| Basic Information | |
|---|---|
| Family ID | F044471 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 154 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MPREYKPPSPRTISTFVYLAVLVIGVLLAYVAVRALFA |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 153 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 84.42 % |
| % of genes near scaffold ends (potentially truncated) | 9.74 % |
| % of genes from short scaffolds (< 2000 bps) | 77.27 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.104 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (21.429 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.818 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (31.169 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.42% β-sheet: 0.00% Coil/Unstructured: 57.58% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 153 Family Scaffolds |
|---|---|---|
| PF01042 | Ribonuc_L-PSP | 63.40 |
| PF00731 | AIRC | 14.38 |
| PF02843 | GARS_C | 7.84 |
| PF00206 | Lyase_1 | 4.58 |
| PF13239 | 2TM | 3.92 |
| PF10397 | ADSL_C | 2.61 |
| PF02844 | GARS_N | 0.65 |
| PF12399 | BCA_ABC_TP_C | 0.65 |
| PF00275 | EPSP_synthase | 0.65 |
| PF00768 | Peptidase_S11 | 0.65 |
| PF00465 | Fe-ADH | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 153 Family Scaffolds |
|---|---|---|---|
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 63.40 |
| COG0151 | Phosphoribosylamine-glycine ligase | Nucleotide transport and metabolism [F] | 8.50 |
| COG0337 | 3-dehydroquinate synthetase | Amino acid transport and metabolism [E] | 0.65 |
| COG0371 | Glycerol dehydrogenase or related enzyme, iron-containing ADH family | Energy production and conversion [C] | 0.65 |
| COG1454 | Alcohol dehydrogenase, class IV | Energy production and conversion [C] | 0.65 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
| COG1979 | Alcohol dehydrogenase YqhD, Fe-dependent ADH family | Energy production and conversion [C] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.10 % |
| Unclassified | root | N/A | 3.90 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090008|P3_DRAFT_NODE_92193_len_1456_cov_19_109890 | All Organisms → cellular organisms → Bacteria | 1506 | Open in IMG/M |
| 2088090008|P3_DRAFT_NODE_92193_len_1456_cov_19_109890 | All Organisms → cellular organisms → Bacteria | 1506 | Open in IMG/M |
| 2124908041|P3_CLC_ConsensusfromContig47509 | All Organisms → cellular organisms → Bacteria | 1971 | Open in IMG/M |
| 3300000506|Soeholt_1014197 | All Organisms → cellular organisms → Bacteria | 1635 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_103093791 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300001870|JGI24129J20441_1005356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3932 | Open in IMG/M |
| 3300002068|JGIcombinedJ21913_10042003 | All Organisms → cellular organisms → Bacteria | 2012 | Open in IMG/M |
| 3300002071|JGIcombinedJ21915_10015396 | All Organisms → cellular organisms → Bacteria | 3454 | Open in IMG/M |
| 3300002071|JGIcombinedJ21915_10180308 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300005938|Ga0066795_10100266 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300005947|Ga0066794_10075096 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300005947|Ga0066794_10205712 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300006102|Ga0075015_100163943 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
| 3300006619|Ga0075529_1004791 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300006864|Ga0066797_1215584 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300006949|Ga0075528_10015413 | All Organisms → cellular organisms → Bacteria | 1872 | Open in IMG/M |
| 3300006949|Ga0075528_10064019 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300009029|Ga0066793_10317885 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300009029|Ga0066793_10899290 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300009078|Ga0105106_10333148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 1097 | Open in IMG/M |
| 3300009087|Ga0105107_11191819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 531 | Open in IMG/M |
| 3300009120|Ga0117941_1008245 | All Organisms → cellular organisms → Bacteria | 3678 | Open in IMG/M |
| 3300009120|Ga0117941_1012650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2254 | Open in IMG/M |
| 3300009131|Ga0115027_11725018 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300009167|Ga0113563_13823423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 510 | Open in IMG/M |
| 3300009171|Ga0105101_10551849 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300009502|Ga0114951_10108639 | All Organisms → cellular organisms → Bacteria | 1569 | Open in IMG/M |
| 3300009607|Ga0123327_1122302 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300009652|Ga0123330_1346063 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300009868|Ga0130016_10006176 | All Organisms → cellular organisms → Bacteria | 21493 | Open in IMG/M |
