10933080 | Not Available | 549 | Open in IMG/M |
| 3300005290|Ga0065712_10277400 | Not Available | 903 | Open in IMG/M |
| 3300005294|Ga0065705_10043556 | Not Available | 843 | Open in IMG/M |
| 3300005328|Ga0070676_10445965 | Not Available | 909 | Open in IMG/M |
| 3300005329|Ga0070683_100714888 | Not Available | 959 | Open in IMG/M |
| 3300005331|Ga0070670_101191589 | Not Available | 696 | Open in IMG/M |
| 3300005332|Ga0066388_104920042 | Not Available | 679 | Open in IMG/M |
| 3300005335|Ga0070666_10417676 | Not Available | 966 | Open in IMG/M |
| 3300005338|Ga0068868_100416369 | Not Available | 1162 | Open in IMG/M |
| 3300005341|Ga0070691_10621488 | Not Available | 640 | Open in IMG/M |
| 3300005353|Ga0070669_101159391 | Not Available | 667 | Open in IMG/M |
| 3300005355|Ga0070671_100087940 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 2600 | Open in IMG/M |
| 3300005355|Ga0070671_101994538 | Not Available | 516 | Open in IMG/M |
| 3300005366|Ga0070659_100393569 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 1169 | Open in IMG/M |
| 3300005535|Ga0070684_100868408 | Not Available | 845 | Open in IMG/M |
| 3300005549|Ga0070704_102257201 | Not Available | 506 | Open in IMG/M |
| 3300005564|Ga0070664_100072870 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2946 | Open in IMG/M |
| 3300005569|Ga0066705_10108160 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1662 | Open in IMG/M |
| 3300005574|Ga0066694_10622065 | Not Available | 503 | Open in IMG/M |
| 3300005578|Ga0068854_100861022 | Not Available | 794 | Open in IMG/M |
| 3300005598|Ga0066706_10388353 | Not Available | 1110 | Open in IMG/M |
| 3300005616|Ga0068852_100925173 | Not Available | 889 | Open in IMG/M |
| 3300005718|Ga0068866_10452878 | Not Available | 839 | Open in IMG/M |
| 3300005841|Ga0068863_100982441 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea | 847 | Open in IMG/M |
| 3300005985|Ga0081539_10062719 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2030 | Open in IMG/M |
| 3300006046|Ga0066652_100407911 | Not Available | 1240 | Open in IMG/M |
| 3300006173|Ga0070716_100144983 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1520 | Open in IMG/M |
| 3300006237|Ga0097621_100672943 | Not Available | 951 | Open in IMG/M |
| 3300006854|Ga0075425_102527192 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 568 | Open in IMG/M |
| 3300006954|Ga0079219_10864260 | Not Available | 724 | Open in IMG/M |
| 3300010046|Ga0126384_12399862 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 510 | Open in IMG/M |
| 3300010048|Ga0126373_10031055 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 4619 | Open in IMG/M |
| 3300010092|Ga0127468_1033614 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 764 | Open in IMG/M |
| 3300010096|Ga0127473_1103310 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 670 | Open in IMG/M |
| 3300010098|Ga0127463_1063138 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1059 | Open in IMG/M |
| 3300010335|Ga0134063_10244089 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 853 | Open in IMG/M |
| 3300010360|Ga0126372_11817092 | Not Available | 653 | Open in IMG/M |
| 3300010362|Ga0126377_10690856 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1072 | Open in IMG/M |
| 3300010366|Ga0126379_10507823 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1278 | Open in IMG/M |
| 3300010376|Ga0126381_100670691 | Not Available | 1481 | Open in IMG/M |
| 3300010400|Ga0134122_10085387 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2477 | Open in IMG/M |
| 3300010403|Ga0134123_10930184 | Not Available | 878 | Open in IMG/M |
| 3300012201|Ga0137365_10008062 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 8407 | Open in IMG/M |
