Metagenome / Metatranscriptome Family F043793

Basic Information
Family ID	F043793
Family Type	Metagenome / Metatranscriptome
Number of Sequences	155
Average Sequence Length	37 residues
Representative Sequence	MLVLRTLTVKMTVKVCEAAASALQINSLEGSLMIEWE
Number of Associated Samples	98
Number of Associated Scaffolds	155

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	41.83 %
% of genes near scaffold ends (potentially truncated)	21.94 %
% of genes from short scaffolds (< 2000 bps)	70.32 %
Associated GOLD sequencing projects	89
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.41

Most Common Taxonomy
Group	Bacteria (61.935 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment (21.290 % of family members)
Environment Ontology (ENVO)	Unclassified (41.935 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Sediment (non-saline) (39.355 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 46.15% β-sheet: 0.00% Coil/Unstructured: 53.85%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 155 Family Scaffolds
PF01381	HTH_3	4.52
PF05015	HigB-like_toxin	3.87
PF09907	HigB_toxin	2.58
PF13338	AbiEi_4	2.58
PF01850	PIN	1.94
PF14437	MafB19-deam	1.29
PF06742	DUF1214	1.29
PF00378	ECH_1	1.29
PF00872	Transposase_mut	1.29
PF07969	Amidohydro_3	1.29
PF00690	Cation_ATPase_N	1.29
PF02518	HATPase_c	1.29
PF07676	PD40	0.65
PF08681	DUF1778	0.65
PF01027	Bax1-I	0.65
PF06348	DUF1059	0.65
PF02777	Sod_Fe_C	0.65
PF12146	Hydrolase_4	0.65
PF13377	Peripla_BP_3	0.65
PF00211	Guanylate_cyc	0.65
PF08450	SGL	0.65
PF02368	Big_2	0.65
PF00702	Hydrolase	0.65
PF05489	Phage_tail_X	0.65
PF13751	DDE_Tnp_1_6	0.65
PF13511	DUF4124	0.65
PF08240	ADH_N	0.65
PF05973	Gp49	0.65
PF06779	MFS_4	0.65
PF00171	Aldedh	0.65
PF13193	AMP-binding_C	0.65
PF01527	HTH_Tnp_1	0.65
PF01425	Amidase	0.65
PF03466	LysR_substrate	0.65
PF01464	SLT	0.65
PF00383	dCMP_cyt_deam_1	0.65
PF13356	Arm-DNA-bind_3	0.65
PF09957	VapB_antitoxin	0.65
PF02635	DrsE	0.65
PF00196	GerE	0.65
PF04851	ResIII	0.65
PF01292	Ni_hydr_CYTB	0.65
PF05521	Phage_H_T_join	0.65
PF05016	ParE_toxin	0.65
PF01979	Amidohydro_1	0.65
PF01569	PAP2	0.65
PF05598	DUF772	0.65
PF13177	DNA_pol3_delta2	0.65
PF03050	DDE_Tnp_IS66	0.65
PF05258	DciA	0.65
PF14659	Phage_int_SAM_3	0.65
PF00027	cNMP_binding	0.65
PF00486	Trans_reg_C	0.65
PF09860	DUF2087	0.65
PF13247	Fer4_11	0.65
PF01609	DDE_Tnp_1	0.65
PF00665	rve	0.65
PF04986	Y2_Tnp	0.65

COG ID	Name	Functional Category	% Frequency in 155 Family Scaffolds
COG3549	Plasmid maintenance system killer protein	Defense mechanisms [V]	3.87
COG0474	Magnesium-transporting ATPase (P-type)	Inorganic ion transport and metabolism [P]	1.29
COG3328	Transposase (or an inactivated derivative)	Mobilome: prophages, transposons [X]	1.29
COG5402	Uncharacterized protein, contains DUF1214 domain	Function unknown [S]	1.29
COG5361	Uncharacterized conserved protein	Mobilome: prophages, transposons [X]	1.29
COG4679	Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system	Defense mechanisms [V]	0.65
COG3657	Putative component of the toxin-antitoxin plasmid stabilization module	Defense mechanisms [V]	0.65
COG3658	Cytochrome b subunit of Ni2+-dependent hydrogenase	Energy production and conversion [C]	0.65
COG4117	Thiosulfate reductase cytochrome b subunit	Inorganic ion transport and metabolism [P]	0.65
COG4230	Delta 1-pyrroline-5-carboxylate dehydrogenase	Amino acid transport and metabolism [E]	0.65
COG4453	Uncharacterized conserved protein, DUF1778 family	Function unknown [S]	0.65
COG4584	Transposase	Mobilome: prophages, transposons [X]	0.65
COG3391	DNA-binding beta-propeller fold protein YncE	General function prediction only [R]	0.65
COG5004	P2-like prophage tail protein X	Mobilome: prophages, transposons [X]	0.65
COG5421	Transposase	Mobilome: prophages, transposons [X]	0.65
COG5433	Predicted transposase YbfD/YdcC associated with H repeats	Mobilome: prophages, transposons [X]	0.65
COG5512	Predicted nucleic acid-binding protein, contains Zn-ribbon domain (includes truncated derivatives)	General function prediction only [R]	0.65
COG5659	SRSO17 transposase	Mobilome: prophages, transposons [X]	0.65
COG3436	Transposase	Mobilome: prophages, transposons [X]	0.65
COG0014	Gamma-glutamyl phosphate reductase	Amino acid transport and metabolism [E]	0.65
COG3386	Sugar lactone lactonase YvrE	Carbohydrate transport and metabolism [G]	0.65
COG3385	IS4 transposase InsG	Mobilome: prophages, transposons [X]	0.65
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	0.65
COG3293	Transposase	Mobilome: prophages, transposons [X]	0.65
COG3039	Transposase and inactivated derivatives, IS5 family	Mobilome: prophages, transposons [X]	0.65
COG3038	Cytochrome b561	Energy production and conversion [C]	0.65
COG2864	Cytochrome b subunit of formate dehydrogenase	Energy production and conversion [C]	0.65
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	0.65
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	0.65
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	0.65
COG1969	Ni,Fe-hydrogenase I cytochrome b subunit	Energy production and conversion [C]	0.65
COG1012	Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase	Lipid transport and metabolism [I]	0.65
COG0605	Superoxide dismutase	Inorganic ion transport and metabolism [P]	0.65
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	0.65

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	61.94 %
Unclassified	root	N/A	38.06 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	61.94 %
Unclassified	root	N/A	38.06 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	61.94 %
Unclassified	root	N/A	38.06 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	47.10 %
Unclassified	root	N/A	38.06 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.94 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	1.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.06 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	19.35 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	5.81 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1.29 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	1.94 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	0.65 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.65 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.06 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	12.26 %
Thermomicrobia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia	1.29 %
Pseudomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales	1.29 %
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	1.94 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.65 %
Cellvibrionales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales	0.65 %
Gammaproteobacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis	0.65 %
Betaproteobacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis	0.65 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.65 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.65 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.06 %
Burkholderiales genera incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis	2.58 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	2.58 %
unclassified Burkholderiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales	1.29 %
Pseudomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae	1.29 %
Thermomicrobiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales	1.29 %