| 3300011997|Ga0120162_1016810 | All Organisms → cellular organisms → Bacteria | 2431 | Open in IMG/M |
| 3300011997|Ga0120162_1121888 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300012411|Ga0153880_1033477 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10441551 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| (restricted) 3300013137|Ga0172375_10968812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 508 | Open in IMG/M |
| (restricted) 3300013138|Ga0172371_10795391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 626 | Open in IMG/M |
| 3300014256|Ga0075318_1004551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1680 | Open in IMG/M |
| 3300014257|Ga0075319_1002751 | All Organisms → cellular organisms → Bacteria | 2256 | Open in IMG/M |
| 3300014257|Ga0075319_1081025 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300014266|Ga0075359_1052439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 723 | Open in IMG/M |
| 3300014272|Ga0075327_1193408 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300014307|Ga0075304_1011941 | All Organisms → cellular organisms → Bacteria | 1761 | Open in IMG/M |
| 3300014312|Ga0075345_1164544 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300014316|Ga0075339_1075585 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300014319|Ga0075348_1195541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 557 | Open in IMG/M |
| 3300014494|Ga0182017_10229444 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300014502|Ga0182021_10039819 | All Organisms → cellular organisms → Bacteria | 5511 | Open in IMG/M |
| 3300017947|Ga0187785_10705797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 530 | Open in IMG/M |
| 3300018060|Ga0187765_10216229 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300020163|Ga0194039_1071624 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
| 3300020163|Ga0194039_1308445 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300020228|Ga0194040_1068966 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300020228|Ga0194040_1084633 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300020228|Ga0194040_1106543 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300020228|Ga0194040_1240163 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300021072|Ga0194057_10152995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 823 | Open in IMG/M |
| 3300021074|Ga0194044_10402107 | Not Available | 511 | Open in IMG/M |
| 3300021074|Ga0194044_10413482 | Not Available | 502 | Open in IMG/M |
| 3300021075|Ga0194063_10103932 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300021075|Ga0194063_10118887 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300021075|Ga0194063_10268811 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300021473|Ga0194043_1048908 | All Organisms → cellular organisms → Bacteria | 1662 | Open in IMG/M |
| 3300021473|Ga0194043_1270685 | Not Available | 546 | Open in IMG/M |
| 3300021605|Ga0194054_10041095 | All Organisms → cellular organisms → Bacteria | 1698 | Open in IMG/M |
| 3300022555|Ga0212088_10177214 | All Organisms → cellular organisms → Bacteria | 1741 | Open in IMG/M |
| 3300025443|Ga0208081_1002828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3479 | Open in IMG/M |
| 3300025443|Ga0208081_1072212 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300025461|Ga0208851_1002252 | All Organisms → cellular organisms → Bacteria | 5801 | Open in IMG/M |
| 3300025481|Ga0208079_1021036 | All Organisms → cellular organisms → Bacteria | 1954 | Open in IMG/M |
| 3300025495|Ga0207932_1027049 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
| 3300025533|Ga0208584_1066256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 908 | Open in IMG/M |
| 3300025575|Ga0209430_1017937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2666 | Open in IMG/M |
| 3300025739|Ga0209745_1155988 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300025739|Ga0209745_1246347 | Not Available | 509 | Open in IMG/M |
| 3300025764|Ga0209539_1135443 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300025764|Ga0209539_1330455 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300025846|Ga0209538_1331583 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300025854|Ga0209176_10126058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 623 | Open in IMG/M |
| 3300025857|Ga0209014_10019593 | All Organisms → cellular organisms → Bacteria | 3289 | Open in IMG/M |
| 3300025857|Ga0209014_10034448 | All Organisms → cellular organisms → Bacteria | 2302 | Open in IMG/M |
| 3300025967|Ga0210136_1005569 | All Organisms → cellular organisms → Bacteria | 1334 | Open in IMG/M |
| 3300026195|Ga0209312_1128840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 616 | Open in IMG/M |
| 3300026271|Ga0209880_1003943 | All Organisms → cellular organisms → Bacteria | 4227 | Open in IMG/M |
