Basic Information | |
---|---|
Family ID | F043582 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 156 |
Average Sequence Length | 38 residues |
Representative Sequence | MPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPPSQR |
Number of Associated Samples | 125 |
Number of Associated Scaffolds | 156 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 67.95 % |
% of genes near scaffold ends (potentially truncated) | 34.62 % |
% of genes from short scaffolds (< 2000 bps) | 71.15 % |
Associated GOLD sequencing projects | 120 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.34 |
Hidden Markov Model |
---|
|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (87.179 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (8.333 % of family members) |
Environment Ontology (ENVO) | Unclassified (39.744 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.590 % of family members) |
⦗Top⦘ |
Full Alignment |
---|
Alignment of all the sequences in the family. |
IDLabel .2.4.6.8.10.12.14.16.18.20.22.24.26.28.30.32.34.36.38.40.42.44.46.48.50.52. |
Powered by MSAViewer |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 43.08% β-sheet: 0.00% Coil/Unstructured: 56.92% |
Feature Viewer | |||||
Position : 0 Zoom : x 1 Enter the variants Position Original Variant |
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
Powered by PDBe Molstar |
⦗Top⦘ |
⦗Top⦘ |
Visualization |
---|
All Organisms Unclassified |
Powered by ApexCharts |
⦗Top⦘ |
Visualization |
---|
Soil Natural And Restored Wetlands Groundwater Sediment Watersheds Soil Soil Terrestrial Soil Tropical Forest Soil Surface Soil Soil Soil Agricultural Soil Soil Soil Forest Soil Soil Hardwood Forest Soil Soil Soil Tropical Peatland Tropical Forest Soil Corn, Switchgrass And Miscanthus Rhizosphere Corn Rhizosphere Switchgrass Rhizosphere Peat Soil Weathered Mine Tailings Arabidopsis Rhizosphere Corn Rhizosphere Tabebuia Heterophylla Rhizosphere Switchgrass Rhizosphere Miscanthus Rhizosphere Arabidopsis Rhizosphere Switchgrass Rhizosphere Populus Rhizosphere Switchgrass Rhizosphere Miscanthus Rhizosphere Corn Rhizosphere Corn Rhizosphere Rhizosphere Soil Switchgrass Rhizosphere Miscanthus Rhizosphere Corn Rhizosphere Simulated |
Powered by ApexCharts |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FACENCA_6470570 | 2035918004 | Soil | MKMPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARPTSQR |
GPICI_00450640 | 2088090015 | Soil | MPLLFYFPYIVWMGMMQIVQDEMRVPVKIKARPPIRH |
FWIRElOz_09810590 | 2124908007 | Soil | MPLLFYFPLIVWMGMMEIANDEMRVPVDVRTRPPARR |
cont_0015.00000590 | 2166559005 | Simulated | MPLLFYFPFIVWMGLMEIAQDEMRVPVRVKTRSTSQH |
INPhiseqgaiiFebDRAFT_1044028511 | 3300000364 | Soil | MPLLLYFPLIIWMGMLGAMQDEMRPATAKVRRRN* |
AF_2010_repII_A01DRAFT_10000713 | 3300000580 | Forest Soil | MPLLFYFPFIVWMGLMEIAQDEMRVPVRVKTRTATQR* |
JGI11643J11755_116727881 | 3300000787 | Soil | MPLLFYFPYIVWMGMMQIVHDEMRVPVKIKARPPVRH* |