unclassified Bryobacterales	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales	1.94 %
Spongiibacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Spongiibacteraceae	0.65 %
Candidatus Competibacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae	0.65 %
Beijerinckiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae	0.65 %
Pleurocapsales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pleurocapsales	0.65 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	0.65 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.65 %
Desulfobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	0.65 %
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.06 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	1.29 %
unclassified Thermomicrobiales	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales	1.29 %
Bryobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium	1.94 %
Burkholderiales bacterium GJ-E10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium GJ-E10	0.65 %
Candidatus Contendobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter	0.65 %
Aquincola	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquincola	0.65 %
Xenococcaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pleurocapsales → Xenococcaceae	0.65 %
Leptothrix	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Leptothrix	0.65 %
unclassified Candidatus Accumulibacter	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter	0.65 %
Thiomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Thiomonas	0.65 %
Polynucleobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter	0.65 %
unclassified Beijerinckiaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae	0.65 %
Variovorax	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax	0.65 %
Pseudoxanthomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Pseudoxanthomonas	0.65 %
Desulfobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	0.65 %
Pelomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas	0.65 %
Ideonella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella	0.65 %
Spongiibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Spongiibacteraceae → Spongiibacter	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.06 %
Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium	1.29 %
Bryobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium	1.94 %
Ideonella sakaiensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → Ideonella sakaiensis	0.65 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.65 %
Candidatus Contendobacter odensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis	0.65 %
Beijerinckiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium	0.65 %
Pseudoxanthomonas winnipegensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Pseudoxanthomonas → Pseudoxanthomonas winnipegensis	0.65 %
unclassified Thiomonas	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Thiomonas → unclassified Thiomonas	0.65 %
unclassified Spongiibacter	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Spongiibacteraceae → Spongiibacter → unclassified Spongiibacter	0.65 %
unclassified Pelomonas	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas	0.65 %
Xenococcus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pleurocapsales → Xenococcaceae → Xenococcus	0.65 %
Leptothrix cholodnii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Leptothrix → Leptothrix cholodnii	0.65 %
unclassified Variovorax	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax	0.65 %
unclassified Pseudomonas	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas	0.65 %
unclassified Desulfobacteraceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae	0.65 %
Aquincola tertiaricarbonis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquincola → Aquincola tertiaricarbonis	0.65 %
Burkholderiales bacterium GJ-E10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium GJ-E10	0.65 %
Polynucleobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.06 %
Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium	1.29 %
Bryobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium	1.94 %
Variovorax sp. OV329	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. OV329	0.65 %
Spongiibacter sp. IMCC21906	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Spongiibacteraceae → Spongiibacter → unclassified Spongiibacter → Spongiibacter sp. IMCC21906	0.65 %
Pelomonas sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp.	0.65 %
Desulfobacteraceae bacterium 4572_19	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium 4572_19	0.65 %
Thiomonas sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Thiomonas → unclassified Thiomonas → Thiomonas sp.	0.65 %
unclassified Xenococcus	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pleurocapsales → Xenococcaceae → Xenococcus → unclassified Xenococcus	0.65 %
Pseudomonas sp. PS1(2021)	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. PS1(2021)	0.65 %
Ideonella sakaiensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → Ideonella sakaiensis	0.65 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.65 %
Candidatus Contendobacter odensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis	0.65 %
Beijerinckiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium	0.65 %
Pseudoxanthomonas winnipegensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Pseudoxanthomonas → Pseudoxanthomonas winnipegensis	0.65 %
Leptothrix cholodnii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Leptothrix → Leptothrix cholodnii	0.65 %
Aquincola tertiaricarbonis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquincola → Aquincola tertiaricarbonis	0.65 %
Burkholderiales bacterium GJ-E10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium GJ-E10	0.65 %
Polynucleobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	38.06 %
Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium	1.29 %
Bryobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium	1.94 %
Xenococcus sp. PCC 7305	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pleurocapsales → Xenococcaceae → Xenococcus → unclassified Xenococcus → Xenococcus sp. PCC 7305	0.65 %
Variovorax sp. OV329	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. OV329	0.65 %
Spongiibacter sp. IMCC21906	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Spongiibacteraceae → Spongiibacter → unclassified Spongiibacter → Spongiibacter sp. IMCC21906	0.65 %
Pelomonas sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp.	0.65 %
Desulfobacteraceae bacterium 4572_19	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium 4572_19	0.65 %
Thiomonas sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Thiomonas → unclassified Thiomonas → Thiomonas sp.	0.65 %
Pseudomonas sp. PS1(2021)	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. PS1(2021)	0.65 %
Ideonella sakaiensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → Ideonella sakaiensis	0.65 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.65 %
Candidatus Contendobacter odensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis	0.65 %
Beijerinckiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium	0.65 %
Pseudoxanthomonas winnipegensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Pseudoxanthomonas → Pseudoxanthomonas winnipegensis	0.65 %