| 3300027051|Ga0209269_1000007 | All Organisms → cellular organisms → Bacteria | 550542 | Open in IMG/M |
| 3300027818|Ga0209706_10113585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 1344 | Open in IMG/M |
| 3300027818|Ga0209706_10541662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 528 | Open in IMG/M |
| 3300027841|Ga0209262_10017078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3037 | Open in IMG/M |
| 3300027841|Ga0209262_10205574 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300027841|Ga0209262_10570859 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300027885|Ga0209450_10021262 | All Organisms → cellular organisms → Bacteria | 3681 | Open in IMG/M |
| 3300027885|Ga0209450_10108479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1856 | Open in IMG/M |
| 3300027897|Ga0209254_10044237 | All Organisms → cellular organisms → Bacteria | 3918 | Open in IMG/M |
| 3300027897|Ga0209254_10058175 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3346 | Open in IMG/M |
| 3300027899|Ga0209668_10230991 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
| 3300027899|Ga0209668_10662937 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300027899|Ga0209668_11009348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 561 | Open in IMG/M |
| 3300027900|Ga0209253_10250116 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
| 3300027900|Ga0209253_10927441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 608 | Open in IMG/M |
| 3300028176|Ga0268284_1007271 | All Organisms → cellular organisms → Bacteria | 3811 | Open in IMG/M |
| (restricted) 3300028581|Ga0247840_10001180 | All Organisms → cellular organisms → Bacteria | 52206 | Open in IMG/M |
| 3300028732|Ga0302264_1010950 | All Organisms → cellular organisms → Bacteria | 2089 | Open in IMG/M |
| 3300028733|Ga0302261_1040260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 1092 | Open in IMG/M |
| 3300028743|Ga0302262_10087949 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300028865|Ga0302291_10157925 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300029288|Ga0265297_10254122 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300030002|Ga0311350_10260275 | All Organisms → cellular organisms → Bacteria | 1546 | Open in IMG/M |
| 3300030050|Ga0302255_1050994 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300030114|Ga0311333_10242732 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
| 3300031691|Ga0316579_10360541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 703 | Open in IMG/M |
| 3300031746|Ga0315293_10151285 | All Organisms → cellular organisms → Bacteria | 1936 | Open in IMG/M |
| 3300031834|Ga0315290_10069741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2901 | Open in IMG/M |
| 3300031834|Ga0315290_10163513 | All Organisms → cellular organisms → Bacteria | 1920 | Open in IMG/M |
| 3300031834|Ga0315290_10228466 | All Organisms → cellular organisms → Bacteria | 1621 | Open in IMG/M |
| 3300031834|Ga0315290_10245692 | All Organisms → cellular organisms → Bacteria | 1561 | Open in IMG/M |
| 3300031834|Ga0315290_10879907 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300031834|Ga0315290_10899273 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300031834|Ga0315290_11379945 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300031873|Ga0315297_10120031 | All Organisms → cellular organisms → Bacteria | 2106 | Open in IMG/M |
| 3300031997|Ga0315278_10115854 | All Organisms → cellular organisms → Bacteria | 2714 | Open in IMG/M |
| 3300031997|Ga0315278_10195073 | All Organisms → cellular organisms → Bacteria | 2083 | Open in IMG/M |
| 3300031997|Ga0315278_12135173 | Not Available | 520 | Open in IMG/M |
| 3300032018|Ga0315272_10002246 | All Organisms → cellular organisms → Bacteria | 9458 | Open in IMG/M |
| 3300032018|Ga0315272_10043724 | All Organisms → cellular organisms → Bacteria | 2025 | Open in IMG/M |
| 3300032018|Ga0315272_10203818 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300032018|Ga0315272_10463462 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300032018|Ga0315272_10591239 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300032143|Ga0315292_10262827 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
| 3300032143|Ga0315292_11284212 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300032156|Ga0315295_10049777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3925 | Open in IMG/M |
| 3300032164|Ga0315283_10990193 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300032164|Ga0315283_11279194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 762 | Open in IMG/M |
| 3300032173|Ga0315268_10081712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3044 | Open in IMG/M |
| 3300032173|Ga0315268_10090474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2883 | Open in IMG/M |
| 3300032173|Ga0315268_10104351 | All Organisms → cellular organisms → Bacteria | 2675 | Open in IMG/M |
