| Basic Information | |
|---|---|
| Family ID | F043606 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 156 |
| Average Sequence Length | 45 residues |
| Representative Sequence | DLKAQFDADAAHLKSKASRGKITPALASEMKKDVNKIYDHALGR |
| Number of Associated Samples | 140 |
| Number of Associated Scaffolds | 156 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.28 % |
| % of genes near scaffold ends (potentially truncated) | 96.79 % |
| % of genes from short scaffolds (< 2000 bps) | 91.03 % |
| Associated GOLD sequencing projects | 133 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.718 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (18.590 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.615 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.154 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 75.00% β-sheet: 0.00% Coil/Unstructured: 25.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 156 Family Scaffolds |
|---|---|---|
| PF03576 | Peptidase_S58 | 35.26 |
| PF13177 | DNA_pol3_delta2 | 2.56 |
| PF07617 | DUF1579 | 1.28 |
| PF05960 | DUF885 | 0.64 |
| PF12169 | DNA_pol3_gamma3 | 0.64 |
| PF02403 | Seryl_tRNA_N | 0.64 |
| COG ID | Name | Functional Category | % Frequency in 156 Family Scaffolds |
|---|---|---|---|
| COG3191 | L-aminopeptidase/D-esterase | Amino acid transport and metabolism [E] | 70.51 |
| COG0172 | Seryl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.64 |
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 0.64 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.72 % |
| Unclassified | root | N/A | 1.28 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886012|MBSR1b_contig_3176604 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 2170459005|F1BAP7Q02IBSU6 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 522 | Open in IMG/M |
| 3300000579|AP72_2010_repI_A01DRAFT_1019653 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300000891|JGI10214J12806_11380776 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300004479|Ga0062595_100851181 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300005159|Ga0066808_1037565 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300005175|Ga0066673_10011540 | All Organisms → cellular organisms → Bacteria | 3807 | Open in IMG/M |
| 3300005186|Ga0066676_10558612 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300005289|Ga0065704_10311654 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300005294|Ga0065705_10024713 | All Organisms → cellular organisms → Bacteria | 1872 | Open in IMG/M |
| 3300005295|Ga0065707_11013748 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300005328|Ga0070676_10606582 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300005332|Ga0066388_100016298 | All Organisms → cellular organisms → Bacteria | 6209 | Open in IMG/M |
| 3300005337|Ga0070682_100054681 | All Organisms → cellular organisms → Bacteria | 2506 | Open in IMG/M |
| 3300005440|Ga0070705_100286617 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300005467|Ga0070706_101031361 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300005536|Ga0070697_102137405 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300005539|Ga0068853_101630762 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300005552|Ga0066701_10704280 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300005554|Ga0066661_10551237 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300005564|Ga0070664_100410941 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
| 3300005569|Ga0066705_10113439 | All Organisms → cellular organisms → Bacteria | 1627 | Open in IMG/M |