Leptothrix cholodnii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Leptothrix → Leptothrix cholodnii	0.65 %
Aquincola tertiaricarbonis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquincola → Aquincola tertiaricarbonis	0.65 %
Burkholderiales bacterium GJ-E10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium GJ-E10	0.65 %
Polynucleobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter	0.65 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000558\|Draft_11730333	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1121	Open in IMG/M
3300001213\|JGIcombinedJ13530_102116599	All Organisms → cellular organisms → Bacteria	758	Open in IMG/M
3300001592\|Draft_10017556	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5737	Open in IMG/M
3300004048\|Ga0055494_10013713	Not Available	1229	Open in IMG/M
3300005565\|Ga0068885_1489202	Not Available	769	Open in IMG/M
3300005656\|Ga0073902_10230445	All Organisms → cellular organisms → Bacteria → Proteobacteria	832	Open in IMG/M
3300005656\|Ga0073902_10293633	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium	719	Open in IMG/M
3300005833\|Ga0074472_10734774	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Contendobacter → Candidatus Contendobacter odensis	1972	Open in IMG/M
3300005833\|Ga0074472_11151951	All Organisms → cellular organisms → Bacteria	1428	Open in IMG/M
3300005940\|Ga0073913_10021180	Not Available	939	Open in IMG/M
3300005982\|Ga0075156_10048021	All Organisms → cellular organisms → Bacteria → Proteobacteria	2479	Open in IMG/M
3300005986\|Ga0075152_10012610	All Organisms → cellular organisms → Bacteria → Proteobacteria	5488	Open in IMG/M
3300005987\|Ga0075158_10340187	All Organisms → cellular organisms → Bacteria → Proteobacteria	847	Open in IMG/M
3300006056\|Ga0075163_10166911	All Organisms → cellular organisms → Bacteria	2594	Open in IMG/M
3300006930\|Ga0079303_10102139	All Organisms → cellular organisms → Bacteria	1082	Open in IMG/M
3300007202\|Ga0103274_1115025	Not Available	1081	Open in IMG/M
3300007521\|Ga0105044_10186020	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	2128	Open in IMG/M
3300007521\|Ga0105044_11298398	Not Available	533	Open in IMG/M
3300009075\|Ga0105090_10006490	All Organisms → cellular organisms → Bacteria → Proteobacteria	6829	Open in IMG/M
3300009075\|Ga0105090_10163999	All Organisms → cellular organisms → Bacteria → Proteobacteria	1384	Open in IMG/M
3300009075\|Ga0105090_10242961	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Spongiibacteraceae → Spongiibacter → unclassified Spongiibacter → Spongiibacter sp. IMCC21906	1109	Open in IMG/M
3300009075\|Ga0105090_10320752	Not Available	948	Open in IMG/M
3300009075\|Ga0105090_10350553	Not Available	902	Open in IMG/M
3300009075\|Ga0105090_10431418	Not Available	802	Open in IMG/M
3300009078\|Ga0105106_10083393	All Organisms → cellular organisms → Bacteria → Proteobacteria	2352	Open in IMG/M
3300009078\|Ga0105106_10153003	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1693	Open in IMG/M
3300009111\|Ga0115026_11472214	Not Available	566	Open in IMG/M
3300009131\|Ga0115027_11286259	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	589	Open in IMG/M
3300009166\|Ga0105100_10037353	All Organisms → cellular organisms → Bacteria → Proteobacteria	2818	Open in IMG/M
3300009167\|Ga0113563_11552121	All Organisms → cellular organisms → Bacteria	782	Open in IMG/M
3300009167\|Ga0113563_12416738	Not Available	633	Open in IMG/M
3300009167\|Ga0113563_12611589	Not Available	610	Open in IMG/M
3300009169\|Ga0105097_10861642	Not Available	519	Open in IMG/M
3300009170\|Ga0105096_10040406	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Thiomonas → unclassified Thiomonas → Thiomonas sp.	2293	Open in IMG/M
3300009170\|Ga0105096_10107795	All Organisms → cellular organisms → Bacteria	1392	Open in IMG/M
3300009170\|Ga0105096_10144425	All Organisms → cellular organisms → Bacteria	1196	Open in IMG/M
3300009170\|Ga0105096_10646619	Not Available	558	Open in IMG/M
3300009171\|Ga0105101_10456052	All Organisms → cellular organisms → Bacteria	626	Open in IMG/M
3300009430\|Ga0114938_1005847	All Organisms → cellular organisms → Bacteria → Proteobacteria	6418	Open in IMG/M
3300009455\|Ga0114939_10194120	All Organisms → cellular organisms → Bacteria → Proteobacteria	859	Open in IMG/M
3300009509\|Ga0123573_10244779	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1753	Open in IMG/M
3300009648\|Ga0116175_1241456	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium	594	Open in IMG/M
3300009654\|Ga0116167_1011680	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	4946	Open in IMG/M
3300009668\|Ga0116180_1028046	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	3021	Open in IMG/M
3300009696\|Ga0116177_10000416	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	31488	Open in IMG/M
3300009771\|Ga0116155_10049900	All Organisms → cellular organisms → Bacteria	2019	Open in IMG/M
3300009782\|Ga0116157_10143948	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1362	Open in IMG/M
3300009782\|Ga0116157_10182347	Not Available	1171	Open in IMG/M
3300009870\|Ga0131092_10004129	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	32578	Open in IMG/M
3300009873\|Ga0131077_11731951	Not Available	507	Open in IMG/M
3300010334\|Ga0136644_10307448	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pelomonas → unclassified Pelomonas → Pelomonas sp.	917	Open in IMG/M
3300010343\|Ga0074044_10868198	Not Available	590	Open in IMG/M
3300010345\|Ga0116253_10872312	Not Available	530	Open in IMG/M
3300010345\|Ga0116253_10959434	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium	500	Open in IMG/M
3300010351\|Ga0116248_10221942	All Organisms → cellular organisms → Bacteria → Proteobacteria	1525	Open in IMG/M
3300010355\|Ga0116242_10588571	Not Available	1004	Open in IMG/M
3300010357\|Ga0116249_11275007	Not Available	658	Open in IMG/M
3300010357\|Ga0116249_11956452	Not Available	514	Open in IMG/M
3300010412\|Ga0136852_10183762	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2099	Open in IMG/M
3300012533\|Ga0138256_10129384	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Leptothrix → Leptothrix cholodnii	2356	Open in IMG/M
3300012931\|Ga0153915_10216420	All Organisms → cellular organisms → Bacteria	2109	Open in IMG/M
3300012956\|Ga0154020_10064795	All Organisms → cellular organisms → Bacteria → Proteobacteria	3720	Open in IMG/M
3300014305\|Ga0075349_1089114	Not Available	670	Open in IMG/M
3300014312\|Ga0075345_1090642	Not Available	680	Open in IMG/M
3300014317\|Ga0075343_1082023	All Organisms → cellular organisms → Bacteria	707	Open in IMG/M
3300014319\|Ga0075348_1028699	All Organisms → cellular organisms → Bacteria → Proteobacteria	1198	Open in IMG/M
3300015240\|Ga0182876_10000655	All Organisms → cellular organisms → Bacteria → Proteobacteria	2481	Open in IMG/M
3300022214\|Ga0224505_10235571	Not Available	697	Open in IMG/M
3300023174\|Ga0214921_10145898	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium 4572_19	1622	Open in IMG/M
3300025106\|Ga0209398_1007685	All Organisms → cellular organisms → Bacteria → Proteobacteria	3815	Open in IMG/M
3300025130\|Ga0209594_1135439	All Organisms → cellular organisms → Bacteria	734	Open in IMG/M
3300025130\|Ga0209594_1156786	Not Available	674	Open in IMG/M
3300025866\|Ga0208822_1219879	Not Available	677	Open in IMG/M