JGI1027J11758_130096152 | 3300000789 | Soil | MPLLFYFPYIVWMGMMQIVQDEMRVPVKIKARPPIRH* |
Ga0066814_100752032 | 3300005162 | Soil | LGFRTDARYKKMPLLFYFPFIVWMGLMEVAQDEMRIPIKVKARPPSQR* |
Ga0066815_101181382 | 3300005164 | Soil | LEFRTDARYKKMPLLFYFPFIVWMGMMEIAQDEMRAPVRVKAQKPSQR* |
Ga0070666_101045263 | 3300005335 | Switchgrass Rhizosphere | LGFRTDARYKKMPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPPSQR* |
Ga0070661_1001499373 | 3300005344 | Corn Rhizosphere | LGFRTDARYKKMPLLFYFPFIVWMGLMEVAQDEMRIPIKVKA* |
Ga0070713_1002903923 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | AQKMPLLFYFPLIIWMGMMEIAHDEMRVPVNDRTRTPARR* |
Ga0070705_1003559293 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MKMPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARPTSQR* |
Ga0070741_1000869623 | 3300005529 | Surface Soil | MPLLFYFPLIVWMGMAEIMRDEMKVPDTADTRRRTQKQ* |
Ga0070672_1001988393 | 3300005543 | Miscanthus Rhizosphere | MPLLFYFPFIVWMGLMEVAQDEMRIPIKVKARPPSQR* |
Ga0070695_1012226922 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VTRDTKMPLLFYFPLIVWMGMLEAMQDEMRVPVTAKPRR* |
Ga0070665_1015996792 | 3300005548 | Switchgrass Rhizosphere | MPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPPSQR* |
Ga0068855_1008088701 | 3300005563 | Corn Rhizosphere | KKMPLLFYFPLIIWMGVLEAMQDEMRVAATAKARR* |
Ga0070664_1001402482 | 3300005564 | Corn Rhizosphere | MPLLFYFPLIVWMGMLGALQDEMRVPATVKARREV* |
Ga0070664_1003959483 | 3300005564 | Corn Rhizosphere | MPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPTAQR* |
Ga0070664_1009768211 | 3300005564 | Corn Rhizosphere | KMPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPPSQR* |
Ga0068857_1011795482 | 3300005577 | Corn Rhizosphere | LGFRTDARYKKMPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPTAQR* |
Ga0068856_1000381866 | 3300005614 | Corn Rhizosphere | MPLLFYFPLIIWMGMMEIAHDEMRVPVNDRTRTPARR* |
Ga0068852_1019154831 | 3300005616 | Corn Rhizosphere | QKMPLLFYFPLIVWMGMLEAMQDEMRVPATAKPRR* |
Ga0066905_1000399402 | 3300005713 | Tropical Forest Soil | MPLLFYFPYIVWMGMMQLVQDEMRVPVKIKARPPVRN* |
Ga0066905_1000822044 | 3300005713 | Tropical Forest Soil | MPLLFYFPYIVWMGMMQLVQDEMRVPVKIKARPPIRH* |
Ga0066905_1002711372 | 3300005713 | Tropical Forest Soil | MPLLFYFPYIIWMGMMQIAQDEMRVPVKIKPRPPVRN* |
Ga0066903_1000201902 | 3300005764 | Tropical Forest Soil | MPLLFYFPFIIWTGMLQLAQDEMCVPAKVKAPVQR* |
Ga0066903_1000716536 | 3300005764 | Tropical Forest Soil | MPLLFYFPFIVWMGMLEIAQDEMRVPVKVRTPVPR* |
Ga0066903_1015379042 | 3300005764 | Tropical Forest Soil | EMPLLFYFPFIIWMGMLEIAHDEMRVPIKVKAPVR* |
Ga0066903_1017938042 | 3300005764 | Tropical Forest Soil | MPLLLYFPLIIWMGMLEAMQDEMRPATAKVRRRN* |
Ga0068860_1013696892 | 3300005843 | Switchgrass Rhizosphere | MPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARPTSQR* |
Ga0068860_1017483172 | 3300005843 | Switchgrass Rhizosphere | LLFYFPLIIWMGMMEIAHDEMRVPVNDRTRTPARR* |
Ga0081455_1000980611 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MPLLFYFPYIIWMGMMQIVQDEMRVPVKIKARPPVRN* |