| 3300005576|Ga0066708_11011764 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300005577|Ga0068857_101300117 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300005587|Ga0066654_10719527 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300005598|Ga0066706_10944308 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300005764|Ga0066903_103273160 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300005764|Ga0066903_106624909 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300005937|Ga0081455_10781419 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300005937|Ga0081455_10783546 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300006169|Ga0082029_1162099 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300009101|Ga0105247_10768710 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300009177|Ga0105248_13336390 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300010043|Ga0126380_11153517 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300010046|Ga0126384_10448224 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300010046|Ga0126384_10808443 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300010046|Ga0126384_10934123 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300010320|Ga0134109_10047787 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300010325|Ga0134064_10264777 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300010326|Ga0134065_10039483 | Not Available | 1418 | Open in IMG/M |
| 3300010326|Ga0134065_10411790 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300010360|Ga0126372_12049756 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300010364|Ga0134066_10237474 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300010366|Ga0126379_13377244 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300010397|Ga0134124_10416665 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
| 3300010397|Ga0134124_12615086 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300010401|Ga0134121_12829336 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300011000|Ga0138513_100059620 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300012096|Ga0137389_11691465 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300012201|Ga0137365_10040035 | All Organisms → cellular organisms → Bacteria | 3579 | Open in IMG/M |
| 3300012202|Ga0137363_10398486 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300012202|Ga0137363_11339666 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300012207|Ga0137381_10974328 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300012208|Ga0137376_10620523 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300012211|Ga0137377_11329314 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300012212|Ga0150985_117313590 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300012285|Ga0137370_10414162 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300012350|Ga0137372_10124472 | All Organisms → cellular organisms → Bacteria | 2133 | Open in IMG/M |
| 3300012350|Ga0137372_10147167 | All Organisms → cellular organisms → Bacteria | 1927 | Open in IMG/M |
| 3300012359|Ga0137385_11241733 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300012360|Ga0137375_10614067 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300012361|Ga0137360_10858120 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300012363|Ga0137390_11836484 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300012519|Ga0157352_1095581 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300012532|Ga0137373_10481740 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300012685|Ga0137397_10705663 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300012882|Ga0157304_1110148 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300012923|Ga0137359_10060662 | All Organisms → cellular organisms → Bacteria | 3297 | Open in IMG/M |
| 3300012927|Ga0137416_11085828 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300012930|Ga0137407_10696196 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300012930|Ga0137407_11478293 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300012948|Ga0126375_11786851 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300012960|Ga0164301_10541400 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300012960|Ga0164301_11375236 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300012961|Ga0164302_11874314 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300012971|Ga0126369_10862422 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300012971|Ga0126369_10973675 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300012977|Ga0134087_10373317 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300012986|Ga0164304_10688203 