3300025950\|Ga0210134_1002873	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium	2576	Open in IMG/M
3300026072\|Ga0208292_1056121	Not Available	517	Open in IMG/M
3300026485\|Ga0256805_1050886	Not Available	547	Open in IMG/M
3300027683\|Ga0209392_1003568	All Organisms → cellular organisms → Bacteria → Proteobacteria	4369	Open in IMG/M
3300027683\|Ga0209392_1252974	Not Available	524	Open in IMG/M
3300027705\|Ga0209063_1099857	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium	1030	Open in IMG/M
3300027715\|Ga0208665_10152112	All Organisms → cellular organisms → Bacteria → Proteobacteria	724	Open in IMG/M
3300027721\|Ga0209492_1034522	All Organisms → cellular organisms → Bacteria	1768	Open in IMG/M
3300027723\|Ga0209703_1126680	Not Available	969	Open in IMG/M
3300027739\|Ga0209575_10309323	Not Available	544	Open in IMG/M
3300027781\|Ga0209175_10439538	Not Available	541	Open in IMG/M
3300027823\|Ga0209490_10068581	All Organisms → cellular organisms → Bacteria → Proteobacteria	2688	Open in IMG/M
3300027885\|Ga0209450_10001838	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	10699	Open in IMG/M
3300027885\|Ga0209450_10047707	All Organisms → cellular organisms → Bacteria → Proteobacteria	2632	Open in IMG/M
3300027885\|Ga0209450_10065011	All Organisms → cellular organisms → Bacteria → Proteobacteria	2308	Open in IMG/M
3300027885\|Ga0209450_10327704	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1110	Open in IMG/M
3300027885\|Ga0209450_10369679	All Organisms → cellular organisms → Bacteria → Proteobacteria	1043	Open in IMG/M
3300027890\|Ga0209496_10060666	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquincola → Aquincola tertiaricarbonis	1481	Open in IMG/M
3300027897\|Ga0209254_10001829	All Organisms → cellular organisms → Bacteria → Proteobacteria	19195	Open in IMG/M
3300027897\|Ga0209254_10045713	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3844	Open in IMG/M
3300027897\|Ga0209254_10068469	All Organisms → cellular organisms → Bacteria	3043	Open in IMG/M
3300027897\|Ga0209254_10097856	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pleurocapsales → Xenococcaceae → Xenococcus → unclassified Xenococcus → Xenococcus sp. PCC 7305	2467	Open in IMG/M
3300027897\|Ga0209254_10102293	All Organisms → cellular organisms → Bacteria	2402	Open in IMG/M
3300027897\|Ga0209254_10105938	All Organisms → cellular organisms → Bacteria	2353	Open in IMG/M
3300027897\|Ga0209254_10123503	Not Available	2147	Open in IMG/M
3300027897\|Ga0209254_10180519	All Organisms → cellular organisms → Bacteria → Proteobacteria	1703	Open in IMG/M
3300027897\|Ga0209254_10304593	Not Available	1218	Open in IMG/M
3300027897\|Ga0209254_10306489	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1213	Open in IMG/M
3300027897\|Ga0209254_10484488	Not Available	897	Open in IMG/M
3300027897\|Ga0209254_10535275	Not Available	839	Open in IMG/M
3300027897\|Ga0209254_10540767	Not Available	834	Open in IMG/M
3300027897\|Ga0209254_10579349	Not Available	795	Open in IMG/M
3300027897\|Ga0209254_10651299	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium	734	Open in IMG/M
3300027897\|Ga0209254_10894192	Not Available	591	Open in IMG/M
3300027897\|Ga0209254_10957315	Not Available	562	Open in IMG/M
3300027900\|Ga0209253_10167835	All Organisms → cellular organisms → Bacteria → Proteobacteria	1768	Open in IMG/M
3300027900\|Ga0209253_10169146	All Organisms → cellular organisms → Bacteria → Proteobacteria	1761	Open in IMG/M
3300027900\|Ga0209253_10252836	All Organisms → cellular organisms → Bacteria → Proteobacteria	1386	Open in IMG/M
3300027900\|Ga0209253_10269684	Not Available	1332	Open in IMG/M
3300027900\|Ga0209253_10433364	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Pseudoxanthomonas → Pseudoxanthomonas winnipegensis	993	Open in IMG/M
3300027900\|Ga0209253_10853932	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → Ideonella sakaiensis	642	Open in IMG/M
3300027900\|Ga0209253_10876644	Not Available	631	Open in IMG/M
3300027902\|Ga0209048_10017752	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	6231	Open in IMG/M
3300027902\|Ga0209048_10064207	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2936	Open in IMG/M
3300027902\|Ga0209048_10217903	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1378	Open in IMG/M
3300027902\|Ga0209048_11001523	Not Available	534	Open in IMG/M
3300027975\|Ga0209391_10021664	All Organisms → cellular organisms → Bacteria → Proteobacteria	3272	Open in IMG/M
3300027975\|Ga0209391_10039736	Not Available	2280	Open in IMG/M
3300027975\|Ga0209391_10128195	Not Available	1102	Open in IMG/M
3300027975\|Ga0209391_10203837	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. OV329	820	Open in IMG/M
3300027975\|Ga0209391_10224251	Not Available	771	Open in IMG/M
3300027975\|Ga0209391_10273215	Not Available	678	Open in IMG/M
3300028108\|Ga0256305_1093201	Not Available	730	Open in IMG/M
3300028647\|Ga0272412_1414989	Not Available	531	Open in IMG/M
3300028804\|Ga0268298_10073647	Not Available	2120	Open in IMG/M
3300031784\|Ga0315899_10776498	All Organisms → cellular organisms → Bacteria → Proteobacteria	880	Open in IMG/M
3300031873\|Ga0315297_11395006	Not Available	569	Open in IMG/M
3300032156\|Ga0315295_10193093	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. PS1(2021)	2042	Open in IMG/M
3300032164\|Ga0315283_10401726	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1490	Open in IMG/M
3300032256\|Ga0315271_10070226	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2589	Open in IMG/M
3300032397\|Ga0315287_10846534	Not Available	1073	Open in IMG/M
3300032397\|Ga0315287_12547345	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	548	Open in IMG/M
3300032456\|Ga0335394_10260760	All Organisms → cellular organisms → Bacteria → Proteobacteria	1602	Open in IMG/M
3300032516\|Ga0315273_11098311	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter	1010	Open in IMG/M
3300033413\|Ga0316603_10183443	Not Available	1766	Open in IMG/M
3300033413\|Ga0316603_10301950	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium GJ-E10	1414	Open in IMG/M
3300033414\|Ga0316619_12107497	All Organisms → cellular organisms → Bacteria	515	Open in IMG/M
3300033416\|Ga0316622_100038559	All Organisms → cellular organisms → Bacteria → Proteobacteria	4380	Open in IMG/M
3300033416\|Ga0316622_102237651	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	633	Open in IMG/M
3300033419\|Ga0316601_102109941	Not Available	568	Open in IMG/M
3300033483\|Ga0316629_10775281	Not Available	734	Open in IMG/M
3300033487\|Ga0316630_11046434	Not Available	716	Open in IMG/M
3300033488\|Ga0316621_10820327	Not Available	682	Open in IMG/M
3300033557\|Ga0316617_100644631	All Organisms → cellular organisms → Bacteria → Proteobacteria	991	Open in IMG/M
3300034018\|Ga0334985_0354575	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales	896	Open in IMG/M
3300034066\|Ga0335019_0046043	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2992	Open in IMG/M
3300034108\|Ga0335050_0007021	All Organisms → cellular organisms → Bacteria → Proteobacteria	7627	Open in IMG/M
3300034125\|Ga0370484_0125126	Not Available	681	Open in IMG/M
3300034283\|Ga0335007_0147582	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1686	Open in IMG/M