| 3300012201|Ga0137365_10249630 | Not Available | 1320 | Open in IMG/M |
| 3300012212|Ga0150985_109986672 | Not Available | 932 | Open in IMG/M |
| 3300012212|Ga0150985_119896202 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1116 | Open in IMG/M |
| 3300012212|Ga0150985_120708880 | Not Available | 819 | Open in IMG/M |
| 3300012212|Ga0150985_122629051 | Not Available | 946 | Open in IMG/M |
| 3300012224|Ga0134028_1181875 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 648 | Open in IMG/M |
| 3300012224|Ga0134028_1289480 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1021 | Open in IMG/M |
| 3300012285|Ga0137370_10756689 | Not Available | 603 | Open in IMG/M |
| 3300012350|Ga0137372_10185649 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1675 | Open in IMG/M |
| 3300012356|Ga0137371_10414631 | Not Available | 1044 | Open in IMG/M |
| 3300012378|Ga0134025_1109662 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 790 | Open in IMG/M |
| 3300012386|Ga0134046_1053320 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 896 | Open in IMG/M |
| 3300012388|Ga0134031_1157039 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1166 | Open in IMG/M |
| 3300012392|Ga0134043_1258295 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1030 | Open in IMG/M |
| 3300012397|Ga0134056_1230416 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 823 | Open in IMG/M |
| 3300012405|Ga0134041_1015960 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 987 | Open in IMG/M |
| 3300012469|Ga0150984_101572205 | Not Available | 840 | Open in IMG/M |
| 3300012469|Ga0150984_102600118 | Not Available | 811 | Open in IMG/M |
| 3300012495|Ga0157323_1030037 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 571 | Open in IMG/M |
| 3300012511|Ga0157332_1080235 | Not Available | 524 | Open in IMG/M |
| 3300012899|Ga0157299_10154587 | Not Available | 652 | Open in IMG/M |
| 3300012923|Ga0137359_10040536 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 4031 | Open in IMG/M |
| 3300012923|Ga0137359_10185373 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1859 | Open in IMG/M |
| 3300012951|Ga0164300_10350024 | Not Available | 793 | Open in IMG/M |
| 3300012957|Ga0164303_10806679 | Not Available | 646 | Open in IMG/M |
| 3300012957|Ga0164303_10833706 | Not Available | 638 | Open in IMG/M |
| 3300012960|Ga0164301_10407545 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 954 | Open in IMG/M |
| 3300012986|Ga0164304_11481407 | Not Available | 561 | Open in IMG/M |
| 3300013100|Ga0157373_11410026 | Not Available | 530 | Open in IMG/M |
| 3300013296|Ga0157374_10198037 | Not Available | 1966 | Open in IMG/M |
| 3300014969|Ga0157376_10072714 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 2926 | Open in IMG/M |
| 3300014969|Ga0157376_10206958 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1809 | Open in IMG/M |
| 3300014969|Ga0157376_11121595 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 813 | Open in IMG/M |
| 3300015085|Ga0167632_1031085 | Not Available | 707 | Open in IMG/M |
| 3300015371|Ga0132258_11007377 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 2105 | Open in IMG/M |
| 3300015371|Ga0132258_11617655 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1635 | Open in IMG/M |
| 3300015371|Ga0132258_11651775 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1617 | Open in IMG/M |
| 3300015371|Ga0132258_12680423 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1244 | Open in IMG/M |
| 3300015372|Ga0132256_101886048 | Not Available | 705 | Open in IMG/M |
| 3300015373|Ga0132257_100090328 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3508 | Open in IMG/M |
| 3300015373|Ga0132257_104165274 | Not Available | 526 | Open in IMG/M |