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300012988|Ga0164306_10518025 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300013296|Ga0157374_10640343 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300013306|Ga0163162_11704565 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300014326|Ga0157380_12745945 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300015051|Ga0137414_1018321 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300015054|Ga0137420_1227745 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300015357|Ga0134072_10287838 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300015358|Ga0134089_10190227 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300015371|Ga0132258_10987838 | All Organisms → cellular organisms → Bacteria | 2127 | Open in IMG/M |
| 3300015372|Ga0132256_101728455 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300015374|Ga0132255_100683668 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
| 3300016357|Ga0182032_11072457 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300016371|Ga0182034_10801009 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300016422|Ga0182039_12235446 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300018072|Ga0184635_10237595 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300018433|Ga0066667_11878030 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300019361|Ga0173482_10743487 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300019870|Ga0193746_1025928 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300019875|Ga0193701_1047137 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300019879|Ga0193723_1041232 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
| 3300019887|Ga0193729_1046756 | All Organisms → cellular organisms → Bacteria | 1770 | Open in IMG/M |
| 3300019890|Ga0193728_1255530 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300020000|Ga0193692_1071011 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300020004|Ga0193755_1102869 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300020012|Ga0193732_1002111 | All Organisms → cellular organisms → Bacteria | 3586 | Open in IMG/M |
| 3300021073|Ga0210378_10350886 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300021344|Ga0193719_10002854 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae | 6967 | Open in IMG/M |
| 3300021344|Ga0193719_10279439 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300021510|Ga0222621_1053784 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300021560|Ga0126371_12263672 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300022534|Ga0224452_1175084 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300022694|Ga0222623_10018086 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2619 | Open in IMG/M |
| 3300022883|Ga0247786_1129403 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300025905|Ga0207685_10755142 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300025907|Ga0207645_10401763 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300025910|Ga0207684_11115344 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300025915|Ga0207693_10231267 | All Organisms → cellular organisms → Bacteria | 1452 | Open in IMG/M |
| 3300025930|Ga0207701_10975097 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300025935|Ga0207709_10916056 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300025960|Ga0207651_10847949 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300026067|Ga0207678_11788112 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300026305|Ga0209688_1029371 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300026314|Ga0209268_1142406 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 590 | Open in IMG/M |
| 3300026317|Ga0209154_1008958 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 4953 | Open in IMG/M |
| 3300026323|Ga0209472_1238885 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300026324|Ga0209470_1001797 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 15533 | Open in IMG/M |