Ga0081455_100563194 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MPLLFYFPYIVWMGMMQFVQDEMRVPVKIKARPPVRN* |
Ga0075432_104611721 | 3300006058 | Populus Rhizosphere | MPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARTPSQR* |
Ga0075018_106618612 | 3300006172 | Watersheds | MPLLFYFPLIIWMGMMEIAHDEMRGPVNVRTRTPARR* |
Ga0074055_118257071 | 3300006573 | Soil | QKMPLLFYFPLIIWMGMLEAMQDEMRVPATAKPRR* |
Ga0074053_111698612 | 3300006575 | Soil | MPLLFYFPFIVWMGMMEIAQDEMRAPVRVKAQKPSQR* |
Ga0074053_119297962 | 3300006575 | Soil | QKMPLLFYFPLIVWMGMLEAIQDEMRVPATAKARR* |
Ga0074053_119591991 | 3300006575 | Soil | KMPLLFYFPLIIWMGMMEIAHDEMRVPVNVRTRTPARR* |
Ga0075433_110165972 | 3300006852 | Populus Rhizosphere | LGFRTDARYKKMPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARTPSQR* |
Ga0074063_128768332 | 3300006953 | Soil | KGEKQKMPLLFYFPLIIWMGMLEAMQDEMRVPATAKPRR* |
Ga0079219_101143042 | 3300006954 | Agricultural Soil | MPLLLYFPLIVWMGLMGVAQDQMRVPVKVKATPSLPR* |
Ga0079219_117889162 | 3300006954 | Agricultural Soil | MPLLFYFPLIIWMGMLEAVQDEMRVPATVRVRRPDRRQ* |
Ga0105240_115310192 | 3300009093 | Corn Rhizosphere | MKMPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARTPSQR* |
Ga0111539_106137751 | 3300009094 | Populus Rhizosphere | TGTRDKKMPLFLYFPLIIWMGMLEAMQDEMRASAPVKLRR* |
Ga0075418_129603091 | 3300009100 | Populus Rhizosphere | MPLLFYFPYIVWMGMMQIVQDEMRVPVKIKARPPVRN* |
Ga0105247_100683615 | 3300009101 | Switchgrass Rhizosphere | MPLLFYFPLIIWMGMMEIAQDEMRAPVNVRTPTPARR* |
Ga0114129_101261491 | 3300009147 | Populus Rhizosphere | DNMPLLFYFPYIVWMGMMQLVQDEMRIPVKIKARPPARN* |
Ga0111538_106735832 | 3300009156 | Populus Rhizosphere | ARYMKMPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARPTSQR* |
Ga0105249_131116722 | 3300009553 | Switchgrass Rhizosphere | MPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPTSQR* |
Ga0126374_100029802 | 3300009792 | Tropical Forest Soil | MPLLFYFPFIVWMGLMEIAQDEMRVPVRVKTRTPTQR* |
Ga0126380_100100553 | 3300010043 | Tropical Forest Soil | MPLLFYFPFIVWMGLIEIAQDEMRVPVRVKTRTPTQR* |
Ga0126380_122653462 | 3300010043 | Tropical Forest Soil | MPLLFYFPFIVWMGLMEVAQNEMRIPIKVKARTPSQR* |
Ga0126384_119357521 | 3300010046 | Tropical Forest Soil | MPLLFYFPYIIWMGMIELAQEEMRVAIKVKARPTARG* |
Ga0126382_100233483 | 3300010047 | Tropical Forest Soil | MPLLFYFPYIVWMGMMQFVQDEMRVPAKVKMRPPVRN* |
Ga0127503_112939791 | 3300010154 | Soil | QKMPLLFYFPLIIWMGMMEIAHDEMRVPVNARTRTPARR* |
Ga0126370_107383222 | 3300010358 | Tropical Forest Soil | MPLLFYFPFIVWMGLMEVAQDEMRVPVRVKTRAPTQR* |
Ga0126377_128893132 | 3300010362 | Tropical Forest Soil | MPLLFYFPFIVWMGMLEIAREEMRVPVKVKTPVRR* |
Ga0126379_124421102 | 3300010366 | Tropical Forest Soil | MPLLFYFPFIVWMGMLEIAQDEMRVPAKVRTPVPR* |
Ga0134125_100590412 | 3300010371 | Terrestrial Soil | MPLLLYFPLIIWMGMLEALRDETRVPATVKARRG* |
Ga0134125_103837902 | 3300010371 | Terrestrial Soil | MKMPLLFYFPFIVWMGLMEVAQDEMRIPIKVKARPPSQR* |
Ga0134128_102675302 | 3300010373 | Terrestrial Soil | MPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARPPSQR* |