| 3300032173|Ga0315268_11052248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 821 | Open in IMG/M |
| 3300032177|Ga0315276_11193440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 802 | Open in IMG/M |
| 3300032275|Ga0315270_10598781 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300032342|Ga0315286_10388135 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
| 3300032397|Ga0315287_11195640 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300032397|Ga0315287_12115934 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300032397|Ga0315287_12909534 | Not Available | 504 | Open in IMG/M |
| 3300032516|Ga0315273_11200732 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300032897|Ga0335071_10097762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2879 | Open in IMG/M |
| 3300032897|Ga0335071_10417977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 1294 | Open in IMG/M |
| 3300032897|Ga0335071_10559839 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300033408|Ga0316605_11553292 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300033434|Ga0316613_10863834 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300033521|Ga0316616_101732303 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300034123|Ga0370479_0073596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 878 | Open in IMG/M |
| 3300034126|Ga0370486_081959 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300034128|Ga0370490_0066826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 1175 | Open in IMG/M |
| 3300034195|Ga0370501_0204303 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300034281|Ga0370481_0012307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 2378 | Open in IMG/M |
| 3300034281|Ga0370481_0118990 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 21.43% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 14.29% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 9.74% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 6.49% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 5.84% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 4.55% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.90% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.90% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 3.90% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 3.25% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.60% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 1.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 1.95% |
| Anaerobic Biogas Reactor | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor | 1.95% |
| Lake Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment | 1.30% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.30% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.30% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.30% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.30% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.65% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 0.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.65% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.65% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.65% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.65% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.65% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.65% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 0.65% |
| Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.65% |
| Anaerobic Digester | Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Activated Sludge → Anaerobic Digester | 0.65% |
| Enrichment Culture | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090008 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3 | Environmental | Open in IMG/M |
| 2124908041 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3 | Environmental | Open in IMG/M |
| 3300000506 | Anaerobic digester microbial communities from Northern Denmark, sample from Soeholt sludge | Engineered | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001870 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 | Environmental | Open in IMG/M |
| 3300002068 | Barrow Graham LP Ref core NGADG0004-212 (Barrow Graham LP Ref core NGADG0004-212,NGADG0011-311, ASSEMBLY_DATE=20131010) | Environmental | Open in IMG/M |
| 3300002071 | Barrow Graham LP Ref core NGADG0011-312 (Barrow Graham LP Ref core NGADG0011-312,NGADG0011-212, ASSEMBLY_DATE=20131010) | Environmental | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006619 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-4B | Environmental | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300006949 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009120 | Lake sediment microbial communities from Tanners Lake, St. Paul, MN | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
| 3300009607 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C13 SIP DNA | Engineered | Open in IMG/M |