| 3300026324|Ga0209470_1223594 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300026330|Ga0209473_1308935 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300026334|Ga0209377_1045623 | All Organisms → cellular organisms → Bacteria | 1989 | Open in IMG/M |
| 3300026343|Ga0209159_1279536 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300026530|Ga0209807_1052684 | All Organisms → cellular organisms → Bacteria | 1871 | Open in IMG/M |
| 3300026537|Ga0209157_1325145 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300026555|Ga0179593_1234478 | Not Available | 6506 | Open in IMG/M |
| 3300026785|Ga0207496_105510 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300027018|Ga0208475_1010493 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300027502|Ga0209622_1029132 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300028711|Ga0307293_10160785 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300028768|Ga0307280_10342325 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300028787|Ga0307323_10121549 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300028791|Ga0307290_10235552 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300028807|Ga0307305_10422676 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300028814|Ga0307302_10648372 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300028828|Ga0307312_10785031 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300028885|Ga0307304_10359220 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300031093|Ga0308197_10297261 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300031128|Ga0170823_13784960 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300031231|Ga0170824_105413546 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300031231|Ga0170824_121515052 | All Organisms → cellular organisms → Bacteria | 1588 | Open in IMG/M |
| 3300031231|Ga0170824_123921410 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300031446|Ga0170820_12985173 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300031720|Ga0307469_12287881 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300031942|Ga0310916_10970295 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300031996|Ga0308176_11326281 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300032013|Ga0310906_11329359 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300033412|Ga0310810_10030127 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 6602 | Open in IMG/M |
| 3300033412|Ga0310810_10953842 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300033475|Ga0310811_11489870 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 18.59% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.18% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.41% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.13% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.85% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.92% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.92% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.28% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.28% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.28% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.28% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.28% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.28% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.28% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.28% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.64% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.64% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.64% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.64% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.64% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.64% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.64% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.64% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.64% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.64% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.64% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.64% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.64% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005159 