| 3300015374|Ga0132255_105432799 | Not Available | 539 | Open in IMG/M |
| 3300017792|Ga0163161_11320830 | Not Available | 627 | Open in IMG/M |
| 3300017792|Ga0163161_11735208 | Not Available | 554 | Open in IMG/M |
| 3300017947|Ga0187785_10088701 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1220 | Open in IMG/M |
| 3300017947|Ga0187785_10384403 | Not Available | 670 | Open in IMG/M |
| 3300017994|Ga0187822_10262287 | Not Available | 597 | Open in IMG/M |
| 3300018482|Ga0066669_10605141 | Not Available | 961 | Open in IMG/M |
| 3300021445|Ga0182009_10068552 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1551 | Open in IMG/M |
| 3300021445|Ga0182009_10084053 | Not Available | 1423 | Open in IMG/M |
| 3300021445|Ga0182009_10198092 | Not Available | 976 | Open in IMG/M |
| 3300021478|Ga0210402_10584079 | Not Available | 1036 | Open in IMG/M |
| 3300024055|Ga0247794_10141969 | Not Available | 745 | Open in IMG/M |
| 3300025315|Ga0207697_10247635 | Not Available | 788 | Open in IMG/M |
| 3300025315|Ga0207697_10284339 | Not Available | 733 | Open in IMG/M |
| 3300025321|Ga0207656_10220650 | Not Available | 921 | Open in IMG/M |
| 3300025899|Ga0207642_10039708 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2048 | Open in IMG/M |
| 3300025899|Ga0207642_10279331 | Not Available | 960 | Open in IMG/M |
| 3300025900|Ga0207710_10360569 | Not Available | 741 | Open in IMG/M |
| 3300025907|Ga0207645_10118791 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1715 | Open in IMG/M |
| 3300025911|Ga0207654_10457026 | Not Available | 896 | Open in IMG/M |
| 3300025913|Ga0207695_10344219 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1378 | Open in IMG/M |
| 3300025919|Ga0207657_10567158 | Not Available | 887 | Open in IMG/M |
| 3300025919|Ga0207657_10744850 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 759 | Open in IMG/M |
| 3300025920|Ga0207649_10067634 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 2269 | Open in IMG/M |
| 3300025920|Ga0207649_10069108 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2248 | Open in IMG/M |
| 3300025923|Ga0207681_10380642 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1136 | Open in IMG/M |
| 3300025931|Ga0207644_10296819 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1301 | Open in IMG/M |
| 3300025931|Ga0207644_10829693 | Not Available | 774 | Open in IMG/M |
| 3300025931|Ga0207644_11429972 | Not Available | 581 | Open in IMG/M |
| 3300025932|Ga0207690_10944762 | Not Available | 716 | Open in IMG/M |
| 3300025934|Ga0207686_11776234 | Not Available | 510 | Open in IMG/M |
| 3300025937|Ga0207669_10901362 | Not Available | 739 | Open in IMG/M |
| 3300025941|Ga0207711_10236976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1672 | Open in IMG/M |
| 3300025944|Ga0207661_10542373 | Not Available | 1065 | Open in IMG/M |
| 3300025945|Ga0207679_11576507 | Not Available | 602 | Open in IMG/M |
| 3300025960|Ga0207651_10291726 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1353 | Open in IMG/M |
| 3300026041|Ga0207639_11244992 | Not Available | 698 | Open in IMG/M |
| 3300026095|Ga0207676_12284867 | Not Available | 538 | Open in IMG/M |
| 3300026323|Ga0209472_1257611 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 557 | Open in IMG/M |
| 3300027775|Ga0209177_10421405 | Not Available | 540 | Open in IMG/M |
| 3300028380|Ga0268265_12685654 | Not Available | 503 | Open in IMG/M |
| 3300031716|Ga0310813_11877231 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 564 | Open in IMG/M |
| 3300032180|Ga0307471_102637462 | Not Available | 637 | Open in IMG/M |
| 3300032955|Ga0335076_10495770 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1105 | Open in IMG/M |