Ga0134128_114396871 | 3300010373 | Terrestrial Soil | LLLYFPLIVWMGLMGVAQDQMRVPVKVKATPSLPR* |
Ga0134126_102026572 | 3300010396 | Terrestrial Soil | MPLLFHFPFIVWMGLMEVAQDEMRIPVKVKARPPSQR* |
Ga0126383_100307147 | 3300010398 | Tropical Forest Soil | MPLLFYFPYIVWMGMMQFVQDEMRVPAKVKARPPIRN* |
Ga0134127_111187123 | 3300010399 | Terrestrial Soil | MKMPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPTSQR* |
Ga0134121_102716273 | 3300010401 | Terrestrial Soil | AQKMPLLFYFPLIIWMGMMEIAQDEMRAPVNVRTPTPARR* |
Ga0124844_10633793 | 3300010868 | Tropical Forest Soil | MPLLFYFPFIVWMGLMEIAQDEMRVPVMVKTRTPTQR* |
Ga0105246_108188491 | 3300011119 | Miscanthus Rhizosphere | KMPLLFYFPLIVWMGMLGALQDEMRVPATVKARREV* |
Ga0157341_10080952 | 3300012494 | Arabidopsis Rhizosphere | MPLLFYFPFIVWLGLMEVAQDEMRIPVKVKARPTAQR* |
Ga0157330_10182553 | 3300012514 | Soil | MPLLFYFPFIVWMGLMEVAQDEMRIPVNVKARPTAQR* |
Ga0157306_100240591 | 3300012912 | Soil | KMPLLFYFPLIVWMGMLEAMQDEMRVPVTAKPRR* |
Ga0164299_100037186 | 3300012958 | Soil | MPLLFYFPFIVWMFLLAVVQDEMRIPVKVKARPTSQR* |
Ga0126369_137104611 | 3300012971 | Tropical Forest Soil | MPLLFYFPFIVWMGMLEIAQDEMRVPVKVRTPVPR |
Ga0168317_10405482 | 3300012982 | Weathered Mine Tailings | MPMLLYFPLIIWMGMFGVVQDEMRVPVKAKASQRR* |
Ga0164308_100957602 | 3300012985 | Soil | MKMPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPPSQR* |
Ga0157369_123307641 | 3300013105 | Corn Rhizosphere | KMPLLFYFPLIVWMGMLEAMQDEMRVPATAKPRR* |
Ga0163162_102197984 | 3300013306 | Switchgrass Rhizosphere | MKMPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARPPSQR* |
Ga0132258_104620513 | 3300015371 | Arabidopsis Rhizosphere | MPLLFYFPFIVWMGMLEIAHDEMRVPLKVKAPVGR* |
Ga0132258_115706321 | 3300015371 | Arabidopsis Rhizosphere | LALGFRTDARYKKMPLLFYFPFIVWMGLMEVAQDEMRIPIKVKARPPSQR* |
Ga0132258_129435062 | 3300015371 | Arabidopsis Rhizosphere | MPLLFYFPLIIWMGMMEIAHDEMRVPVNVRTRTLARP* |
Ga0132258_137365142 | 3300015371 | Arabidopsis Rhizosphere | MPLLFYFPLIVWMGMLEIAHDEMRVPLKTPVRRLDRELT* |
Ga0132255_1040831582 | 3300015374 | Arabidopsis Rhizosphere | FRTDARYKKMPLLFYFPFIVWMGLMEVAQDEMRIPIKVKARPPSQR* |
Ga0132255_1042352981 | 3300015374 | Arabidopsis Rhizosphere | MPLLFYFPFIVWMGLMEIAQDEMRVPVRVKTRTPTHG* |
Ga0132255_1044875292 | 3300015374 | Arabidopsis Rhizosphere | MPLLFYFPLIVWMGLMEVAQDEMRIPVKVKARPTAQR* |
Ga0182037_1000002026 | 3300016404 | Soil | MPLLLYFPFIVWMGLMEVAQDEMRVPVRVKTRTPTQR |
Ga0163161_102306451 | 3300017792 | Switchgrass Rhizosphere | DARYMKMPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARPTAQR |
Ga0187786_101292212 | 3300017944 | Tropical Peatland | MPLLFYFPFIVWMGLMEVAQDEMRIPVRVKAQTPPHR |
Ga0187785_100005575 | 3300017947 | Tropical Peatland | MPLLLYFPLIIWIGMVEIVQGEMLTRAKSKVPTPPRRR |
Ga0187785_100110553 | 3300017947 | Tropical Peatland | MPLLFYFPLIVWMGLMEVAQDEMRIPVRVKAQTPPHR |
Ga0187785_100166924 | 3300017947 | Tropical Peatland | MPLLFYFPFIVWMGLMEVAQDEMRVPVRVKTRAPTQR |