| 3300009652 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_A C13 SIP DNA | Engineered | Open in IMG/M |
| 3300009868 | Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant | Engineered | Open in IMG/M |
| 3300011997 | Permafrost microbial communities from Nunavut, Canada - A15_80cm_18M | Environmental | Open in IMG/M |
| 3300012411 | Freshwater microbial communities from Lake Alinen Mustaj?rvi, Finland - AM7a metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013123 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11m | Environmental | Open in IMG/M |
| 3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
| 3300013138 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_12m | Environmental | Open in IMG/M |
| 3300014256 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleB_D2 | Environmental | Open in IMG/M |
| 3300014257 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014266 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014272 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014307 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D1 | Environmental | Open in IMG/M |
| 3300014312 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1 | Environmental | Open in IMG/M |
| 3300014316 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1 | Environmental | Open in IMG/M |
| 3300014319 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300020163 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L227-8m | Environmental | Open in IMG/M |
| 3300020228 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L227-10m | Environmental | Open in IMG/M |
| 3300021072 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-15m | Environmental | Open in IMG/M |
| 3300021074 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-17m | Environmental | Open in IMG/M |
| 3300021075 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L373-20m | Environmental | Open in IMG/M |
| 3300021473 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-15m | Environmental | Open in IMG/M |
| 3300021605 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L227-10m | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300025443 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025461 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025481 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025495 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025533 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025575 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 11-33A (SPAdes) | Environmental | Open in IMG/M |
| 3300025739 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-312 (SPAdes) | Environmental | Open in IMG/M |
| 3300025764 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-312 (SPAdes) | Environmental | Open in IMG/M |
| 3300025846 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211 (SPAdes) | Environmental | Open in IMG/M |
| 3300025854 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B (SPAdes) | Environmental | Open in IMG/M |
| 3300025857 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 (SPAdes) | Environmental | Open in IMG/M |
| 3300025967 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026195 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C13 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300026271 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 (SPAdes) | Environmental | Open in IMG/M |
| 3300027051 | Enrichment culture microbial communities from Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKM (Arthur Kill Methanogenic) MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027841 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300028176 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_40m | Environmental | Open in IMG/M |
| 3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
| 3300028732 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300028733 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_4 | Environmental | Open in IMG/M |
| 3300028743 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4 | Environmental | Open in IMG/M |
| 3300028865 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_4 | Environmental | Open in IMG/M |
| 3300029288 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 137-91 | Engineered | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030050 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_4 | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Host-Associated | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300034123 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_15 | Environmental | Open in IMG/M |
| 3300034126 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_16 | Environmental | Open in IMG/M |
| 3300034128 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16 | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| 3300034281 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| P3_DRAFT_00172500 | 2088090008 | Soil | MPREYKPPSPRTISTFIYVAVLVIGVLLAFVAVRALFA |