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPB | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019870 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m1 | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020000 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020012 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026785 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A5w-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027018 | Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN575 (SPAdes) | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MBSR1b_0217.00003720 | 2162886012 | Miscanthus Rhizosphere | RRPVLVDLKAQFDADAAHLKSKASHGKITPALASEMKKDVNKTYDHALGR |
| E41_04804220 | 2170459005 | Grass Soil | GPVLVNLKGQFDADAAHLQSKASRGKITPALATEMKNDINKTYDHALGR |
| AP72_2010_repI_A01DRAFT_10196531 | 3300000579 | Forest Soil | PVLVNLKGQFDADAAHLRSKASRSKITPALATEMKNDINKTYDHALGR* |
| JGI10214J12806_113807761 | 3300000891 | Soil | FTARRPVLVDLKAQFDADAAHLKSKASHGKVTPALASEMKKDVNKIYDHALGR* |
| Ga0062595_1008511811 | 3300004479 | Soil | VDLKAQFDADAAHIKSKASHGKITPALASEMKKDVNKVYDHALGR* |
| Ga0066808_10375651 | 3300005159 | Soil | GQFDADAAHLQSKASRGKITPALATEMKSDVNKTYDHALGR* |
| Ga0066673_100115401 | 3300005175 | Soil | KAQFDADAAHLRSKASHGKVTSALASEMKKDINKIYDHALGR* |
| Ga0066676_105586121 | 3300005186 | Soil | IDLKAQFDADAAHLRSKASHGKVTSALASEMKKDINKIYDHALGR* |
| Ga0065704_103116541 | 3300005289 | Switchgrass Rhizosphere | VNLKGQFDADAAHLKSKASRGKITPALATEMKNDINKTYDHALGR* |
| Ga0065705_100247131 | 3300005294 | Switchgrass Rhizosphere | PVLVNLKGQFDADAAHLKSKASRGKITPALATEMKNDINKTYDHALGR* |
| Ga0065707_110137481 | 3300005295 | Switchgrass Rhizosphere | RRPVLVNLKGQFDADAAHLKSKASRGKITPALATEMKNDINKTYDHALGR* |
| Ga0070676_106065821 | 3300005328 | Miscanthus Rhizosphere | DKFTARRPVFVDLKAQFDADAAHIKSKASRGKVTPALASEMKKDVNKTYDHALGR* |
| Ga0066388_1000162981 | 3300005332 | Tropical Forest Soil | EKFTARRPVLVNLKGQFDADAAHLRSKSSRGKITPALATEMKNDINKTYDHALGR* |
| Ga0070682_1000546814 | 3300005337 | Corn Rhizosphere | RPVLVDLKAQFDADAAHLKSKASHGKVTPALASEMKKDVNKIYDHALGR* |
| Ga0070705_1002866171 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | ARRPVFVDLKAQFDADAAHIKSKASRGKVTPALASEMKKDVNKTYDHALGR* |
| Ga0070706_1010313611 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | FDADAAHLKSKASRGKITPALATEMKSDINKTYDHALGR* |
| Ga0070697_1021374052 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | IDLKAQFDADATHLRSKASRGKVTPALAAEMKKDVNKIYDHALGR* |
| Ga0068853_1016307622 | 3300005539 | Corn Rhizosphere | ARRPVLVDLKAQFDADAAHLKSKASHGKITPALASEMKKDVNKTYDHALGR* |
| Ga0066701_107042802 | 3300005552 | Soil | DADAAHLRSKASHGKVTPALASEMKKDINKIYDHALGR* |
| Ga0066661_105512371 | 3300005554 | Soil | FTARRPVLIDLKAQFDADATHLRSKASRGKITPALASEMKKDVNKIYDHALGR* |
| Ga0070664_1004109413 | 3300005564 | Corn Rhizosphere | PVLVDLKAQFDADAAHLKSKASHGKVTPALASEMKKDVNKIYDHALGR* |
| Ga0066705_101134393 | 3300005569 | Soil | KFTARRPVFVDLKAQFDADAAHIKSKATRGKITPALASEMKKDVNKIYDHALGR* |
| Ga0066708_110117642 | 3300005576 | Soil | PVFVDLKAQFDADAAHIKSKATRGKISPALASEMKKDVNKIYDHALGR* |
| Ga0068857_1013001173 | 3300005577 | Corn Rhizosphere | RPVFVDLKAQFDADAAHLKSKATRGKITPALASEMKKDVNKIYDHALGR* |
| Ga0066654_107195271 | 3300005587 | Soil | VLIDLKAQFDADAAHLRSKASRGKITPALANEMKKDVNKVYNHALGR* |
| Ga0066706_109443082 | 3300005598 | Soil | KAQFDADAAHLRSKASHGKVTPALATEMKKDVNKIYDHALGR* |
| Ga0066903_1032731603 | 3300005764 | Tropical Forest Soil | VFVDLKAQFDADAAHIKSKASRGKITPALASEMKKDVNKTYDHALGR* |
| Ga0066903_1066249092 | 3300005764 | Tropical Forest Soil | DEKFTARRPVLVDLKAQFDADAAHLKSKASHGKITPALASEMKKDVNKIYNHALGQ* |
| Ga0081455_107814191 | 3300005937 | Tabebuia Heterophylla Rhizosphere | DLKAQFDADAAHIKSKATRGKITPVLASEMKKDVNKTYDHALGR* |
| Ga0081455_107835461 | 3300005937 | Tabebuia Heterophylla Rhizosphere | DADAAHIKSKASRGKVTPALASEMKKDVNKIYDHALGR* |
| Ga0082029_11620992 | 3300006169 | Termite Nest | VNLKGQFDADAAHLRSKASRGKITPALATEMKNDINKTYDHALGR* |
| Ga0105247_107687101 | 3300009101 | Switchgrass Rhizosphere | DADAAHIKSKASRGKVTPALASEMKKDVNKTYDHALGR* |
| Ga0105248_133363902 | 3300009177 | Switchgrass Rhizosphere | DAAHIKSKASRGKVTPALASEMKKDVNKTYDHALGR* |