| 3300033004|Ga0335084_10654504 | Not Available | 1073 | Open in IMG/M |
| 3300033412|Ga0310810_10572084 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1096 | Open in IMG/M |
| 3300033412|Ga0310810_10608895 | Not Available | 1046 | Open in IMG/M |
| 3300033475|Ga0310811_10282851 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1929 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.14% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 6.49% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 5.19% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 5.19% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.25% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.60% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.95% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.95% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.30% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.30% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.30% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.30% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.30% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.30% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.30% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.30% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.30% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.65% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.65% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.65% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.65% |
| Volcano-Associated Fumarole | Environmental → Terrestrial → Volcanic → Fumaroles → Unclassified → Volcano-Associated Fumarole | 0.65% |
| Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.65% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.65% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.65% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.65% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090001 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB | Host-Associated | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Host-Associated | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002099 | Soil microbial communities from Manhattan, Kansas, USA - Sample 400um MDA | Environmental | Open in IMG/M |
| 3300002100 | Soil microbial communities from Manhattan, Kansas, USA - Sample 500um MDA | Environmental | Open in IMG/M |
| 3300003453 | Combined Assembly of Gp0111477, Gp0111476 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010092 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010096 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010098 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012224 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012378 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012386 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012388 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012392 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012397 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012405 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Host-Associated | Open in IMG/M |
| 3300012511 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10 | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015085 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4B, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| CNB_02116040 | 2088090001 | Quercus Rhizosphere | MKRLKEILDQIATGIKNKLSLPGSFAGNYQMAVIRLKQII |
| INPgaii200_07741192 | 2228664022 | Soil | MKKLKEILDQIATGIKNKLGLNGSFAGNYQVAVISLKHK |
| ARcpr5yngRDRAFT_0208552 | 3300000043 | Arabidopsis Rhizosphere | MTMEKLKQIFEKLSTGFKNKLGLDGIFSGNYQMAVIYLKK* |