| P3_DRAFT_00172510 | 2088090008 | Soil | MPREYKPPSSRTISTFIYFAVLVIGVLLAFVAVRALFA |
| P3_CLC_01310120 | 2124908041 | Soil | MPREYKPPSPRTISTFIYFAVLVIGVLLAFVAVRALFA |
| Soeholt_10141974 | 3300000506 | Anaerobic Digester | MPRNDRPPSPKTISGFLYVAVVLIAVALIYVAVRALLA* |
| JGIcombinedJ13530_1030937912 | 3300001213 | Wetland | MSRKYKPPSPRSISTFIYFAVLTIGVLLAYVAVRALFA* |
| JGI24129J20441_10053567 | 3300001870 | Arctic Peat Soil | MPREYKPPSPRTISTLIYFAVLVIGALLAFVAVRALFA* |
| JGIcombinedJ21913_100420033 | 3300002068 | Arctic Peat Soil | MPKDYRPPSARTISNFVYLAVLVIAILLAYVAVRSLFG* |
| JGIcombinedJ21915_100153966 | 3300002071 | Arctic Peat Soil | MPREYKPPSPRSISTFIYFAVLVIGVLLAFVALRALFA* |
| JGIcombinedJ21915_101803082 | 3300002071 | Arctic Peat Soil | MPREHKPPSPRTISTFIYLAVLVIGVLLVFVAVRALFA* |
| Ga0066795_101002662 | 3300005938 | Soil | MPREYKPPSPRTISTFIYFAVLVIGVLLAFVAVRALFA* |
| Ga0066794_100750963 | 3300005947 | Soil | MPREYKPPSPRTISTFIYFAVLVIGVFLAFVAVRALFA* |
| Ga0066794_102057122 | 3300005947 | Soil | MPREYKPPSPRTISTFIYVAVLVIGVLLAFVAVRALFA* |
| Ga0075015_1001639433 | 3300006102 | Watersheds | MPRDHRPPNPRTISTFIYLVVLVMAVLIAYVAIRALFA* |
| Ga0075529_10047913 | 3300006619 | Arctic Peat Soil | VPKDYRPPNPKTISSFVYLAVLVIGILLAYVAVRSLFG* |
| Ga0066797_12155842 | 3300006864 | Soil | VPKDYRPPNPQTISSFVYLAVLVIGILLAYVAMRSLFG* |
| Ga0075528_100154133 | 3300006949 | Arctic Peat Soil | VPKDYRPPNPKTISSFVYLAVLVNGILLAYVAVRSLFG* |
| Ga0075528_100640191 | 3300006949 | Arctic Peat Soil | GSPMPREYKPPSPRTISTFIYFAVLVIGVFLAFVAVRALFA* |
| Ga0066793_103178851 | 3300009029 | Prmafrost Soil | RTRGSPMPREYKPPSPRTISTFIYVAVLVIGVLLAFVAVRALFA* |
| Ga0066793_108992902 | 3300009029 | Prmafrost Soil | MPREYKPPSPRTISTLIYFAVLVIGVLLAFVAVRALFA* |
| Ga0105106_103331482 | 3300009078 | Freshwater Sediment | VPRNDKPPSPRTISGFLYFAVLFIAVALAYVAVRALLA* |
| Ga0105107_111918192 | 3300009087 | Freshwater Sediment | VPRNDQPPSPKTISGFLYVAVLVIAVALAYVAVRALLA* |
| Ga0117941_10082456 | 3300009120 | Lake Sediment | MPRNDQPPSPRTISGFLYVAVLLIAVALVYVAVRALLA* |
| Ga0117941_10126502 | 3300009120 | Lake Sediment | VPRNDKPPSPRTISGFLYVTVLIIAVALAYVAVRALLA* |
| Ga0115027_117250182 | 3300009131 | Wetland | PRNDKPPSPRTISGFLYIAVLIIAVALAYVALRALLA* |
| Ga0113563_138234231 | 3300009167 | Freshwater Wetlands | VPRNDKPPSPRTISGFLYIAVLVIAVALAYVAVRALLA* |
| Ga0105101_105518491 | 3300009171 | Freshwater Sediment | RRVPRNDKPPSPRTISSFLYFAVLFIAVALAYVAVRALLA* |
| Ga0114951_101086392 | 3300009502 | Freshwater | MPRDHRPPDPKTVSTYIYLAVLVMAVLIAYVAVRALFT* |
| Ga0123327_11223022 | 3300009607 | Anaerobic Biogas Reactor | MPRDQKPPSPRTISGFLYVAVALIAVALACVAVRALLA* |
| Ga0123330_13460632 | 3300009652 | Anaerobic Biogas Reactor | VPRDQKPPSPRTISGFLYVAVALIAVALACVAVRALLA* |
| Ga0130016_1000617615 | 3300009868 | Wastewater | MPSNDKPPSPRTISGFLHVAVLAIAVALAYVAVRALVT* |
| Ga0120162_10168103 | 3300011997 | Permafrost | MPREHKPPSPRTISTFVYFAVLVIGLLLAFVAVRALFA* |
| Ga0120162_11218882 | 3300011997 | Permafrost | MPREYKPPSPRTISTFIYFAVLVIGVLLVFVAVRALFA* |
| Ga0153880_10334772 | 3300012411 | Freshwater Sediment | MPRQYKPPSPRSISTFIYFAVLVIGVLLAFVAVRALFA* |
| (restricted) Ga0172368_104415512 | 3300013123 | Freshwater | VPRNNQPPSPRTISGFLYIAVLLIAVALVYVAVRALFA* |
| (restricted) Ga0172375_109688121 | 3300013137 | Freshwater | VPRNDQPPSPRTISGFLYIAVLLIAVALAYVAVRALLA* |
| (restricted) Ga0172371_107953912 | 3300013138 | Freshwater | MPKDHRPPSPKTISSFVYLAVLAIAIILAYVAVRSLFS* |
| Ga0075318_10045514 | 3300014256 | Natural And Restored Wetlands | MPRNDQPPSPKTISGFLYVAVLLIAVALVYVAVRALFA* |
| Ga0075319_10027513 | 3300014257 | Natural And Restored Wetlands | VPRNDQPPSPRTISGFLYIAVLLIAAALVYVAVRALLA* |
| Ga0075319_10810252 | 3300014257 | Natural And Restored Wetlands | VPRNDKPPSPRTISGFLYVAVLLIAVALAYVAVRALLA* |
| Ga0075359_10524392 | 3300014266 | Natural And Restored Wetlands | VPRNDKPPSPRTISGFLYIAVLLIAVALAYVAVRALLA* |
| Ga0075327_11934082 | 3300014272 | Natural And Restored Wetlands | VPRNDKPPSPKTISGFLYIAVLAIAVALVYVAVRALLA* |
| Ga0075304_10119413 | 3300014307 | Natural And Restored Wetlands | MPRNDQPPSPRTVSGFLYIAVLVIAVALVYVAVRALFA* |
| Ga0075345_11645442 | 3300014312 | Natural And Restored Wetlands | VPRNDQPPSPRTISGVLYVAVLLIAVALASVAVRSLLA* |
| Ga0075339_10755852 | 3300014316 | Natural And Restored Wetlands | VPRNDKPPSPRTISGFLYFAVLLIAVALAYVAVRALLA* |
| Ga0075348_11955412 | 3300014319 | Natural And Restored Wetlands | VPRNDQPPSPRTISGFLYFAVLFIAVALAYVAVRALLA* |
| Ga0182017_102294443 | 3300014494 | Fen | VGRPPRRPPDPHTISRLLYVAVAIIALLLIYVAVRAALN* |
| Ga0182021_100398192 | 3300014502 | Fen | MPKDYRPPSPKTISNFLYVVVLVIAILLAYVAVRSLFG* |
| Ga0187785_107057972 | 3300017947 | Tropical Peatland | VPRNDKPPSPRTISGFLYVAVLLIAVALAYVAVRALLA |
| Ga0187765_102162293 | 3300018060 | Tropical Peatland | VPRNDKPPSPRTISSFLYIVVLLIAIALAYVAVRALLA |
| Ga0194039_10716241 | 3300020163 | Anoxic Zone Freshwater | MPREYKPPSPRTISTFVYFVVLVIGVLLAYVAVRALFA |