Ga0187783_110070601 | 3300017970 | Tropical Peatland | MPLLFYFPFIVWMGMLEIAHDEMRVPLKVKAPVQR |
Ga0187780_101657343 | 3300017973 | Tropical Peatland | KREAYAMPLLLYFPLIVWMGMMEIARQEMHVPVRVKAQSRQQ |
Ga0187787_100003435 | 3300018029 | Tropical Peatland | MPLLLYFPLIIWMGMMEIVQGEMRVPVRTRVPTQPQR |
Ga0187766_112072781 | 3300018058 | Tropical Peatland | KMPLLFYFPFIVWMGLMEVAQDEMRIPVRVKAQTPPHR |
Ga0184635_1000004722 | 3300018072 | Groundwater Sediment | MPLLFYFPYIVWMGMMEYARDEGRVPVKIKTQPPPR |
Ga0193719_100801123 | 3300021344 | Soil | PLLFYFPLIIWMGMMEIAHDEMRGPVNVRTRTPARR |
Ga0126371_100291182 | 3300021560 | Tropical Forest Soil | MPLLFYFPFIIWMGMLEIAHDEMRVPIKVKAPVIRR |
Ga0126371_104090432 | 3300021560 | Tropical Forest Soil | MPLLFYFPFIVWMGLMEIAQDEMRVPVRVKTRTATQR |
Ga0126371_108018521 | 3300021560 | Tropical Forest Soil | MPLLFYFPYIIWMGMMQIVQDEMRVPVKIKARPPVRN |
Ga0247792_10153982 | 3300022880 | Soil | EKKMPLLFYFPLIIWMGVLEAMQDEMRVAATAKARR |
Ga0247789_10013985 | 3300023266 | Soil | TKMPLLFYFPLIVWMGMLEAMQDEMRVPVTAKPRR |
Ga0247661_10824571 | 3300024254 | Soil | MPLLFHFPFIVWMGLMEVAQDEMRIPVKVKARPTAQR |
Ga0210094_10786212 | 3300025549 | Natural And Restored Wetlands | MPLLFYFPLIIWMGMVEIMHDELRVPAKAKVGTPARL |
Ga0207680_110983602 | 3300025903 | Switchgrass Rhizosphere | KKMPLLFYFPLIIWMGVLEAIQDEMRVAATAKARR |
Ga0207645_105478032 | 3300025907 | Miscanthus Rhizosphere | MKMPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPPSQR |
Ga0207645_106614991 | 3300025907 | Miscanthus Rhizosphere | TVTRDAKMPLLFYFPLIVWMGMLEAMQDEMRVPVTAKPRR |
Ga0207654_108939982 | 3300025911 | Corn Rhizosphere | GFRTDARYKKMPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPPSQR |
Ga0207707_106619062 | 3300025912 | Corn Rhizosphere | EMPLLFYFPLIIWMGMMEIAQDEMRAPVNVRTPTPARR |
Ga0207693_100623052 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLLFYFPLIIWMGMMEIAHDEMRGPVNVRTRAPARR |
Ga0207663_106039192 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARTPSQR |
Ga0207662_108765022 | 3300025918 | Switchgrass Rhizosphere | MPLLFYFPLIIWMGMMEIAHDELRVPVNVRTRTPARR |
Ga0207657_100527401 | 3300025919 | Corn Rhizosphere | DARYKKMPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARTPSQR |
Ga0207687_102261633 | 3300025927 | Miscanthus Rhizosphere | EAQKMPLLFYFPLIIWMGMMEIAHDEMRVPVNDRTRTPARR |
Ga0207690_112197292 | 3300025932 | Corn Rhizosphere | MPLLFYFPLIVWMGMLGALQDEMRVPATVKARREV |
Ga0207706_101425482 | 3300025933 | Corn Rhizosphere | MPLLFYFPLIIWMGMMEIAQDEMRAPVNVRTPTPARR |
Ga0207670_110981141 | 3300025936 | Switchgrass Rhizosphere | MPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPPSQ |
Ga0207669_103133402 | 3300025937 | Miscanthus Rhizosphere | KKMPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPPSQR |
Ga0207704_103477332 | 3300025938 | Miscanthus Rhizosphere | MPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARPPSQR |
Ga0207665_100272824 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLLFYFPLIIWMGMMEIAHDEMRVPVNVRTRTPARR |