| INPhiseqgaiiFebDRAFT_1015679092 | 3300000364 | Soil | MKKLKEILDQIATGIKHKXGLDGSFAGSYQMAVIYLKK* |
| INPhiseqgaiiFebDRAFT_1015685092 | 3300000364 | Soil | MXKLKXILDQIATGIKXKLGLDGSFAGNYQMAVITLKCK* |
| INPhiseqgaiiFebDRAFT_1015697972 | 3300000364 | Soil | MKKLKEILDQIATGIKNKLGLNGSFAGNYQVAVISLKHK* |
| INPhiseqgaiiFebDRAFT_1015704032 | 3300000364 | Soil | MKKIKDILNQIATGIKNKLGLHGSFAGNYQMAVISLKK* |
| F14TC_1002046792 | 3300000559 | Soil | MEKLKQIFEKLSTGFKNKLGLDGIFSGNYQMAVIYLKK* |
| F14TC_1021710092 | 3300000559 | Soil | MKKLKEILDQIATGIKNKLGLDGSFAGNYQMAVIRLKHK* |
| AP72_2010_repI_A01DRAFT_10013274 | 3300000579 | Forest Soil | MKNLKEILDQLTTGIKHKLGLYGYLAGNYQMAVILKDK* |
| JGI1027J12803_1013454573 | 3300000955 | Soil | LKEILDQIATGIKNKLGLNGSFAGNYQVAVISLKHK* |
| JGI24808J26613_10142632 | 3300002099 | Soil | MNKLKEILDQIATGIKNKLGLDGSFAGNYQMALITLKCK* |
| JGI24809J26612_10192361 | 3300002100 | Soil | MEKIKEILNQIATGIKNKLGLNGSFAGNYQMAVIILKNK* |
| JGI24809J26612_10664023 | 3300002100 | Soil | MNKLKEILDQIATGIKNKLGLNGSFAGNYQMALITLKCK* |
| ERB_10051527 | 3300003453 | Volcano-Associated Fumarole | MKKLKKIVNNITTGIRNKLRQYGSSAGNYQMAPLYLKRK* |
| Ga0062593_1000181005 | 3300004114 | Soil | MKKLKEILDRIATGIKNKLGLDGAFAGNYQMAVITLKCK* |
| Ga0062593_1009083751 | 3300004114 | Soil | MMKLKEILDRIATGIKNKLGLDGSFTGNYQMAVILLKHN* |
| Ga0063356_1001078112 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKKLKEILDQLATGIKNKLGLDGSFAGNYQMAVILLKHK* |
| Ga0062595_1011774912 | 3300004479 | Soil | MKKLKEMLDQIATGIKNKLGLNGSFAGNYQMAVIRLKHK* |
| Ga0062595_1014653022 | 3300004479 | Soil | MKKLKEILDQIATGIKNKLGLDGSSTGNYQMAVIRLKHK* |
| Ga0062591_1018524152 | 3300004643 | Soil | MKKLKKILDQIATGIKHKLGLDGSFAGNYQMAVILLKHK* |
| Ga0066673_108615172 | 3300005175 | Soil | MKKLKEILNQITTGIKNKLGLDGSFAGNYQMAVIILKHKI* |
| Ga0066671_109330801 | 3300005184 | Soil | MKKIKEIFEKIANGISNNPGLPGISSGNYQMAVIILKLK* |
| Ga0065712_102774002 | 3300005290 | Miscanthus Rhizosphere | MKKLKDILDQIATGIKNKLGLDGTFAGNYQMAVILLKHK* |
| Ga0065705_100435562 | 3300005294 | Switchgrass Rhizosphere | MKKLKEILDQIATGIKNKLGLDGSFAGNYQMALITLKCK* |
| Ga0070676_104459651 | 3300005328 | Miscanthus Rhizosphere | MKKLKEILDQIATGIKNKLGLDGSFAGNYQVAVIILKHK* |
| Ga0070683_1007148881 | 3300005329 | Corn Rhizosphere | MKKLKKILDQIATGIKHKLGLDGSFAGNYQMAVILLEHK* |
| Ga0070670_1011915892 | 3300005331 | Switchgrass Rhizosphere | MKKLKEILDQIATGIKNKLGLDGSFAGNYQVAIIILKHK* |
| Ga0066388_1049200422 | 3300005332 | Tropical Forest Soil | MKRLKEILDQIATGIKNKLGLNGSFAGNYQMAVITLKCN* |
| Ga0070666_104176761 | 3300005335 | Switchgrass Rhizosphere | MKKLKEILDRIATGIKNKLGLDGSFAGNYQMAVIRLKQK* |
| Ga0068868_1004163691 | 3300005338 | Miscanthus Rhizosphere | MKKLKMILDQIATGIKNKLGLDGSFAGNYQMAVITLKCK* |
| Ga0070691_106214882 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKLKEILDQIATGIKNKLGLNGSSTGNYQMAVIRLKHK* |
| Ga0070669_1011593912 | 3300005353 | Switchgrass Rhizosphere | MKKLKEILDQIATGIKNKLGLDGSFAGNYQMAVILLKRK* |
| Ga0070671_1000879402 | 3300005355 | Switchgrass Rhizosphere | MNKLKMILDQIATGIKNKLGLDGSFAGNYQMAVITLKCK* |
| Ga0070671_1019945382 | 3300005355 | Switchgrass Rhizosphere | MKKLKDILDQIATGIRNKLGLDGTFAGNYQMAVILLKHK* |
| Ga0070659_1003935692 | 3300005366 | Corn Rhizosphere | MKKLKEILDQIATGIKNKLGPDGSSTGNYQMAVIRLKHK* |
| Ga0070684_1008684081 | 3300005535 | Corn Rhizosphere | MKKLKDILDQIATGIKNKLGLDGTFAGNYQMAVVLLKHK* |
| Ga0070704_1022572012 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKLKEILDRLATGIKNKLGLDGSFAGNYQMAVITLKCK* |
| Ga0070664_1000728702 | 3300005564 | Corn Rhizosphere | MKKLKEILDQIATGIKNKLGLDGSFAGNYQMAIILLKRK* |
| Ga0066705_101081602 | 3300005569 | Soil | VKKIREILNQIATGIKNKLGLDGSFAGNYHMAVIYLKK* |
| Ga0066694_106220652 | 3300005574 | Soil | MKKLKEILNQIATGIKNKLGLNGSFAGNYQMAVSYLKK* |