| Ga0194039_13084452 | 3300020163 | Anoxic Zone Freshwater | MPPEYKPPSPRTISTFIYLAVLVIGVLLAFVALRALFA |
| Ga0194040_10689662 | 3300020228 | Anoxic Zone Freshwater | MPRDHKPPSPRTISTFVYLAVLVIGVLLALVALRALFA |
| Ga0194040_10846332 | 3300020228 | Anoxic Zone Freshwater | MPRQYKPPSPRSISTFIYFAVLVIGVLLAFVAVRALFA |
| Ga0194040_11065433 | 3300020228 | Anoxic Zone Freshwater | PPPEYKPPSPRTISTFIYLAVLVIGVLLAFVALRALFA |
| Ga0194040_12401631 | 3300020228 | Anoxic Zone Freshwater | RGSPMPREYKPPSPRTISTFVYFVVLVIGVLLAYVAVRALFA |
| Ga0194057_101529952 | 3300021072 | Anoxic Zone Freshwater | MPRDYRPPSPKTVSTFVYLAVLVIAVLIAYVAIRALFT |
| Ga0194044_104021072 | 3300021074 | Anoxic Zone Freshwater | MPREYKPPSPRTLSTFIYLAVLVIGVLLAYVAMRALFA |
| Ga0194044_104134822 | 3300021074 | Anoxic Zone Freshwater | MPRDYRPPSPRTISMFIYLALLVIGVLLAYVAVRALFA |
| Ga0194063_101039322 | 3300021075 | Anoxic Zone Freshwater | MPHDHRPPSPRTISTFIYLAVLVIGVLLAFVALRALFA |
| Ga0194063_101188872 | 3300021075 | Anoxic Zone Freshwater | MPREYKPPSPRTISTFVYFAVLVIGVLLAYVAVRALFA |
| Ga0194063_102688112 | 3300021075 | Anoxic Zone Freshwater | MPREHKPPSPRTISTFIYFAVLVIGVLLAFVAVRALFA |
| Ga0194043_10489084 | 3300021473 | Anoxic Zone Freshwater | MPRDYRPPNPKTVSTFVYLAVLMIAVLIAYVAIRALFT |
| Ga0194043_12706851 | 3300021473 | Anoxic Zone Freshwater | MPRDYKPPSPRTISTFVYFAVLVIGVLLAFVALRALFA |
| Ga0194054_100410953 | 3300021605 | Anoxic Zone Freshwater | MPRDYKPPSPRTISMFIYLAVLVIGVLLAFVALRALFA |
| Ga0212088_101772142 | 3300022555 | Freshwater Lake Hypolimnion | MPRDHRPPDPKTVSTYIYLAVLVMAVLIAYVAVRALFT |
| Ga0208081_10028284 | 3300025443 | Arctic Peat Soil | VPKDYRPPNPKTIASFIYLAVLVIGILLAYVAVRSLFG |
| Ga0208081_10722122 | 3300025443 | Arctic Peat Soil | ATERRMPRNDQPPSPKTISGFLYVAVLLIAVALAYVAVRALFA |
| Ga0208851_10022524 | 3300025461 | Arctic Peat Soil | MPRNDQPPSPKTISGFLYVAVLLIAVALAYVAVRALFA |
| Ga0208079_10210362 | 3300025481 | Arctic Peat Soil | MPREYKPPSPRTISTLIYFAVLVIGALLAFVAVRALFA |
| Ga0207932_10270493 | 3300025495 | Arctic Peat Soil | MSREYKPPSPRTISTFIYFAVLVIGVLLAFVAVRALFA |
| Ga0208584_10662563 | 3300025533 | Arctic Peat Soil | MPREHKPPNPRTISTFIYLAVLVIGVLLVFVAVRALFA |
| Ga0209430_10179373 | 3300025575 | Arctic Peat Soil | VPKDYRPPNPKTISSFVYLAVLVNGILLAYVAVRSLFG |
| Ga0209745_11559882 | 3300025739 | Arctic Peat Soil | MPREYKPPNPRSISTFIYFAVLVIGVLLAFVALRALFA |
| Ga0209745_12463472 | 3300025739 | Arctic Peat Soil | MPREHKPPSPRTISTFIYVAVFVIGVLLVFVAVRALFA |
| Ga0209539_11354432 | 3300025764 | Arctic Peat Soil | MPREYKPPSPRTISTLIYFAVLVIGVLLAFVAVRALFA |
| Ga0209539_13304551 | 3300025764 | Arctic Peat Soil | MRKDYRPPSPKTISNFLYVVVLVIAILLAYVALRSLFG |
| Ga0209538_13315832 | 3300025846 | Arctic Peat Soil | RTRGSPMSREYKPPSPRTISTFIYFAVLVIGVLLAFVAVRALFA |
| Ga0209176_101260582 | 3300025854 | Arctic Peat Soil | VPKDYRPPNPKTISSFVYLAVLVIGILLAYVAVRSLFG |
| Ga0209014_100195932 | 3300025857 | Arctic Peat Soil | MPREYKPPSPRTISTFIYFAVLVIGVLLAFVALRALFG |
| Ga0209014_100344484 | 3300025857 | Arctic Peat Soil | VPKDNRPPSPKSISNFLYVAVLVIAILLAYVAVRSLFG |
| Ga0210136_10055692 | 3300025967 | Natural And Restored Wetlands | VPRNDKPPSPRTISGFLYIAVLLIAVALAYVAVRALLA |
| Ga0209312_11288401 | 3300026195 | Anaerobic Biogas Reactor | MPRDQKPPSPRTISGFLYVAVALIAVALACVAVRALLA |
| Ga0209880_10039436 | 3300026271 | Soil | MPREYKPPSPRTISTFIYFAVLVIGVFLAFVAVRALFA |
| Ga0209269_100000795 | 3300027051 | Enrichment Culture | MPRDQKPPSPRTISGFLYVAVLLIAVALVYVAVRALLA |
| Ga0209706_101135853 | 3300027818 | Freshwater Sediment | VPRNDKPPSPRTISGFLYFAVLFIAVALAYVAVRALLA |
| Ga0209706_105416622 | 3300027818 | Freshwater Sediment | VPRNDQPPSPKTISGFLYVAVLVIAVALAYVAVRALLA |
| Ga0209262_100170783 | 3300027841 | Freshwater | VPRNDKPPSPRTISGFLYVVVLLIAMALAYVAVRALLA |
| Ga0209262_102055742 | 3300027841 | Freshwater | VSRNDKPPSPRTISGFLYFAVLFIAVALAYVAVRALLA |
| Ga0209262_105708592 | 3300027841 | Freshwater | MPREYKPPSPKSISTFVYLAVLVIGVLLAFVAVRALFA |
| Ga0209450_100212622 | 3300027885 | Freshwater Lake Sediment | VPRNDKPPSPRTISGVLYAVVLLIAVALAYVAVRALLA |
| Ga0209450_101084793 | 3300027885 | Freshwater Lake Sediment | MPRQQKPPSLRTISDFICFAVLVIGVLLAFVAVRALFA |
| Ga0209254_100442375 | 3300027897 | Freshwater Lake Sediment | MPREHKPPSPRTISNFIYFAVLVIGVLLAFVAVRALFA |
| Ga0209254_100581755 | 3300027897 | Freshwater Lake Sediment | MPRNDRPPSPRTISGFLYIAVLVIAVALAYVAVRALLA |
| Ga0209668_102309912 | 3300027899 | Freshwater Lake Sediment | VPRNDKPPGPRTISGFLYVVVLLIAIALAYVAVRALLA |
| Ga0209668_106629372 | 3300027899 | Freshwater Lake Sediment | MPREHKPPNPRTISNFVYFAVLVIGVLLAFVAVRALFA |
| Ga0209668_110093481 | 3300027899 | Freshwater Lake Sediment | MPRNDQPPSPRTISGFLYVAVLLIAVALVYVAVRALLA |
| Ga0209253_102501162 | 3300027900 | Freshwater Lake Sediment | MPREHKPPSPRTISNFIYFAVLVIGILLAFVAVRALFA |
| Ga0209253_109274412 | 3300027900 | Freshwater Lake Sediment | VPRNDKPPSPRTISGFLYVVVLLIAIALAYVAVRALLA |
| Ga0268284_10072716 | 3300028176 | Saline Water | VPRDYRPPSPRTISAFIYLAVLAIAVILAYVAVRSLFS |
| (restricted) Ga0247840_1000118033 | 3300028581 | Freshwater | MPRDYKPPSPRTISMLIYLAVLVIGVLLAFVALRALFA |