3300034284\|Ga0335013_0154394	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1558	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	80.00%
Engineered	Engineered	20.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	67.10%
Wastewater	Engineered → Wastewater	20.00%
Terrestrial	Environmental → Terrestrial	12.90%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	61.94%
Soil	Environmental → Terrestrial → Soil	11.61%
Anaerobic Digestor	Engineered → Wastewater → Anaerobic Digestor	9.68%
Activated Sludge	Engineered → Wastewater → Activated Sludge	5.81%
Nutrient Removal	Engineered → Wastewater → Nutrient Removal	3.23%
Marine	Environmental → Aquatic → Marine	2.58%
Sediment	Environmental → Aquatic → Sediment	2.58%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	1.29%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater	1.29%

Habitat	Taxonomy	Distribution
Lentic	Environmental → Aquatic → Freshwater → Lentic	21.94%
Sediment	Environmental → Aquatic → Freshwater → Sediment	18.06%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	10.97%
Lake	Environmental → Aquatic → Freshwater → Lake	10.32%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified	9.68%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	5.81%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	3.23%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	3.23%
Unclassified	Engineered → Wastewater → Nutrient Removal → Unclassified	3.23%
Ice	Environmental → Aquatic → Freshwater → Ice	2.58%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.58%
Wetlands	Environmental → Aquatic → Marine → Wetlands	1.94%
Pond	Environmental → Aquatic → Freshwater → Pond	1.29%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	1.29%
Petrochemical	Engineered → Wastewater → Industrial Wastewater → Petrochemical	1.29%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	0.65%
River	Environmental → Aquatic → Freshwater → River	0.65%
Sediment	Environmental → Aquatic → Marine → Sediment	0.65%
Sand	Environmental → Terrestrial → Soil → Sand	0.65%

Habitat	Taxonomy	Distribution
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	21.29%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	18.06%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	10.97%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified	9.68%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	5.81%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	5.81%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	4.52%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	3.23%
Unclassified	Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified	3.23%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	2.58%
Glacial Lake	Environmental → Aquatic → Freshwater → Ice → Glacial Lake	2.58%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.58%
Sediment	Environmental → Aquatic → Freshwater → Pond → Sediment	1.29%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	1.29%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	1.29%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified	1.29%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	0.65%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.65%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	0.65%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	0.65%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	0.65%
Unclassified	Environmental → Aquatic → Marine → Sediment → Unclassified	0.65%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.65%

Habitat	Taxonomy	Distribution
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	21.29%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	16.13%
Anaerobic Digestor Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge	9.68%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	6.45%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	4.52%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater	3.23%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	3.23%
Wastewater Effluent	Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent	3.23%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	3.87%
Freshwater	Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater	2.58%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	1.94%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	1.94%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	1.94%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	1.94%
Freshwater	Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater	1.29%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	1.29%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	1.29%
Mangrove Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment	1.29%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	1.29%
Hydrocarbon Resource Environments	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments	1.29%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	0.65%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	0.65%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	0.65%
Microbial Mat	Environmental → Aquatic → Freshwater → Lake → Unclassified → Microbial Mat	0.65%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.65%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment	0.65%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	0.65%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	0.65%
Wetland	Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland	0.65%
Sediment	Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment	0.65%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.65%
Bog Forest Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil	0.65%
Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Sand	0.65%
Wastewater	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater	0.65%
Active Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge	0.65%
Active Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge	0.65%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000558	Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011	Engineered	Open in IMG/M
3300001213	Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)	Environmental	Open in IMG/M
3300001592	Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes in water sample from Medicine Hat oil field -PW_MHGC_2012April2:	Engineered	Open in IMG/M
3300004048	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D2	Environmental	Open in IMG/M
3300005565	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005656	Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB19-Kit	Engineered	Open in IMG/M
3300005833	Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK	Environmental	Open in IMG/M
3300005940	Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14	Environmental	Open in IMG/M
3300005982	Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNA	Engineered	Open in IMG/M
3300005986	Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 C2 DNA	Engineered	Open in IMG/M
3300005987	Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B DNA	Engineered	Open in IMG/M
3300006056	Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNA	Engineered	Open in IMG/M
3300006930	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC	Environmental	Open in IMG/M
3300007202	Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Monthly Sampling-Site C) 9 sequencing projects	Environmental	Open in IMG/M