| Ga0068854_1008610221 | 3300005578 | Corn Rhizosphere | MKLKEILDRIATGIKNKLGLDGSFTGNYQMAVILLKHN* |
| Ga0066706_103883531 | 3300005598 | Soil | MKKIEEILNQITTGIKNKLGLDGSFAGNYQMAVIILKHKI* |
| Ga0068852_1009251731 | 3300005616 | Corn Rhizosphere | MKKLKDILDQIATGIKNKLGLDGSFAGNYQMAIILLKRK* |
| Ga0068866_104528781 | 3300005718 | Miscanthus Rhizosphere | TMKKLKEILDQIATGIKNKLGLDGSFAGNYQVAVIILKHK* |
| Ga0068863_1009824412 | 3300005841 | Switchgrass Rhizosphere | MKKLKQILDQIATGIKNKLGPDGSFAGNYQMALIKLKHK* |
| Ga0081539_100627192 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MKNLKQILEQIFTGLKNKLGLHGIFSGNYQMAVIYLKK* |
| Ga0066652_1004079111 | 3300006046 | Soil | MKKLKEILNQIATGIKNKLGLHGSFAGNYQMAVIYLKK* |
| Ga0070716_1001449832 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKIKEILNQIATGIKNKLGLDGSFAGNYQMAVIYLNK* |
| Ga0097621_1006729432 | 3300006237 | Miscanthus Rhizosphere | MKKLKEILNQIATGIKNKLGLDGSFAGNYQMAVILLKHK* |
| Ga0075425_1025271922 | 3300006854 | Populus Rhizosphere | MKKLKEILNQIATGIKNKLGLNGSFAGNYQMAVIYLKK* |
| Ga0079219_108642602 | 3300006954 | Agricultural Soil | MKRLKEILDQIATGVKNKLGLDGSFAGNYQMAVITLKCK* |
| Ga0126384_123998622 | 3300010046 | Tropical Forest Soil | MKRLKEILDQIATGIKHKLGLDGSFAGSYQMAVIYLKK* |
| Ga0126373_100310553 | 3300010048 | Tropical Forest Soil | MKRLKEILDQIATGIKYKLGLTGSFAGTYQMAVTCLKQ* |
| Ga0127468_10336142 | 3300010092 | Grasslands Soil | AVMKKLKEILNQIATGIKNKLGLHGSFAGNYQMAVIYLKK* |
| Ga0127473_11033101 | 3300010096 | Grasslands Soil | KEILNQIATGIKNKLGLDGSFAGNYQMAVIYLKK* |
| Ga0127463_10631381 | 3300010098 | Grasslands Soil | VVKELIEILNQIATGIKNKLGLHGSFAGNYQMAVIYLKK* |
| Ga0134063_102440892 | 3300010335 | Grasslands Soil | MKKLKEILNQIATGIKNKLGLNVSFAGNYQMAVSYLKK* |
| Ga0126372_118170923 | 3300010360 | Tropical Forest Soil | MKKLKDILDQIATGPDSYRDKNKLGLDGSFAGNYQMAVIH* |
| Ga0126377_106908562 | 3300010362 | Tropical Forest Soil | MKKLKEILDQIATGIKYKLGLDGSFAGSYQMAVIYLKK* |
| Ga0126379_105078232 | 3300010366 | Tropical Forest Soil | MKKIKDILNQIATGIKNKLGLHGSFAGNYQMAVIYLKK* |
| Ga0126381_1006706912 | 3300010376 | Tropical Forest Soil | MKRLKEILDQIATGVKNKLGLTGSFAGTYQMAVIYLKQ* |
| Ga0134122_100853872 | 3300010400 | Terrestrial Soil | MKKLKEILDQIATGVKNKLGLDGSFAGTYQMAVITLKCK* |
| Ga0134123_109301841 | 3300010403 | Terrestrial Soil | EILDQIATGVKNKLGLDGSFAGNYQMAVIRLKQK* |
| Ga0137365_100080628 | 3300012201 | Vadose Zone Soil | MKKLKQILEQISTGVKNKLGLPGIFSGNYQMAVIYLKK* |
| Ga0137365_102496303 | 3300012201 | Vadose Zone Soil | MKKLKEILNQIATGIKNKLGLDGSFAGNYQMAVIILKHKI* |
| Ga0150985_1099866721 | 3300012212 | Avena Fatua Rhizosphere | KKLKKILDEIATGIINKLGLDGSFAGNYQMAVITIKHK* |
| Ga0150985_1198962023 | 3300012212 | Avena Fatua Rhizosphere | KKLKEMLDRIATGIKNKIGLNGSFAGNYQVAVITLKYK* |
| Ga0150985_1207088801 | 3300012212 | Avena Fatua Rhizosphere | LKEILDQIATGIKNKLSLPGSFAGNYQMAVIILKQK* |
| Ga0150985_1226290512 | 3300012212 | Avena Fatua Rhizosphere | KKLKEILDQIATGVKNKLGLDGSFAGSYPMAVITIKHK* |
| Ga0134028_11818751 | 3300012224 | Grasslands Soil | GGCMKKIREILNQIATGIKNKLGLDGSFAGNYQMAIIYLKK* |
| Ga0134028_12894801 | 3300012224 | Grasslands Soil | KKLKEILNQIATGIKNKLGLNGSFAGNYQMAVSYLKK* |
| Ga0137370_107566891 | 3300012285 | Vadose Zone Soil | MKKLKQILEQISTGVKNKLGLSGLFSGNYQMAVIHLKK* |
| Ga0137372_101856492 | 3300012350 | Vadose Zone Soil | MKKLKQILEQISTGVKNKLGLPGIFSGNYQMAIIYLKK* |
| Ga0137371_104146312 | 3300012356 | Vadose Zone Soil | MRKLKEILNQIATGIKNKLGLDGSFAGNYQMAVIILKHKI* |
| Ga0134025_11096621 | 3300012378 | Grasslands Soil | KKLKEILNQIATGIKNKLGLHGSFAGNYQMAVIYLKK* |
| Ga0134046_10533201 | 3300012386 | Grasslands Soil | KKLKEILNQIATGIKNKLGLNGSFAGNYQMAVIYLKK* |
| Ga0134031_11570391 | 3300012388 | Grasslands Soil | KKLKEILNQIATGIKNKLGLDGSFAGNYQMAVINLKK* |
| Ga0134043_12582952 | 3300012392 | Grasslands Soil | VMKKLKEILNQIATGIKNKLGLHGSFAGNYQMAVIYLKK* |