| Ga0302264_10109502 | 3300028732 | Fen | MPRNQQPPSPRTISGVLYMVVLVIAVALAYVAVRALLG |
| Ga0302261_10402602 | 3300028733 | Fen | MPRNQQPPSPRTISGVVYMVVLVIAVALAYVAVRALLG |
| Ga0302262_100879493 | 3300028743 | Fen | MPKDYRPPSPKTISNFLYVVVLVIAILLAYVALRSLFG |
| Ga0302291_101579253 | 3300028865 | Fen | MPPEHRPPDPRTISTFVYLVVLVIAVLIAYVAVRALFA |
| Ga0265297_102541221 | 3300029288 | Landfill Leachate | MPREYKPPSPRTISTFVYLAVLVIGVLLAFVAVRALFA |
| Ga0311350_102602752 | 3300030002 | Fen | MPRNQQPPSPRTISGVLYIVVLVIAVALAYVAVRALLG |
| Ga0302255_10509943 | 3300030050 | Fen | MPKDHRPPSPKTISNFLYVVVLVIAILLAYVALRSLFG |
| Ga0311333_102427324 | 3300030114 | Fen | MPPEHRPPDPRTISTFVYLVVLVIAILVAYVAVRALFA |
| Ga0316579_103605411 | 3300031691 | Rhizosphere | VPRNDKPPSPKTISGILYVAVLLIAAALVYVAVRALFA |
| Ga0315293_101512853 | 3300031746 | Sediment | MPRENKPPSPRTISTFIYFAVLVIGVLLAFVAVRALFA |
| Ga0315290_100697413 | 3300031834 | Sediment | MPREHKPPSPKSISTFVYFAVLVIGVLLAFVAVRALFA |
| Ga0315290_101635132 | 3300031834 | Sediment | MPREYKPPSPRTISTFVYFAVLVIGVLLAFVALRALFA |
| Ga0315290_102284663 | 3300031834 | Sediment | MPREYKPPSPRTISTFIYLAVLVIGVLLAFVALRALFA |
| Ga0315290_102456922 | 3300031834 | Sediment | VPKDHRPPSPKTISSFLYLAVLVIAISLAYVAVRSLFS |
| Ga0315290_108799072 | 3300031834 | Sediment | VPKDHRPPSPKTISTFVYLAVLVIAVILAYVAVRSLFS |
| Ga0315290_108992732 | 3300031834 | Sediment | VPKDYRPPSPKTISTFVYLAVLVIAILLAYVAVRSLFS |
| Ga0315290_113799452 | 3300031834 | Sediment | MPREYKPPSPRAISTFIYLAVLVIGVLLAYVALRALFA |
| Ga0315297_101200312 | 3300031873 | Sediment | MPREYKPPSPRTISMFIYLAVLVIGVLLAFVAVRALFA |
| Ga0315278_101158543 | 3300031997 | Sediment | MPREYKPPSPRTISTFVYLAVLVIGVLLAYVAVRALFA |
| Ga0315278_101950732 | 3300031997 | Sediment | VPKDYRPPSPRTISTFVYLAVLVIAILLAYVAVRSLFS |
| Ga0315278_121351732 | 3300031997 | Sediment | MPRDYKPPSPPTISTFVYLAVLVIGVLLAFVALRALLA |
| Ga0315272_100022464 | 3300032018 | Sediment | VPRNDKPPSPKTISGFLYIAVLLIAVALAYVAVRALLT |
| Ga0315272_100437244 | 3300032018 | Sediment | MPRNDQPPSPKTISGFLYVAVLLIAVAIAYVAVRALFA |
| Ga0315272_102038182 | 3300032018 | Sediment | MSREYKPPNPRTISTFVYLAVLVIGVLLALVALRALFA |
| Ga0315272_104634622 | 3300032018 | Sediment | MPREYKPPSPRSISTFVYFAVLVIGVLLAFVAVRALFA |
| Ga0315272_105912392 | 3300032018 | Sediment | VPKDYRPPSPRTISNFVYLAVLVIAILLAYVAVRSLFS |
| Ga0315292_102628273 | 3300032143 | Sediment | VPRSDKPPSPKTISGFLYVVVLLIAIALAYVAVRALLA |
| Ga0315292_112842122 | 3300032143 | Sediment | MPREYKPPSPRTISTFIYFAVLVIGVLLAFVALRALFA |
| Ga0315295_100497775 | 3300032156 | Sediment | MPRDHRPPSPRAISTFIYFAVLVIGMLLAFVAVRALFA |
| Ga0315283_109901932 | 3300032164 | Sediment | MPREYKPPSPRTISTFVYLAVLVIGLLLAYVAVRALFA |
| Ga0315283_112791942 | 3300032164 | Sediment | MARDHKPPSPKAISTVVYFAVLLIGLLLAFVAVRALFA |
| Ga0315268_100817123 | 3300032173 | Sediment | VPKDYRPPSPKSISNFLYVAVLVIAILLAYVAVRSLFG |
| Ga0315268_100904744 | 3300032173 | Sediment | MPRNDQPPGPKTISGFLYVAVLLIAVAIAYVAVRALFA |
| Ga0315268_101043514 | 3300032173 | Sediment | MPRDYRPPNPKTVSTFIYLAVLVMAVLIAYVAIRALFT |
| Ga0315268_110522483 | 3300032173 | Sediment | PSATDARGSPMPREYKPPSPKSISTFVYFAVLVIGVLLAFVAVRALFA |
| Ga0315276_111934401 | 3300032177 | Sediment | RSPMPREYKPPSPRTISTFIYFAVLVIGVLLAFVALRALFA |
| Ga0315270_105987812 | 3300032275 | Sediment | MPREYKPPSPKSISTFVYFAVLVIGVLLAFVAVRALFA |
| Ga0315286_103881353 | 3300032342 | Sediment | MPRDYKPPSPRTISTFIYLAMLVVGVLLAFVALQALFA |
| Ga0315287_111956402 | 3300032397 | Sediment | MPREYKPPGPRTMSTFIYLAVLVIGVLLAFVALRALFA |
| Ga0315287_121159341 | 3300032397 | Sediment | PSPSGTEPRGSTMPREYKPPSPRTISTFVYLAVLVIGLLLAYVAVRALFA |
| Ga0315287_129095342 | 3300032397 | Sediment | MPRDHRPPSPRTISTFVYLAVLVIGVLLAFVALRALLA |
| Ga0315273_112007321 | 3300032516 | Sediment | THRTRGSLMPRENKPPSPRTISTFIYFAVLVIGVLLAFVAVRALFA |
| Ga0335071_100977621 | 3300032897 | Soil | VPRNDRPPSPKTISGFLYIAVLLIAIALAYVAVRALLA |
| Ga0335071_104179772 | 3300032897 | Soil | VPRNDKPPSPKTISGFLYIAVLLIAIALAYVAVRALLA |
| Ga0335071_105598392 | 3300032897 | Soil | VPRNDRPPSPKTISSFLYITVLLIAIALAYVAVRALLA |
| Ga0316605_115532922 | 3300033408 | Soil | VPRNDKPPSPRTISGFLYVTVLIIAVALAYVAVRALLA |
| Ga0316613_108638342 | 3300033434 | Soil | VPRNDKPPSPRTISGLLYLAVLIIAVALAYVAVRALLA |
| Ga0316616_1017323032 | 3300033521 | Soil | VPRNDKPPSPRTISGFLYIAVLIIAVALAYVAVRALLA |
| Ga0370479_0073596_222_338 | 3300034123 | Untreated Peat Soil | MPRNDQPPSPRTISGFLYIVVLIIAVALAYVAVRALFA |
| Ga0370486_081959_449_565 | 3300034126 | Untreated Peat Soil | MPRNDQPPSPRTISGFLYVVVLIIAVALAYVAVRALFA |
| Ga0370490_0066826_776_892 | 3300034128 | Untreated Peat Soil | VPRNDKPPSPRTISGFLYIAVLAIAVALAYVAVRALLA |
| Ga0370501_0204303_100_216 | 3300034195 | Untreated Peat Soil | VPRNDRPPSPRTISGFLYVVVLIIAIALAYVAVRSLLA |
| Ga0370481_0012307_87_203 | 3300034281 | Untreated Peat Soil | MPRNDQPPSPRTISGFLYIVVLVIAVALAYVAVRALFA |
| Ga0370481_0118990_3_107 | 3300034281 | Untreated Peat Soil | MPREYKPPDPRTISTFVYLAVLVIAVLLAFVAVRA |
| ⦗Top⦘ |