| Ga0126380_111535171 | 3300010043 | Tropical Forest Soil | MTGCDLMGQFDEDATHLRSKASQGKITPALLVEMKKDVNTMYDHALGR* |
| Ga0126384_104482241 | 3300010046 | Tropical Forest Soil | KGQFDADAAHLRRKASQGKVTPALASEMKKDVNKIYDHALGR* |
| Ga0126384_108084431 | 3300010046 | Tropical Forest Soil | QFKADAAHLQSKASRGKVTPALAIEMKKDINKIYHHALGR* |
| Ga0126384_109341231 | 3300010046 | Tropical Forest Soil | TARRPVLVDLKGQFDADATHLRSKASRGKVTPALASEMKKDVNKIYDHALGR* |
| Ga0134109_100477871 | 3300010320 | Grasslands Soil | VLVDLKGQFDADAAHLRSKASRGKVTPALASEMKKDVNKIYDHALGR* |
| Ga0134064_102647772 | 3300010325 | Grasslands Soil | AHLRSKASRGKVTPALASEMKKDVNKIYDHALGR* |
| Ga0134065_100394832 | 3300010326 | Grasslands Soil | NLKGQFDADAAHLRSKASRGKITPALGTEMKNDINKT* |
| Ga0134065_104117901 | 3300010326 | Grasslands Soil | TARRPVLVDLKGQFDADAAHLRSKASRGKITPALPAEMKKDVNKIYDHALGRQT* |
| Ga0126372_120497561 | 3300010360 | Tropical Forest Soil | DLKAQFDADAAHLKSKASRGKITPALASEMKKDVNKIYDHALGR* |
| Ga0134066_102374741 | 3300010364 | Grasslands Soil | DLKAQFDADAAHLRSKASRGKITPALANEMKKDVNKVYNHALGR* |
| Ga0126379_133772441 | 3300010366 | Tropical Forest Soil | AHIKSKASRGKITPALASEMKKDVNKAYDHALGR* |
| Ga0134124_104166651 | 3300010397 | Terrestrial Soil | ARRPVLVDLKAQFDADAAHLKSKASKGKVTPALASEMKKDVNKTYDHALGR* |
| Ga0134124_126150861 | 3300010397 | Terrestrial Soil | FDADAAHLKSKASRGKITPALASEMKKDVNKIYDHALGR* |
| Ga0134121_128293362 | 3300010401 | Terrestrial Soil | FDADATHLRSKASRGKVTPGLATEMKKDVNKIYDHALGR* |
| Ga0138513_1000596201 | 3300011000 | Soil | LKGQFDADAAHLKSKASRGKITPALATEMKNDINKTYDHALGR* |
| Ga0137389_116914651 | 3300012096 | Vadose Zone Soil | QFDADAAHLKSKASRGKITPALATEMKNDINKTYDHALGR* |
| Ga0137365_100400351 | 3300012201 | Vadose Zone Soil | DAAHLKSKASRGKITPALATEMKNDINKTYDHALGR* |
| Ga0137363_103984862 | 3300012202 | Vadose Zone Soil | LLRVCLKAQFDADAAHLKSKASRGKITPALASEMKKDVNKIYDHALGR* |
| Ga0137363_113396662 | 3300012202 | Vadose Zone Soil | DADAAHLRSKASRGKITPALATEMKKDVNKIYDHALGR* |
| Ga0137381_109743283 | 3300012207 | Vadose Zone Soil | DAAHLRSKASRGKVTPELATEMKKDVNKIYDHALGR* |
| Ga0137376_106205233 | 3300012208 | Vadose Zone Soil | DEKFTARRPVLVNLKGQFDADAAHLRSKASRGKITPALATEMKNDINKTYDHALGR* |
| Ga0137377_113293141 | 3300012211 | Vadose Zone Soil | RRPVLIDLKAQFDADAAHIRSKASRGKITPALATEMKKDVNKIYDHALGR* |
| Ga0150985_1173135902 | 3300012212 | Avena Fatua Rhizosphere | ARRPVLVDLKAQFDADAAHLKSKASHGKVTPALASEMKKDVNKIYDHALGR* |
| Ga0137370_104141623 | 3300012285 | Vadose Zone Soil | LKAQFDADAAHLRSKASRGKVTPALASEMKKDVNKIYDHALGR* |
| Ga0137372_101244724 | 3300012350 | Vadose Zone Soil | RPVLVDLKAQFDADAAHLRSKASRGKITPALPAEMKKDVNKIYDHALGR* |
| Ga0137372_101471671 | 3300012350 | Vadose Zone Soil | AQFKADAAHLRSKASRGKVTPALASEMKKDTNKIYDHALGR* |
| Ga0137385_112417331 | 3300012359 | Vadose Zone Soil | DAAHLKSKASRGKITPALASEMKKDVNKIYDHALGR* |
| Ga0137375_106140671 | 3300012360 | Vadose Zone Soil | EKFTARRPVLVDLKGQFDADAAHLRSKASRGKITPALATEMKNDINKTYDHALGR* |
| Ga0137360_108581201 | 3300012361 | Vadose Zone Soil | DADAAHLRSKASRGKVTPALPSEMKKDVNKIYDHALAR* |
| Ga0137390_118364842 | 3300012363 | Vadose Zone Soil | DADAAHLKSKASHGKITPALASEMKKDVNKIYDHALGR* |
| Ga0157352_10955812 | 3300012519 | Unplanted Soil | RRPVLVDLKAQFDADAAHLKSKASRGKITPALASEMKNDVNKTYDHALGR* |
| Ga0137373_104817401 | 3300012532 | Vadose Zone Soil | IADEKFTARRPVLVDLKAQFDADAAHLKSKASRGKITPALASEMKKDVNKIYDHALGR* |
| Ga0137397_107056633 | 3300012685 | Vadose Zone Soil | FDADAAHLKSKASRGKITPALATEMKNDINKTYDHALGR* |
| Ga0157304_11101482 | 3300012882 | Soil | VDLKAQFDADAAHLRSKASGGKITPALASEMKKDVNKIYDHALGR* |
| Ga0137359_100606621 | 3300012923 | Vadose Zone Soil | ATHLRSKATRGKITPALATEMKKDVNKIYDHALGRQT* |
| Ga0137416_110858283 | 3300012927 | Vadose Zone Soil | PVLIDLKAQFDADAAHLRSKASRGKITPALATEMKKDVNKIYDHALGR* |
| Ga0137407_106961961 | 3300012930 | Vadose Zone Soil | TARRPVLIDLKSQFDADAAHLRSKASRGKITPALATEMKKDVHKIYDHALGR* |
| Ga0137407_114782931 | 3300012930 | Vadose Zone Soil | ALADEKFTARRPVLVDLKAQFDADAAHLKSKASHGKVTPALASEMKKDVNKIYDHALGR* |
| Ga0126375_117868512 | 3300012948 | Tropical Forest Soil | DAAHIKSKASHGKITPALASEMKKDVNKIYNHALGR* |