| Ga0134056_12304162 | 3300012397 | Grasslands Soil | KKLKEILNQIATGIKNKLGLDGSFAGNYQMAVIYFKK* |
| Ga0134041_10159601 | 3300012405 | Grasslands Soil | KKLKEILNQIATGIKHKLGLDGSFAGNYQMAVIYLKK* |
| Ga0150984_1015722052 | 3300012469 | Avena Fatua Rhizosphere | KKLKEILDQIATGVKNKLGLDGSFAGSYQMAVITIKHK* |
| Ga0150984_1026001181 | 3300012469 | Avena Fatua Rhizosphere | KEILDQIATGIKNKLSLHGSFAGNYQMAVILKHK* |
| Ga0157323_10300372 | 3300012495 | Arabidopsis Rhizosphere | MKKLKEMLDQIATGIKNKLGLNGSFAGNYQMAVIYLKK* |
| Ga0157332_10802352 | 3300012511 | Soil | MTMEKLKQILEKLSTGFENKLGLDGIFSGNYQMAVIYLKK* |
| Ga0157299_101545871 | 3300012899 | Soil | MKKLKEILDRIATGIKNKLGLDGSFAGNYQMAVIRLIHK* |
| Ga0137359_100405361 | 3300012923 | Vadose Zone Soil | MKKLKQILERISTGVINKPGLHGIFSGNYQMAVIY |
| Ga0137359_101853731 | 3300012923 | Vadose Zone Soil | QKGESMKKLKQILERISTGVINKPGLHGIFSGNYQMAVIYFKK* |
| Ga0164300_103500241 | 3300012951 | Soil | MNKLKEILDQIATGIKNKLGLDGSFAGNYQMAVIRLKHK* |
| Ga0164303_108066793 | 3300012957 | Soil | MKKLKEILDRIATGIKNKLGLDGSFAGNYQMAVITLNCK* |
| Ga0164303_108337061 | 3300012957 | Soil | MKKLKEILDQIATGIKNKLGLNGSFPGNYHMAAILLKYK* |
| Ga0164301_104075452 | 3300012960 | Soil | MNKLKEILNQIATGIKNKLGPDGSFAGNYQMAVIRLKHK* |
| Ga0164304_114814071 | 3300012986 | Soil | MKKLKEILDQIATGIKNKLGPDGSFAGNYQMAVIRLKHK* |
| Ga0157373_114100261 | 3300013100 | Corn Rhizosphere | MKKLKEILDQIATGIKNKLGLDDSSTGNYQMAVIRLKHK* |
| Ga0157374_101980371 | 3300013296 | Miscanthus Rhizosphere | KLKEILDQIATGIKNKLGLDGSFAGNYQMAVIRLKQK* |
| Ga0157376_100727144 | 3300014969 | Miscanthus Rhizosphere | MKKLKQILDQIATGIKNKLGLDGSFAGNYQMALIKLKHK* |
| Ga0157376_102069583 | 3300014969 | Miscanthus Rhizosphere | MKKLKEILDQIATGIKNKLGLNGSFAGNYQMAVIRLKHK* |
| Ga0157376_111215952 | 3300014969 | Miscanthus Rhizosphere | MKKLKQILDQIATGIKNKLGLNGSFAGNYQMAVLKLKHK* |
| Ga0167632_10310851 | 3300015085 | Glacier Forefield Soil | MKKLKEILNQITTGIKNKLGPDGSFAGNYQMAVIILKIKI* |
| Ga0132258_110073773 | 3300015371 | Arabidopsis Rhizosphere | MKNLKQILERISTGVKNKLGLHGIFSGNYQMAVIYLKK* |
| Ga0132258_116176552 | 3300015371 | Arabidopsis Rhizosphere | MKKLKEILDQIATGVKNKLGLDGSFAGNYQMAIISLKRK* |
| Ga0132258_116517753 | 3300015371 | Arabidopsis Rhizosphere | MKKLKEILDQIVTGIKNKLGLDGSFAGNYQMAVSRLKHK* |
| Ga0132258_126804232 | 3300015371 | Arabidopsis Rhizosphere | MKKLKEILEKLSTGVKNKLGLDGIFSGTYQMAVIYLKK* |
| Ga0132256_1018860482 | 3300015372 | Arabidopsis Rhizosphere | MKKLKEILDRIATGIKNKLGLDGSFAGNYQMAVSRLKHK* |
| Ga0132257_1000903282 | 3300015373 | Arabidopsis Rhizosphere | MEKLKQILEKLSTGFENKLGLDGIFSGNYQMAVIYLKK* |
| Ga0132257_1041652742 | 3300015373 | Arabidopsis Rhizosphere | MNKLKEILDQIVTGIKNKLGLDGSFAGTYQMAVITLKCK* |
| Ga0132255_1054327992 | 3300015374 | Arabidopsis Rhizosphere | MKKLKEILEKLSTGVKNKLGLDGIFSGTYQMAVIYL |
| Ga0163161_113208301 | 3300017792 | Switchgrass Rhizosphere | MKKLKEILDQIATGIKNKLGLDGSSTGNYQMAVIRLKHK |
| Ga0163161_117352082 | 3300017792 | Switchgrass Rhizosphere | MKKLKMILDQIATGIKNKLGLDGSFAGNYQMAVITLKCK |
| Ga0187785_100887013 | 3300017947 | Tropical Peatland | MKKLKEILDQLTTGIKHKLGLYGYLAGNYQMAVILKDK |
| Ga0187785_103844032 | 3300017947 | Tropical Peatland | MMKRLKKILDQIATGPDSYRDKNKPGLIGSFAGNYQMAVITLKCK |
| Ga0187822_102622872 | 3300017994 | Freshwater Sediment | MKRIKEILEKIATGIKNKFGLFGYSAGNYQMAVIILK |
| Ga0066669_106051412 | 3300018482 | Grasslands Soil | MKKLKEILNQITTGIKNKLGLDGSFAGNYQMAVIILKHKI |
| Ga0182009_100685522 | 3300021445 | Soil | MKRLKEILDQIATGPDSYRDKNKLGLDGAFAGNHQMAVINLKCK |
| Ga0182009_100840532 | 3300021445 | Soil | MKKLKEILDRIATGIKNKLGLNGSFPGNYQMAIITLKYK |
| Ga0182009_101980922 | 3300021445 | Soil | MKKLKEMLDQIATGIKNKLGLNGSFAGNYQMAVIRLKHK |