3300007521	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01	Environmental	Open in IMG/M
3300009075	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015	Environmental	Open in IMG/M
3300009078	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015	Environmental	Open in IMG/M
3300009111	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1	Environmental	Open in IMG/M
3300009131	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1	Environmental	Open in IMG/M
3300009166	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015	Environmental	Open in IMG/M
3300009167	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)	Environmental	Open in IMG/M
3300009169	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015	Environmental	Open in IMG/M
3300009170	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015	Environmental	Open in IMG/M
3300009171	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015	Environmental	Open in IMG/M
3300009430	Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big Spring	Environmental	Open in IMG/M
3300009455	Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring	Environmental	Open in IMG/M
3300009509	Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11	Environmental	Open in IMG/M
3300009648	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC125_MetaG	Engineered	Open in IMG/M
3300009654	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR3_MetaG	Engineered	Open in IMG/M
3300009668	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC073_MetaG	Engineered	Open in IMG/M
3300009696	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC10_MetaG	Engineered	Open in IMG/M
3300009771	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC032_MetaG	Engineered	Open in IMG/M
3300009782	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC048_MetaG	Engineered	Open in IMG/M
3300009870	Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant	Engineered	Open in IMG/M
3300009873	Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant	Engineered	Open in IMG/M
3300010334	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2)	Environmental	Open in IMG/M
3300010343	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1	Environmental	Open in IMG/M
3300010345	AD_JPNAca2	Engineered	Open in IMG/M
3300010351	AD_USPNca	Engineered	Open in IMG/M
3300010355	AD_USDVca	Engineered	Open in IMG/M
3300010357	AD_USSTca	Engineered	Open in IMG/M
3300010412	Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10	Environmental	Open in IMG/M
3300012533	Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MG	Engineered	Open in IMG/M
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental	Open in IMG/M
3300012956	Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MG	Engineered	Open in IMG/M
3300014305	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D1	Environmental	Open in IMG/M
3300014312	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1	Environmental	Open in IMG/M
3300014317	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D1	Environmental	Open in IMG/M
3300014319	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1	Environmental	Open in IMG/M
3300015240	Freshwater microbial mat microbial communities from Canadian High Arctic Lake 9K, Kuujjuarapik, Canada - Sample L9Kc	Environmental	Open in IMG/M
3300022214	Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1	Environmental	Open in IMG/M
3300023174	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505	Environmental	Open in IMG/M
3300025106	Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big Spring (SPAdes)	Environmental	Open in IMG/M
3300025130	Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring (SPAdes)	Environmental	Open in IMG/M
3300025866	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC08_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025950	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2 (SPAdes)	Environmental	Open in IMG/M
3300026072	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1 (SPAdes)	Environmental	Open in IMG/M
3300026485	Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 F6	Environmental	Open in IMG/M
3300027683	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes)	Environmental	Open in IMG/M
3300027705	Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB19-Kit (SPAdes)	Engineered	Open in IMG/M
3300027715	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes)	Environmental	Open in IMG/M
3300027721	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)	Environmental	Open in IMG/M
3300027723	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 (SPAdes)	Environmental	Open in IMG/M
3300027739	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 (SPAdes)	Environmental	Open in IMG/M
3300027781	Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNA (SPAdes)	Engineered	Open in IMG/M
3300027823	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-06 (SPAdes)	Environmental	Open in IMG/M
3300027841	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes)	Environmental	Open in IMG/M
3300027885	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)	Environmental	Open in IMG/M
3300027890	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)	Environmental	Open in IMG/M
3300027897	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)	Environmental	Open in IMG/M
3300027900	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)	Environmental	Open in IMG/M
3300027902	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)	Environmental	Open in IMG/M
3300027975	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 (SPAdes)	Environmental	Open in IMG/M
3300028108	Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300028647	Metatranscriptome of activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300028804	Activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt	Engineered	Open in IMG/M
3300031784	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112	Environmental	Open in IMG/M
3300031873	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0	Environmental	Open in IMG/M
3300032156	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0	Environmental	Open in IMG/M
3300032164	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0	Environmental	Open in IMG/M
3300032256	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top	Environmental	Open in IMG/M
3300032397	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0	Environmental	Open in IMG/M
3300032456	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (spades assembly)	Environmental	Open in IMG/M
3300032516	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0	Environmental	Open in IMG/M
3300033413	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT	Environmental	Open in IMG/M
3300033414	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B	Environmental	Open in IMG/M
3300033416	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C	Environmental	Open in IMG/M
3300033419	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT	Environmental	Open in IMG/M
3300033483	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A	Environmental	Open in IMG/M
3300033487	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A	Environmental	Open in IMG/M
3300033488	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C	Environmental	Open in IMG/M