| Ga0164301_105414003 | 3300012960 | Soil | DAAHLKSKASHGKVTPALASEMKKDVNKIYDHALRR* |
| Ga0164301_113752361 | 3300012960 | Soil | ARRPVLVDLKAQFDADAAHLKSKASKGKVTPALASEMKKDVNKIYDHALGR* |
| Ga0164302_118743141 | 3300012961 | Soil | ADAAHLKSKASKGKVTPALASEMKKDVNKIYDHALGR* |
| Ga0126369_108624221 | 3300012971 | Tropical Forest Soil | FDADAAHLKSKASRGKVTPALASEMKKDVNKIYDHALGR* |
| Ga0126369_109736753 | 3300012971 | Tropical Forest Soil | DADATHLRSKASRGKVTPALASEMKKDVNKIYDHALGR* |
| Ga0134087_103733171 | 3300012977 | Grasslands Soil | IDLKAQFDADAAHLRSKASHGKVTPALATEMKKDVNKIYDHALGR* |
| Ga0164304_106882033 | 3300012986 | Soil | DLKAQFDADAAHLKSKASKGKVTPALASEMKKDVNKIYDHALGR* |
| Ga0164306_105180251 | 3300012988 | Soil | DADAAHLKSKASKGKVTPALATEMKKDVNKIYDHALGR* |
| Ga0157374_106403431 | 3300013296 | Miscanthus Rhizosphere | ADATHLRSKASRGKVTPALASEMKKDVNKVYDHALGR* |
| Ga0163162_117045653 | 3300013306 | Switchgrass Rhizosphere | LIDLKGQFDADATHLRSKASRGKVTPALASEMKKDVNKVYDHALGR* |
| Ga0157380_127459453 | 3300014326 | Switchgrass Rhizosphere | DAAHLQSKASRGKITPALATEMKNDVNKTYDHALGR* |
| Ga0137414_10183214 | 3300015051 | Vadose Zone Soil | AIADEKFTARRPVLVDLKAQFDADVAHLKSKASHGKVTPALASEMKKDVNKIYDHALGR* |
| Ga0137420_12277452 | 3300015054 | Vadose Zone Soil | LKAQFDADAAHLKSKASHGKVTPALASEMKKDVNKIYDHALGR* |
| Ga0134072_102878381 | 3300015357 | Grasslands Soil | AAHLRSKASRGKVTPALASEMKKDVNKIYDHALGR* |
| Ga0134089_101902271 | 3300015358 | Grasslands Soil | VLIDLKAQFDADAAHIRSKASRGKITPALATEMKKDVNKIYDHALGR* |
| Ga0132258_109878381 | 3300015371 | Arabidopsis Rhizosphere | EKFTARRPVLVNLKGQFDADAAHLQSKASRGKITPALATEMKNDVNKTYDHALGR* |
| Ga0132256_1017284551 | 3300015372 | Arabidopsis Rhizosphere | AHLKSKASRGKVTPALASEMKKDVNKIYDHALGR* |
| Ga0132255_1006836681 | 3300015374 | Arabidopsis Rhizosphere | TARRPVFVDLKAQFDADAAHIKSKASRGKVTPALASEMKKDVNKTYDHALGR* |
| Ga0182032_110724573 | 3300016357 | Soil | VNLKGQFDADAAHLRSKASRGKITPALATEMKNDINKTYDHALGR |
| Ga0182034_108010091 | 3300016371 | Soil | GQFDADAAHLRSKASRGKITPALATEMKNDINKTYDHALGR |
| Ga0182039_122354462 | 3300016422 | Soil | PVFVDLKAQFDADAAHIKSKASRGEVTPALASEMKKDVNKIYDHALGR |
| Ga0184635_102375951 | 3300018072 | Groundwater Sediment | PVLVDLKAQFDADAAHLKSKASRGKITPALASEMKKDVNKTYDHALGR |
| Ga0066667_118780302 | 3300018433 | Grasslands Soil | VLIDLKAQFDADAAHLRSKASRGKITPALANEMKKDVNKVYDHALGR |
| Ga0173482_107434872 | 3300019361 | Soil | VDLKAQFDADAAHLRSKASGGKITPALASEMKKDVNKIYDHALGR |
| Ga0193746_10259282 | 3300019870 | Soil | KFTARRPVLVNLKGQFDADAAHLKSKASRGKITPALATEMKSDINKTYDHALGR |
| Ga0193701_10471373 | 3300019875 | Soil | FTARRPVLVDLKGQFDADAAHLRSKASRGKVTPALASEMKKDVNKVYDHALGR |
| Ga0193723_10412323 | 3300019879 | Soil | TARRPVLVDLKSQFDADATHLRSKASRGKVTPALAAEMKKDVNKIYDHALGQQT |
| Ga0193729_10467561 | 3300019887 | Soil | RRPVLIDLKAQFDADATHLRSKAGRGKVTPALAAEMKKDVNKIYDHALGRQT |
| Ga0193728_12555303 | 3300019890 | Soil | VDLKGQFDADATHLRSKASRGKVTPGLATEMKKDLNKIYDHALGR |
| Ga0193692_10710111 | 3300020000 | Soil | DAAHLKSKASHGKVTPALASHMKKDVNKIYDHALGR |
| Ga0193755_11028693 | 3300020004 | Soil | DADAAHLKSKASRGKITPALATEMKSDINKTYDHALGR |
| Ga0193732_10021111 | 3300020012 | Soil | DAGATHLRSKASRGKVTPALASEMKKDVNKVYDHALGR |
| Ga0210378_103508862 | 3300021073 | Groundwater Sediment | LVNLKGQFDADAAHLKSKASRGKITPALATEMKNDINKTYDHALGR |
| Ga0193719_100028541 | 3300021344 | Soil | KGQFDADAAHLKSKASRGKITPALATEMKSDINKTYDHALGR |
| Ga0193719_102794391 | 3300021344 | Soil | QFDADAAHLKSKASRGKITPALATEMKSDINKTYDHALGR |
| Ga0222621_10537843 | 3300021510 | Groundwater Sediment | DEKFTARRPVLVNLKGQFDADAAHLKSKASRGKITPALATEMKNDINKTYDHALGR |
| Ga0126371_122636722 | 3300021560 | Tropical Forest Soil | AAHLKSKAGRGKVTPAPASEMKKDVNKIYDHALGR |
| Ga0224452_11750843 | 3300022534 | Groundwater Sediment | ADAAHLKSKASRGKITPALATEMKNDINKTYDHALGR |
| Ga0222623_100180861 | 3300022694 | Groundwater Sediment | NLKGQFDADAAHLKSKASRGKITPALATEMKNDINKTYDHALGR |
| Ga0247786_11294032 | 3300022883 | Soil | DADAAHLKSKASKGKVTPALASEMKKDVNKIYDHALGR |
| Ga0207685_107551422 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | QFDADAAHIKSKASRGKITPALATDMKKDINKTYDHALGR |
| Ga0207645_104017633 | 3300025907 | Miscanthus Rhizosphere | DKFTARRPVFVDLKAQFDADAAHIKSKASRGKVTPALASEMKKDVNKTYDHALGR |