Ga0207689_104014952 | 3300025942 | Miscanthus Rhizosphere | MKMPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARTPSQR |
Ga0207668_102309582 | 3300025972 | Switchgrass Rhizosphere | MPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPTSQR |
Ga0207668_103929701 | 3300025972 | Switchgrass Rhizosphere | TGREAQKMPLLFYFPLIIWMGMMEIAHDEMRVPVNGRTRTTARR |
Ga0207668_104290032 | 3300025972 | Switchgrass Rhizosphere | ARKKMPLLFYFPLIIWMGVLEAMQDEMRVAATAKARR |
Ga0207648_112524631 | 3300026089 | Miscanthus Rhizosphere | MPLLFYFPFIVWMGMMEIAQDEMRAPVRVKAQTPSQR |
Ga0207439_1019032 | 3300026740 | Soil | PQREKKMPLLFYFPLIIWMGVLEAMQDEMRVAATAKARR |
Ga0207576_1021521 | 3300026745 | Soil | QREKKMPLLFYFPLIIWMGVLEAMQDEMRVAATAKARR |
Ga0207497_1061432 | 3300026786 | Soil | IQKMPLLFYFPLIVWMGMLEAMQDEMRVPATAKPRR |
Ga0307287_101727402 | 3300028796 | Soil | MPLLFYFPYIIWMGMMEIVQDEMRAPVKIKAQTPARR |
Ga0307503_100020511 | 3300028802 | Soil | MPLLLYFPLIIWMGMLEVARSEIRSPAEAKVRVPTRR |
Ga0308203_10371241 | 3300030829 | Soil | KMPLLFYFPFIVWMGLMEIAQDEMRVPVRVKTRSTSQH |
Ga0075377_111015082 | 3300030844 | Soil | MPLLFYFPLIIWMGMMEIAHDEMRVPVNVRTPTPARR |
Ga0307497_100092653 | 3300031226 | Soil | MPLLFYFPFIVWMGLIEVVQDEMRIPVKVKARPTSQR |
Ga0310888_100558853 | 3300031538 | Soil | MPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPTAQR |
Ga0318534_100323833 | 3300031544 | Soil | MPLLFYFPFIVWMGLMEVAQDEMRVPVRVKTRTPTQR |
Ga0310887_101085141 | 3300031547 | Soil | RTDARYMKMPLLFYFPFIVWMGLIEVVQDEMRIPVKVKARPTSQR |
Ga0310813_101338083 | 3300031716 | Soil | EAQKMPLLFYFPLIIWMGMLEVAHDEMRVPVNVRTRTPARR |
Ga0310813_110976042 | 3300031716 | Soil | RYKKMPLLFYFPFIVWMGLMEVAQDEMRIPIKVKARPPSQR |
Ga0306919_100788291 | 3300031879 | Soil | ARYKKMPLLFYFPFIVWMGLMEVAQDEMRVPVRVKTRTPTQR |
Ga0310901_100499452 | 3300031940 | Soil | MKMPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPTSQR |
Ga0310884_104693512 | 3300031944 | Soil | TVTRDTKMPLLFYFPLIVWMGMLEAMQDEMRVPVTAKPRR |
Ga0308176_111231442 | 3300031996 | Soil | MPLLLYFPLIVWVSMMEIVQQEMHIPVRVKAQVRQR |
Ga0310895_100016881 | 3300032122 | Soil | ITRDTKMPLLFYFPLIVWMGMLEAMQDEMRVPVTAKPRR |
Ga0307472_1003356613 | 3300032205 | Hardwood Forest Soil | MPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPSSQR |
Ga0335085_100418637 | 3300032770 | Soil | MPLLLYFPLIIWMGMVEIVQGEMRVPAKTRVPTQPRR |
Ga0335084_100432724 | 3300033004 | Soil | MPLLFYFPLIIWMGMLEIVQDEMRVPARVRVPPQR |
Ga0335084_111892242 | 3300033004 | Soil | MPLLLYFPLIIWMGMLEAMQDEMRVPVTAKASAKSELS |
Ga0335084_113202292 | 3300033004 | Soil | MPLLLYFPLIVWMGMMEFAHQEMRVPVKVKAQSPQR |
Ga0310810_101614663 | 3300033412 | Soil | MPLLFYFPLIIWMGMLEVAHDEMRVPVNVRTRTPARR |
Ga0326726_100015452 | 3300033433 | Peat Soil | MPLLFYLPLIIWMGMVEIVQEEMRVPARVRVPPQRRRDA |
Ga0326726_102407693 | 3300033433 | Peat Soil | MPLLFYFPLIIWMGMVEIMHDELRVFAKAKVGTPARL |
Ga0316628_1018314112 | 3300033513 | Soil | MPLLFYFPLIVWMGMMEIMQDEMRVPAKIKARRSEQR |
Ga0373948_0028991_1000_1104 | 3300034817 | Rhizosphere Soil | MPLLFYFPLIIWMGMMEIAHDEMRVPVNVRTRTPA |
⦗Top⦘ |