3300033557	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B	Environmental	Open in IMG/M
3300034018	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021	Environmental	Open in IMG/M
3300034066	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087	Environmental	Open in IMG/M
3300034108	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157	Environmental	Open in IMG/M
3300034125	Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15	Environmental	Open in IMG/M
3300034283	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061	Environmental	Open in IMG/M
3300034284	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.41
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.41
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F043793

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Draft_117303333	3300000558	Hydrocarbon Resource Environments	MLVLSTLTAKMTVKVCEAAAGALQINSLKSSLMIEWE*
JGIcombinedJ13530_1021165993	3300001213	Wetland	MLVLRTLTAKMTVKVCEAAAGASRINSLEGSLMIEWE*
Draft_100175566	3300001592	Hydrocarbon Resource Environments	MLVPDKLTVRMTVKTREAAASFLQINRLESSLMIEWE*
Ga0055494_100137132	3300004048	Natural And Restored Wetlands	PAPMLVLRTLTAKVTVNFCGAASGALQSNSLEGSLMIEWE*
Ga0068885_14892021	3300005565	Freshwater Lake	MLVLRTLTVNMTVNFCRAASGALQINSLEGSLMIEWE*
Ga0073902_102304452	3300005656	Activated Sludge	MLVPDTLTVKMTVKIERATCKHLEINSLEGSLMIEWE*
Ga0073902_102936331	3300005656	Activated Sludge	MLVLDRLTVNMTVKVCGAAAIALRINSLEGSLMIEWE*
Ga0074472_107347742	3300005833	Sediment (Intertidal)	MLVPDRLTAKVTAKICEAASSALPINGLVRSLTIEWEEGPQW*
Ga0074472_111519513	3300005833	Sediment (Intertidal)	MLVLSTLKVEMTVKVCEAAASTLQINSLEGSLMIEWE*
Ga0073913_100211802	3300005940	Sand	MLVPSTLTVKVTAKVFEEAARNLQINNLEGWLMIERE*
Ga0075156_100480212	3300005982	Wastewater Effluent	MLVPDTLTVKMTVKIERATCKHFEINSLEGSLMIEWE*
Ga0075152_100126105	3300005986	Wastewater Effluent	MLVPDTLTVKMTVKIERATCKHFEINSLEGPLMIEWAK*
Ga0075158_103401872	3300005987	Wastewater Effluent	MLVPDTLTVKMTVKIERATCKHFEINSLEGPLMIEWE*
Ga0075163_101669112	3300006056	Wastewater Effluent	MLVLRTLTVKMTVNFGGAASGALQINSLEGSLMIEWE*
Ga0079303_101021393	3300006930	Deep Subsurface	MLVPDRLTVKVTVKICKAAPGALPINNLEGSLMIEWE*
Ga0103274_11150254	3300007202	Freshwater Lake	MLVLGRLTVKMTVKVCGAATSDLQINSLEGSLMIEWE*
Ga0105044_101860202	3300007521	Freshwater	MLVPDTLTVKMAVKIDRTTWNHFEINSLDGSLMIEWE*
Ga0105044_112983981	3300007521	Freshwater	MLVHGTLTVKMTVKVDQETWNHFQINSLERSLTIEWE
Ga0105090_100064901	3300009075	Freshwater Sediment	MLVPDRLTVKMTVKICEAASNALPINSLEGSLMIEWE*
Ga0105090_101639994	3300009075	Freshwater Sediment	MLVPDRLTVRMTVKIREAVASTLQVNDLDGSLMIEWE*
Ga0105090_102429611	3300009075	Freshwater Sediment	MLVPSASTVKVTVKVFEEAARTLQSNNLEGSLMIEWE*
Ga0105090_103207523	3300009075	Freshwater Sediment	MLVSDRLTVKMTVKIFEAAASALRINSLEGSLMIEWE*
Ga0105090_103505531	3300009075	Freshwater Sediment	MLVPDTLTVKVTVKIFEAAASALQINGLEGSLMIEWE*
Ga0105090_104314182	3300009075	Freshwater Sediment	MLVPGTLTVNVTAKVLEAAASTLQINSLEGSLMIEWE*
Ga0105106_100833933	3300009078	Freshwater Sediment	MLVPSTLTVKVTVKVFEEAARTLQINNGEGSLMIEWE*
Ga0105106_101530032	3300009078	Freshwater Sediment	MLMPDELTVKVTVKGASPLMDALQINSLESSLMIEWE*
Ga0115026_114722141	3300009111	Wetland	MLMPDGLTVNVTVKIWEAAATALQLNSLEGSLMSEWE*
Ga0115027_112862592	3300009131	Wetland	MLVPGTLTVIVTVKVFEAAASALQINNLEGSLMIEWE*
Ga0105100_100373533	3300009166	Freshwater Sediment	MLVPSTLTVKVTVKVFEEAARTLQINNVEGSLMIEWE*
Ga0113563_115521211	3300009167	Freshwater Wetlands	APMLVLDRFTVKMTVEVCEATSSALLINSLERSLMIEWE*
Ga0113563_124167382	3300009167	Freshwater Wetlands	LVPGTLTVNVTVRICEAASGALPINNLEGSLMIEWE*
Ga0113563_126115892	3300009167	Freshwater Wetlands	MLVPAGLTVKVTVKTLAPCSDARQINSLEGSLMIEWE*
Ga0105097_108616421	3300009169	Freshwater Sediment	MLVPSTLTVKVTVKVFEEAARTLQINNLEGSLMIEWE*
Ga0105096_100404063	3300009170	Freshwater Sediment	LGRLTVKVTVKVRVAVESAMKINGLKRSLMIEWE*
Ga0105096_101077952	3300009170	Freshwater Sediment	MLVPDRLTKKMTVKIFEAAASALRTNSLEGSSMIEWE*
Ga0105096_101444251	3300009170	Freshwater Sediment	PAPMLVPSASTVKVTVKVFEEAARTLQSNNLEGSLMIEWE*
Ga0105096_106466191	3300009170	Freshwater Sediment	MLVPSTLTVKVTVEVFEEAAGTLQINNLEGSLMIEWE*
Ga0105101_104560522	3300009171	Freshwater Sediment	MLVLRTLTVKTTVKRRDTAQSPMQINGLEASLMIEWE*
Ga0114938_10058472	3300009430	Groundwater	MLVPGTLTVNVTVKVFEAAASTLQINNLEVSLMIEWE*
Ga0114939_101941201	3300009455	Groundwater	MLVLRTLTVKLTVNFCDAAASPLSINNLERSLMIEWE*
Ga0123573_102447794	3300009509	Mangrove Sediment	MLMLDGLTAKVTVKFCETAASPLSINDLERSLMIEWE*
Ga0116175_12414561	3300009648	Anaerobic Digestor Sludge	MLVPDTLTVKMTVKVDHATWNHFEINSLDGSLMIEWE*
Ga0116167_10116805	3300009654	Anaerobic Digestor Sludge	MLVPNTLTVKMTVKIARATCKHFEINSLEGSLMIEWE*
Ga0116180_10280462	3300009668	Anaerobic Digestor Sludge	MLVPDTLTVKMTVKIDCAAWNHLEINSLDGSLMIEWE*
Ga0116177_1000041632	3300009696	Anaerobic Digestor Sludge	MLVRDTLTVKMTVKIERATCKHFEINSLEGSLMIEWE*
Ga0116155_100499003	3300009771	Anaerobic Digestor Sludge	MLVPGTLTVNVTVKAFEAAASTLQINNLEGSLMIEWE*
Ga0116157_101439482	3300009782	Anaerobic Digestor Sludge	MLVPDTLTVKMTVKIDRTTWNHFEINSLDCSLMIEWE*
Ga0116157_101823472	3300009782	Anaerobic Digestor Sludge	MLVPDTLTVKMTVKIEISTWNHFEINSLEGLLMIEWE*
Ga0131092_1000412933	3300009870	Activated Sludge	MLVLRALTVKMTVNFYVAASGVLQINSLEGSLMIEWE*
Ga0131077_117319511	3300009873	Wastewater	MLVLRTLTVKMTVKVCEAAASALQINSLEGSLMIEWE*
Ga0136644_103074483	3300010334	Freshwater Lake	LRTLTVKMTVNFRGAASGALQINSLEGSLMIEWE*
Ga0074044_108681981	3300010343	Bog Forest Soil	MLMRDRLTVRMTVKICMASASALRINSLEGSLMIEWE*
Ga0116253_108723122	3300010345	Anaerobic Digestor Sludge	RKPAPMLVPDTLTVKMTVKIDRSTWKHFEINSLEGSLMIEWE*
Ga0116253_109594341	3300010345	Anaerobic Digestor Sludge	MLVPDTLTVKMTVKIDRSTWKHFEINSLEGSLMIEWE*
Ga0116248_102219422	3300010351	Anaerobic Digestor Sludge	MLVPDTLTVKMTVKIERATCKHFEINSLEGLLMIEWE*
Ga0116242_105885712	3300010355	Anaerobic Digestor Sludge	MLVPDTLTVKMTVKSYRSIWKHFEINSLEGSLMIEWES*
Ga0116249_112750072	3300010357	Anaerobic Digestor Sludge	PAPMLVLRTLTVKMTVKVCGAAESALRINSLEGSLMIEWE*
Ga0116249_113725722	3300010357	Anaerobic Digestor Sludge	KPAPMLVPGTLTVKMTVNIREAVSRTIQINSLEGLLMIEWE*
Ga0116249_119564521	3300010357	Anaerobic Digestor Sludge	RKPAPMLVLRTLTVKMTVKVCGAAESALRINSLEGSLMIEWE*
Ga0136852_101837622	3300010412	Mangrove Sediment	MLVLRTLTVKLTVKGCGTVASALRINSLEGSLMIEWE*
Ga0138256_101293843	3300012533	Active Sludge	MLVPDTLTVKMTVKSERATCKHFEINSLEGSLMIEWE*
Ga0153915_102164202	3300012931	Freshwater Wetlands	MLVPDRLTVKMTVKIRAAAASTLQINDVEGSLMIEWE*
Ga0154020_100647955	3300012956	Active Sludge	MLVLRTLTVKMTVNFCGSTSGALQINSLEGSLMIEWE*
Ga0075349_10891141	3300014305	Natural And Restored Wetlands	MLVLRTLTAKVTVNFCGAASGALQSNSLEGSLMIECE*
Ga0075345_10906422	3300014312	Natural And Restored Wetlands	MLALRTLTVKVTVNFGGAASGALQINSLEGSLMIEWE*
Ga0075343_10820231	3300014317	Natural And Restored Wetlands	MLVPDRLTVKMTVEICEGVSGALQINSLEGSLMIEWE*
Ga0075348_10286993	3300014319	Natural And Restored Wetlands	MLVPDRLTVKMTVKVCDAAVSTLEINGLESSLMIEW
Ga0182876_100006553	3300015240	Microbial Mat	MLVPDRLTVIVTVNICDAAATALQINGSEGSLMIEWE*
Ga0224505_102355711	3300022214	Sediment	KPAPMLAPDRLTVRMSVKVCEAASIPLRINSLEGSLMIEWE
Ga0214921_101458983	3300023174	Freshwater	MLVPDTLTVKMTVKSELATCKHFEINSLEGSLMIEWE
Ga0209398_10076852	3300025106	Groundwater	MLVPGTLTVNVTVKVFEAAASTLQINNLEVSLMIEWE
Ga0209594_11354392	3300025130	Groundwater	KPAPMLVPGTLTVNVTVKVFEAAASTLQINNLEVSLMIEWE
Ga0209594_11567862	3300025130	Groundwater	MLVPGTLTVNVTVRVFEAASSTLQINNLEGSLMIEWE