| Ga0210402_105840791 | 3300021478 | Soil | MKKVIETLKQISTGIKNKFGLRGYSAGNYHVAVIIIKYK |
| Ga0247794_101419692 | 3300024055 | Soil | MKLKEILDRIATGIKNKLGLDGSFTGNYQMAVILLKHN |
| Ga0207697_102476352 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKLKEILDRIATGIKNKLGLDGSFAGNYQMAVIRLKQK |
| Ga0207697_102843392 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | KLKTMKKLKEILDQIATGIKNKLGLDGSSTGNYQMAVIRLKHK |
| Ga0207656_102206502 | 3300025321 | Corn Rhizosphere | MKKLKDILDQIATGIRNKLGLDGTFAGNYQMAVIRLKQK |
| Ga0207642_100397082 | 3300025899 | Miscanthus Rhizosphere | MKKLKEILDQIATGIKNKLGLDGSFAGNYQVAVIILKHK |
| Ga0207642_102793311 | 3300025899 | Miscanthus Rhizosphere | MNKLKMILDQIATGIKNKLGLDGSFAGNYQMAVITLKCK |
| Ga0207710_103605692 | 3300025900 | Switchgrass Rhizosphere | MKKLKDILDQIATGIKNKLGLDGTFAGNYQMAVILLKHK |
| Ga0207645_101187912 | 3300025907 | Miscanthus Rhizosphere | MKKLKEILDRIATGIKNKLGLDGSFAGNYQMAVIRLKQ |
| Ga0207654_104570261 | 3300025911 | Corn Rhizosphere | MKKLKEILDQIATGIKNKLGLNGSFAGNYQMAVIRLNHK |
| Ga0207695_103442192 | 3300025913 | Corn Rhizosphere | MKKLKEILDQIATGIKNKLGLDGSFAGNYQVAIIILKHK |
| Ga0207657_105671582 | 3300025919 | Corn Rhizosphere | MKKLKEILDQIATGIKNKLGLDGSFAGNYQMAVIRLKHK |
| Ga0207657_107448501 | 3300025919 | Corn Rhizosphere | MKKLKEILDQIATGIKNKLGLDGSFAGNYQMAIILLKRK |
| Ga0207649_100676343 | 3300025920 | Corn Rhizosphere | MKKLKKILDQIATGIKHKLGLDGSFAGNYQMAVILLKHK |
| Ga0207649_100691081 | 3300025920 | Corn Rhizosphere | MMKLKEILDRIATGIKNKLGLDGSFTGNYQMAVILLKHN |
| Ga0207681_103806423 | 3300025923 | Switchgrass Rhizosphere | TMKKLKEILDRIATGIKNKLGLDGSFAGNYQMAVIRLKQK |
| Ga0207644_102968191 | 3300025931 | Switchgrass Rhizosphere | MKKLKQILDQIATGIKNKLGLNGSFAGNYQMAVLELKHK |
| Ga0207644_108296932 | 3300025931 | Switchgrass Rhizosphere | MNKLKMILDQIATGIKNKLGLDGSFAGNYQMAVIRLKHK |
| Ga0207644_114299722 | 3300025931 | Switchgrass Rhizosphere | MKKLKDILDQIATGIRNKLGLDGTFAGNYQMAVILLKHK |
| Ga0207690_109447621 | 3300025932 | Corn Rhizosphere | MKKLKEILDQIATGIKNKLGPDGSSTGNYQMAVIRLKHK |
| Ga0207686_117762341 | 3300025934 | Miscanthus Rhizosphere | MKRLKEILDQIATGIKNKLGLNGSFAGNYQVAVIILKH |
| Ga0207669_109013622 | 3300025937 | Miscanthus Rhizosphere | MKKLKEILDQIATGIKNKLGLDGSFAGNYQMAVIRLKQK |
| Ga0207711_102369764 | 3300025941 | Switchgrass Rhizosphere | MKKLKDILDQIATGIKNKLGLDGSFAGNYQMAVITLKCK |
| Ga0207661_105423731 | 3300025944 | Corn Rhizosphere | MKKLKKILDQIATGIKHKLGLDGSFAGNYQMAVILLEHK |
| Ga0207679_115765071 | 3300025945 | Corn Rhizosphere | MKKLKQILDQIATGIKNKLGLNGSFAGNYQMAVLKLKHK |
| Ga0207651_102917262 | 3300025960 | Switchgrass Rhizosphere | MKKLKEMLDQIATGIKNKLGLNGSFAGNYKMAVIRLKHK |
| Ga0207639_112449922 | 3300026041 | Corn Rhizosphere | MKKLKEILDRIATGIKNKLGLDGSFAGIYQMAVIRLKQK |
| Ga0207676_122848672 | 3300026095 | Switchgrass Rhizosphere | FEGKSITMKKLKEILDQIATGIKNKLGLDGSFAGNYQVAIIILKHK |
| Ga0209472_12576111 | 3300026323 | Soil | MKKLKEILNQIATGIKNKLGLNGSFAGNYQMAVSYLKK |
| Ga0209177_104214051 | 3300027775 | Agricultural Soil | AKQLVMKRLKEILDQIATGVKNKLDLDGSFAGNYQMAVITLKCK |
| Ga0268265_126856541 | 3300028380 | Switchgrass Rhizosphere | MKKLKEILDQIATGIKNKLGLDGSFAGNYQMAVILLKRK |
| Ga0310813_118772311 | 3300031716 | Soil | QKGKPMKNLKQILERISTGVKNKLGLHGIFSGNYQMAVIYLKK |
| Ga0307471_1026374621 | 3300032180 | Hardwood Forest Soil | MNKLKEILNQIATGIKNKLGPDGSFAGNYQMAVIRLKHK |
| Ga0335076_104957701 | 3300032955 | Soil | AMKKLKEILDQLTTGIKNKLGLYGYLAGNYQMAVILKDK |
| Ga0335084_106545042 | 3300033004 | Soil | MKKLKKILDQLATGIKHKFGLYGYLAGNHQMAAILKDK |
| Ga0310810_105720842 | 3300033412 | Soil | MKNLKQILERISTGVKNKLGLHGIFSGNYQMAVIYLKK |
| Ga0310810_106088952 | 3300033412 | Soil | MKKLKEILDRIATGIKNKLGLDGAFAGNYQMAVITLKCK |
| Ga0310811_102828513 | 3300033475 | Soil | MKKLKEILDRIATGIKNKLGLDGAFAGNYQMAIITIKCK |
| ⦗Top⦘ |