| Ga0207684_111153441 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | PVLVDLKGQFDADAAHLRSKASRGKVTPALATEMKKDVNKIYDHALGR |
| Ga0207693_102312671 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | EKFTARRPVLVNLKGQFDADAAHLQSKASRGKITPALATEMKNDVNKTYDHALGR |
| Ga0207701_109750973 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | VFVDLKAQFDADAAHLKSKATRGKVTPALASEMKKDVNKIYDHALGR |
| Ga0207709_109160561 | 3300025935 | Miscanthus Rhizosphere | LKAQFDADAAHIKSKASRGKVTPALASEMKKDVNKTYDHALGR |
| Ga0207651_108479493 | 3300025960 | Switchgrass Rhizosphere | DLKAQFDADAAHIKSKASRGKVTPALASEMKKDVNKTYDHALGR |
| Ga0207678_117881122 | 3300026067 | Corn Rhizosphere | AAHLQSKASRGKITPALATEMKNDVNKTYDHALGR |
| Ga0209688_10293712 | 3300026305 | Soil | VLVDLKGQFDADAAHLRSKASRGKVTPALASEMKKDVNKIYDHALGR |
| Ga0209268_11424061 | 3300026314 | Soil | EKFTARRPVLGNLKGQFDADAAHLRSKASRGKITPALGTEMKNDINKTYDHALGR |
| Ga0209154_10089587 | 3300026317 | Soil | TARRPVLIDLKAQFDADAAHIRSKASRAKITPALATEMKKDVNKIYDHALGR |
| Ga0209472_12388852 | 3300026323 | Soil | FTARRPVLIDLKAQFDADAAHLRSKGSHGKVTSALASEMKKDVNKIYDHALGR |
| Ga0209470_100179719 | 3300026324 | Soil | QFDADAAHLRSKASRGKITPALATEMKKDVNKIYDHALGRQT |
| Ga0209470_12235943 | 3300026324 | Soil | IDLKAQFDADAAHLRSKASHGKVTSALASEMKKDINKIYDHALGR |
| Ga0209473_13089352 | 3300026330 | Soil | ARRPVLIDLKAQFDADAAHLRSKASHGKVTPALATEMKKDVNKIYDHALGR |
| Ga0209377_10456231 | 3300026334 | Soil | TARRPVLIDLKAQFDADAAHLRSKASRGKITPALATEMKKDVNKIYDHALGR |
| Ga0209159_12795361 | 3300026343 | Soil | DLKAQFDADAAHIRSKASRGKITPALATEMKKDVNKIYDHALGR |
| Ga0209807_10526841 | 3300026530 | Soil | VDLKGQFDADAAHLRSKASRGKVTPALASEMKKDVNKIYDHALGR |
| Ga0209157_13251451 | 3300026537 | Soil | VLVDLKGQFDADAAHLRSKATRGKVTPALASEMKKDVNKIYDHALGR |
| Ga0179593_12344782 | 3300026555 | Vadose Zone Soil | MRKFTARRPVLVDLKGQFDADATHLRSKASRGKVTPGLATEMKKDVNKIYDHALGR |
| Ga0207496_1055101 | 3300026785 | Soil | IVNLKGQFDADAAHLQIKASRGKITPALATEMKNDVNKTYDHALGR |
| Ga0208475_10104931 | 3300027018 | Soil | GQFDADAAHLRSKASRGKVTSALASEMKKDTNKIYDHALGR |
| Ga0209622_10291321 | 3300027502 | Forest Soil | RPVLVDLKAQFDADAAHLKSKASRGKITPALASEMKKDVNKTYDHALGR |
| Ga0307293_101607853 | 3300028711 | Soil | KFTARRPVLVDLKGQFDADATHLRSKASRGKVTPALASEMKKDVNKVYDHALGR |
| Ga0307280_103423251 | 3300028768 | Soil | PVLVDLKTQFDADAAHLKSKASHGKITPALASEMKKDVNKIYDHALGR |
| Ga0307323_101215491 | 3300028787 | Soil | VLVNLKGQFDADAAHLKSKASRGKITPALATEMKNDINKTYDHALGR |
| Ga0307290_102355523 | 3300028791 | Soil | ADAAHLRSKASRGKVTPALASEMKKDTNKIYDHALGR |
| Ga0307305_104226763 | 3300028807 | Soil | DADATHLRSKASRGKVTPALAGEMKKDVNKVYDHALGR |
| Ga0307302_106483722 | 3300028814 | Soil | PVLVNLKGQFDADAAHLKSKASRGKITPALATEMKNDINKTYDHALGR |
| Ga0307312_107850311 | 3300028828 | Soil | KGQFDADAAHLKSKASRGKITPALATEMKNDINKTYDHALGR |
| Ga0307304_103592203 | 3300028885 | Soil | EEKFTARRPVLVDLKAQFDADAAHLKSKASHGKVTPALASEMKKDVNKIYDHALGR |
| Ga0308197_102972612 | 3300031093 | Soil | GQFDADAAHLQSKASRGKITPALATEMKNDVNKTYDHALGR |
| Ga0170823_137849601 | 3300031128 | Forest Soil | IDLKGQFDSDAAHLRSKASRGKVTPALANEMKKDVNKIYDHALCR |
| Ga0170824_1054135463 | 3300031231 | Forest Soil | DADAAHLKSKASHGKITPALASEMKKDVNKIYDHALGR |
| Ga0170824_1215150522 | 3300031231 | Forest Soil | VINHLAAQFKADTAHLRSKAGRGKVTPALASEMKKDINKIYDHASGR |
| Ga0170824_1239214101 | 3300031231 | Forest Soil | PVLIDLKQKFDNDATHLRSKASQGKVTPALAAEMKKSVNKIYDHALGRQT |
| Ga0170820_129851731 | 3300031446 | Forest Soil | PVLIDLKAQFDADATHLRSKASRGKVTPALASEMKKDVNKIYDHALGR |
| Ga0307469_122878811 | 3300031720 | Hardwood Forest Soil | QFDADAAHLQSKASRGKITPALATEMKNDINKTYDHALGR |
| Ga0310916_109702952 | 3300031942 | Soil | LKGQFDADAAHLKSKASRGKITPALATEMKSDINKTYDHALGR |
| Ga0308176_113262813 | 3300031996 | Soil | DADAAHLKSKASHGKVTPALASEMKKDVNKIYDHALGR |
| Ga0310906_113293592 | 3300032013 | Soil | DADAAHLKSKASHGKITPALASEMKKDVNKTYDHALGR |
| Ga0310810_100301271 | 3300033412 | Soil | VDLKAQFDADAAHLKSKASHGKVTPALASEMKKDVNKIYDHALGR |
| Ga0310810_109538421 | 3300033412 | Soil | RPVLVDLKAQFDADAAHLKSKASHGKVTPALASEMKKDVNKIYDHALGR |
| Ga0310811_114898702 | 3300033475 | Soil | EKFTARRPVVVDLKAQFDADAAHLKSKASHGKITPALASEMKKDVNKIYDHAIGR |
| ⦗Top⦘ |