Ga0208822_12198792	3300025866	Anaerobic Digestor Sludge	RKPAPMLVPDTLTVKMTVKIERATCKHFEINSLEGSLMIEWE
Ga0210134_10028733	3300025950	Natural And Restored Wetlands	LVPEMLTVKMTVKVCEAVSGALQINSLEGSLMIEWE
Ga0208292_10561211	3300026072	Natural And Restored Wetlands	MLALRTLTVKMTVNFGGAASGALQINSLEGSLMIEWE
Ga0256805_10508861	3300026485	Sediment	MLVPDRLTVKMTVKVCGAAASALRINSLEGSLTIEWVAFEIYRGL
Ga0209392_10035685	3300027683	Freshwater Sediment	MLVPSTLTVKVTVKVFEEAARTLQINNGEGSLMIEWE
Ga0209392_12529741	3300027683	Freshwater Sediment	MLVPDRLTKKMTVKIFEAAASALRTNSLEGSSMIEWE
Ga0209063_10998572	3300027705	Activated Sludge	MLVLDRLTVNMTVKVCGAAAIALRINSLEGSLMIEWE
Ga0208665_101521122	3300027715	Deep Subsurface	MLVPDRLTVKVTVKICKAAPGALPINNLEGSLMIEWE
Ga0209492_10345223	3300027721	Freshwater Sediment	MLVPSTLTVKVTVKVFEEAARTLQINNLEGSLMIEWE
Ga0209703_11266801	3300027723	Freshwater Sediment	MLVPSTLTVKVTVKVFEEAARTLQINNVEGSLMIEWE
Ga0209575_103093232	3300027739	Freshwater	MLDLDGLTVKVTVKICEAEASAMKINSLEGSLMIEWE
Ga0209175_104395381	3300027781	Wastewater Effluent	MLVLRTLTVKMTVNFGGAASGALQINSLEGSLMIEWE
Ga0209490_100685812	3300027823	Freshwater	MLVPDTLTAKMTVKVDQETWNHFQINSLERSLTIEWE
Ga0209262_100501362	3300027841	Freshwater	MRVLRTLTAKVTVKTLVPCSDATQINSLEGSLMIEWE
Ga0209450_100018383	3300027885	Freshwater Lake Sediment	MLVPDKLTVIVTVKLRDTAWSAMQINGLEGSLMIEWE
Ga0209450_100477072	3300027885	Freshwater Lake Sediment	MLALRTLTVKMTVNFGGAASGALQINSLEGSWMIEWE
Ga0209450_100650113	3300027885	Freshwater Lake Sediment	MLVLCALTVKMTVKICGAASNHLRINSLEGSLMIE
Ga0209450_103277042	3300027885	Freshwater Lake Sediment	MLMPDGLTARMTVKLSHAAQSAMQINGLDGSLMIEWE
Ga0209450_103696792	3300027885	Freshwater Lake Sediment	MLVLSTLTVKMTVKVCEAAANTLRINSLEGSLMIEWE
Ga0209496_100606661	3300027890	Wetland	MLVPDTLTVKVTVKIFEAAASALQINGLEGSLMIEWE
Ga0209254_100018293	3300027897	Freshwater Lake Sediment	MLDLDRLTVKVTVRICEAEAGTLQINRLRGSLMFEWE
Ga0209254_100457135	3300027897	Freshwater Lake Sediment	MRAPDRLTVKMTVKIFEAASSALPINSLERSLMIEWE
Ga0209254_100684692	3300027897	Freshwater Lake Sediment	MLVPDRLTVKMTAKICEAAARSIRINSLEGSLMIEWE
Ga0209254_100978563	3300027897	Freshwater Lake Sediment	MLVLSTLTAKMTVKVCVAAASTLQINSVEGSLMIEWE
Ga0209254_101022933	3300027897	Freshwater Lake Sediment	MLVPDRLPAKMTAKICGAAASTLLINSLEGSLMIEWE
Ga0209254_101059382	3300027897	Freshwater Lake Sediment	MLVLHRLTVKMTVKICETEAIDLRINILESPLMIEWE
Ga0209254_101235032	3300027897	Freshwater Lake Sediment	RIVRKPAPMLVPDRLTVKVTVKIFEAAASSLQINNLECLLMIE
Ga0209254_101805192	3300027897	Freshwater Lake Sediment	MLDLDGLTVKVTVKICEAEARAMEINSLEGSLMIEWE
Ga0209254_103045931	3300027897	Freshwater Lake Sediment	MLVLRTSTAKMTANACGAAAGALQINSLEGSLMIEWE
Ga0209254_103064891	3300027897	Freshwater Lake Sediment	MLVLSTLTVEMTVKVCEAAVKTLRINSLERSLMIEWE
Ga0209254_104844881	3300027897	Freshwater Lake Sediment	MLVLGSLTVKVTAEVCKAAVSTLRINSLEGSLMIEWE
Ga0209254_105352751	3300027897	Freshwater Lake Sediment	MLDLVGLTVKVTVKTCEAEASAMQINSFEGSLMIEWE
Ga0209254_105407672	3300027897	Freshwater Lake Sediment	MLVPDRLTVKVTVKVFEVAAIALQINSLEGSLMIEWE
Ga0209254_105793492	3300027897	Freshwater Lake Sediment	MLVLDRLTVKVTVTVWGAAAGALQINSLERSLMIEWE
Ga0209254_106512992	3300027897	Freshwater Lake Sediment	MLMPARLTAKVTVKVCEEAASALQINGLEGLLMIEWE
Ga0209254_108941921	3300027897	Freshwater Lake Sediment	MLVPGTLTVNVTVKIFGAAASALRINSLEGSLMIEWE
Ga0209254_109573152	3300027897	Freshwater Lake Sediment	VLVLRTLTVKMTVKVCEATSSALPINSLEGSLMIEWE
Ga0209253_101678352	3300027900	Freshwater Lake Sediment	MLVPDRLTAKTTVKICEAAASALQINSSEGSSMIEWE
Ga0209253_101691461	3300027900	Freshwater Lake Sediment	MLVLRTLTVKMTAKSCDEPASALQINSLEGSLMIEWE
Ga0209253_102528363	3300027900	Freshwater Lake Sediment	MLVPDRLTVKMTVKVCEAAYSAFQINGLERSLMIEWE
Ga0209253_102696841	3300027900	Freshwater Lake Sediment	MLDLDGLTVKVTVKICEAEASAMQINSLEGSLMIEWE
Ga0209253_104333642	3300027900	Freshwater Lake Sediment	MLMPHGLTVKVTVKICEAAASALSINSLEGSLMIEWE
Ga0209253_108539323	3300027900	Freshwater Lake Sediment	IARIPPPMLMPDRLTVIVTVKTCDAALKAMKINDVEGSLMIEWE
Ga0209253_108766441	3300027900	Freshwater Lake Sediment	MLVLSTLTVKTTVNVCEAAANTLQINSLEGSLMIEWE
Ga0209048_100177521	3300027902	Freshwater Lake Sediment	MLVLSTLTVKMTVKICEAAASTLQINSLEGSLMIEWE
Ga0209048_100642074	3300027902	Freshwater Lake Sediment	MLVLDRLTVKMTVKIREAVASTLQINDLDGSLTIEWE
Ga0209048_102179032	3300027902	Freshwater Lake Sediment	MLVPDRLTVRMTAKIREAVASALQINDLDGSLMIEWE
Ga0209048_110015231	3300027902	Freshwater Lake Sediment	MLVPDRLTVKVTVKVCVAAASALQINSLEGSLMIEWE
Ga0209391_100216643	3300027975	Freshwater Sediment	MLVPSTLTVKVTVKVFEEAARTLQINNFEGSLMIEWE
Ga0209391_100397361	3300027975	Freshwater Sediment	PAPMLVPSTLTVKVTVKVFEEAARTLQINNGEGSLMIEWE
Ga0209391_101281951	3300027975	Freshwater Sediment	MLVPSASTVKVTVKVFEEAARTLQSNNLEGSLMIEWE
Ga0209391_102038371	3300027975	Freshwater Sediment	KPAPMLVLRTLTVKMTAKVCEAASSALPINSLERSLMIEWE
Ga0209391_102242512	3300027975	Freshwater Sediment	MPYGLTARVTVKTCEAAANALRINSVEGSLMIEWE
Ga0209391_102732152	3300027975	Freshwater Sediment	MLVPEMLTVKMTVKVCEAVSGALQINSLEGSLMIEWE
Ga0256305_10932013	3300028108	Freshwater	MLVPDTLTVKMTVKIARATCKHFEINSLEGSLMIEWE
Ga0272412_14149891	3300028647	Activated Sludge	MLVPDTLTVKMTVKIDRATWNHFEINSLGCSLMIEWE
Ga0268298_100736472	3300028804	Activated Sludge	MLVPDTLTVKMTVKLDRATWKHFEINGLEGSLMIEWE
Ga0315899_107764982	3300031784	Freshwater	MLVLSTLTVDMTVKVCEAAVKTLRINSLERSLMIEWE
Ga0315297_113950062	3300031873	Sediment	MLVLRTLTVKVTVNVCAAAASALRINSLEGSLMIEWV
Ga0315295_101930932	3300032156	Sediment	MLVPDRLTVKMTVKICEAAASALLINSLEGSLMIEWE
Ga0315283_104017263	3300032164	Sediment	KIARKPAPMLVLRTLTVKVTVNFCRAASGALQINSLEGLLMIEWE
Ga0315271_100702264	3300032256	Sediment	MSEKVSRLVPDRLTAKMTVRICEAAVSALRINSLEGSLMIEWE
Ga0315287_108465342	3300032397	Sediment	MLVPGTLTVNVTVKVFEAAASTLQSNNLEGSLMIEWE
Ga0315287_125473451	3300032397	Sediment	MLVLNRLTVKMTVRIFEAAASALRINSLEGSLMIEW
Ga0335394_102607602	3300032456	Freshwater	MLVPDTLTVKMAVKIDRTTWNHFEINSLDGSLMIEWE
Ga0315273_110983111	3300032516	Sediment	EPDRLTVKMTVNGCEASTSALPINDLVGSLMIEWE
Ga0316603_101834431	3300033413	Soil	MLVPDRLTVKMTVKICDAAASTLNINSLEGSLMIEWE
Ga0316603_103019501	3300033413	Soil	PAPMLVPDRLTVKMTVKVCEAGASTLQINSLEVSLMIEWE
Ga0316619_121074972	3300033414	Soil	KPAPMLMPHGLTVIVTVTIYDAVTSALQINSLEGSWMIAWE
Ga0316622_1000385592	3300033416	Soil	MLVPAGLTVKVTVKTLAPCSDARQINSLEGSLMIEWE
Ga0316622_1022376511	3300033416	Soil	MLVLRTLTVKMTVKVCEAVVSTLKINSLEGSLMIEWE
Ga0316601_1021099411	3300033419	Soil	MLVPERLTVKVTVKRDDAAQRPMQINGLEGSLMIEWE
Ga0316629_107752811	3300033483	Soil	APMLVLRTLTVKMTVKVCEEAANTLRINSLEGSLMIEWE
Ga0316630_110464341	3300033487	Soil	MLTPDRLTVKATVKIWGVAAGALQINSLEGSLVIEWE
Ga0316621_108203272	3300033488	Soil	MLVPDRLTVKMSVRMVEAAASASQINNLEDSLMIEWE
Ga0316617_1006446313	3300033557	Soil	MLVPDRLTVEVTVKICKAAPGALPINSLEGSLMIEWE
Ga0334985_0354575_224_337	3300034018	Freshwater	MLVLSTLTVKMTVNVCEAAANTLQINSLEGSLMIEWE
Ga0335019_0046043_440_553	3300034066	Freshwater	MLVLRTLTAKMTVNFCRAASGALQINSLEGSLMIEWE
Ga0335050_0007021_7512_7625	3300034108	Freshwater	MLVPDRLTVKVTEKVCVAAASALRIKSLEISLTIEWE
Ga0370484_0125126_387_500	3300034125	Untreated Peat Soil	MLVPDRLTVKVTVDIFDAAVLALQINSLEGSLMIEWE
Ga0335007_0147582_1562_1684	3300034283	Freshwater	PAPMLVPDRLTVKVTVKVCVAAASALRIKSLEISLTIEWE
Ga0335013_0154394_3_125	3300034284	Freshwater	PAPMLVPDRLTVKVTVKVCVAAASALRIKRLEISLTIEWE

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign