Metagenome / Metatranscriptome Family F043582

Basic Information
Family ID	F043582
Family Type	Metagenome / Metatranscriptome
Number of Sequences	156
Average Sequence Length	38 residues
Representative Sequence	MPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPPSQR
Number of Associated Samples	125
Number of Associated Scaffolds	156

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	67.95 %
% of genes near scaffold ends (potentially truncated)	34.62 %
% of genes from short scaffolds (< 2000 bps)	71.15 %
Associated GOLD sequencing projects	120
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.34

Most Common Taxonomy
Group	Bacteria (87.179 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (8.333 % of family members)
Environment Ontology (ENVO)	Unclassified (39.744 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (43.590 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 43.08% β-sheet: 0.00% Coil/Unstructured: 56.92%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 156 Family Scaffolds
PF00294	PfkB	54.49
PF04392	ABC_sub_bind	8.33
PF01522	Polysacc_deac_1	3.85
PF01832	Glucosaminidase	3.21
PF01925	TauE	2.56
PF02630	SCO1-SenC	2.56
PF06559	DCD	1.28
PF03330	DPBB_1	1.28
PF07859	Abhydrolase_3	1.28
PF04536	TPM_phosphatase	1.28
PF03734	YkuD	0.64
PF13185	GAF_2	0.64
PF14707	Sulfatase_C	0.64
PF00884	Sulfatase	0.64
PF08501	Shikimate_dh_N	0.64
PF03960	ArsC	0.64
PF06532	NrsF	0.64
PF00069	Pkinase	0.64
PF13683	rve_3	0.64
PF13641	Glyco_tranf_2_3	0.64
PF13416	SBP_bac_8	0.64
PF00528	BPD_transp_1	0.64
PF04820	Trp_halogenase	0.64
PF00155	Aminotran_1_2	0.64
PF02737	3HCDH_N	0.64

COG ID	Name	Functional Category	% Frequency in 156 Family Scaffolds
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	8.33
COG0726	Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family	Cell wall/membrane/envelope biogenesis [M]	3.85
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	2.56
COG0730	Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family	Inorganic ion transport and metabolism [P]	2.56
COG1225	Peroxiredoxin	Posttranslational modification, protein turnover, chaperones [O]	2.56
COG1999	Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family	Posttranslational modification, protein turnover, chaperones [O]	2.56
COG0657	Acetyl esterase/lipase	Lipid transport and metabolism [I]	1.28
COG0717	dCTP deaminase	Nucleotide transport and metabolism [F]	1.28
COG4944	Uncharacterized conserved protein	Function unknown [S]	0.64
COG0169	Shikimate 5-dehydrogenase	Amino acid transport and metabolism [E]	0.64
COG3034	Murein L,D-transpeptidase YafK	Cell wall/membrane/envelope biogenesis [M]	0.64
COG2084	3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase	Lipid transport and metabolism [I]	0.64
COG1748	Saccharopine dehydrogenase, NADP-dependent	Amino acid transport and metabolism [E]	0.64
COG1393	Arsenate reductase or related protein, glutaredoxin family	Inorganic ion transport and metabolism [P]	0.64
COG1376	Lipoprotein-anchoring transpeptidase ErfK/SrfK	Cell wall/membrane/envelope biogenesis [M]	0.64
COG1250	3-hydroxyacyl-CoA dehydrogenase	Lipid transport and metabolism [I]	0.64
COG1004	UDP-glucose 6-dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	0.64
COG0677	UDP-N-acetyl-D-mannosaminuronate dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	0.64
COG0287	Prephenate dehydrogenase	Amino acid transport and metabolism [E]	0.64
COG0240	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	0.64

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	87.18 %
Unclassified	root	N/A	12.82 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	87.18 %
Unclassified	root	N/A	12.82 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	87.18 %
Unclassified	root	N/A	12.82 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	58.97 %
Unclassified	root	N/A	12.82 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.64 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	51.28 %
Unclassified	root	N/A	12.82 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.64 %

Name	Rank	Taxonomy	Distribution
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	45.51 %
Unclassified	root	N/A	12.82 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1.28 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	1.28 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.64 %
Sphingomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	0.64 %

Name	Rank	Taxonomy	Distribution
Xanthobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae	17.31 %
Unclassified	root	N/A	12.82 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	7.05 %
Rhodovibrionaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodovibrionaceae	4.49 %
unclassified Rhodospirillales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales	1.28 %
Nakamurellales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales	0.64 %
Alphaproteobacteria bacterium HGW-Alphaproteobacteria-5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium HGW-Alphaproteobacteria-5	0.64 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.64 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.64 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	0.64 %

Name	Rank	Taxonomy	Distribution
Pseudolabrys	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	17.31 %
Unclassified	root	N/A	12.82 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	5.77 %
Limibacillus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodovibrionaceae → Limibacillus	4.49 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	1.28 %
Hyphomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	0.64 %
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	0.64 %
Nakamurellaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae	0.64 %
Alphaproteobacteria bacterium HGW-Alphaproteobacteria-5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium HGW-Alphaproteobacteria-5	0.64 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.64 %

Name	Rank	Taxonomy	Distribution
unclassified Pseudolabrys	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys	14.74 %
Unclassified	root	N/A	12.82 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	5.77 %
Limibacillus halophilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodovibrionaceae → Limibacillus → Limibacillus halophilus	4.49 %
Pseudolabrys taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	2.56 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	1.28 %
Nakamurella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella	0.64 %
Hyphomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	0.64 %
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	0.64 %
Alphaproteobacteria bacterium HGW-Alphaproteobacteria-5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium HGW-Alphaproteobacteria-5	0.64 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.64 %

Name	Rank	Taxonomy	Distribution
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	13.46 %
Unclassified	root	N/A	12.82 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	5.77 %
Limibacillus halophilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodovibrionaceae → Limibacillus → Limibacillus halophilus	4.49 %
Pseudolabrys taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	2.56 %
Pseudolabrys sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	1.28 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	1.28 %
Nakamurella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella	0.64 %
Hyphomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	0.64 %
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	0.64 %
Alphaproteobacteria bacterium HGW-Alphaproteobacteria-5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium HGW-Alphaproteobacteria-5	0.64 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	0.64 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2035918004\|FACENC_F56XM5W01ER7A8	Not Available	538	Open in IMG/M
2088090015\|GPICI_9105347	All Organisms → cellular organisms → Bacteria	2305	Open in IMG/M
2124908007\|FWIRElOz_GKZ9IRQ02IE3PB	Not Available	501	Open in IMG/M
2166559005\|cont_contig04015	All Organisms → cellular organisms → Bacteria	2135	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_104402851	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	708	Open in IMG/M
3300000580\|AF_2010_repII_A01DRAFT_1000071	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	11358	Open in IMG/M
3300000787\|JGI11643J11755_11672788	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	530	Open in IMG/M
3300000789\|JGI1027J11758_13009615	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodovibrionaceae → Limibacillus → Limibacillus halophilus	618	Open in IMG/M
3300005162\|Ga0066814_10075203	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	598	Open in IMG/M
3300005164\|Ga0066815_10118138	Not Available	513	Open in IMG/M
3300005335\|Ga0070666_10104526	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1955	Open in IMG/M
3300005344\|Ga0070661_100149937	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1762	Open in IMG/M
3300005436\|Ga0070713_100290392	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1502	Open in IMG/M
3300005440\|Ga0070705_100355929	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1069	Open in IMG/M
3300005529\|Ga0070741_10008696	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	20180	Open in IMG/M
3300005543\|Ga0070672_100198839	All Organisms → cellular organisms → Bacteria	1676	Open in IMG/M
3300005545\|Ga0070695_101222692	All Organisms → cellular organisms → Bacteria	619	Open in IMG/M
3300005548\|Ga0070665_101599679	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	659	Open in IMG/M
3300005563\|Ga0068855_100808870	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	995	Open in IMG/M
3300005564\|Ga0070664_100140248	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2128	Open in IMG/M
3300005564\|Ga0070664_100395948	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1262	Open in IMG/M
3300005564\|Ga0070664_100976821	All Organisms → cellular organisms → Bacteria → Proteobacteria	795	Open in IMG/M
3300005577\|Ga0068857_101179548	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	741	Open in IMG/M
3300005614\|Ga0068856_100038186	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4714	Open in IMG/M
3300005616\|Ga0068852_101915483	All Organisms → cellular organisms → Bacteria	615	Open in IMG/M
3300005713\|Ga0066905_100039940	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2769	Open in IMG/M
3300005713\|Ga0066905_100082204	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2121	Open in IMG/M
3300005713\|Ga0066905_100271137	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1316	Open in IMG/M
3300005764\|Ga0066903_100020190	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	7057	Open in IMG/M
3300005764\|Ga0066903_100071653	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	4440	Open in IMG/M
3300005764\|Ga0066903_101537904	All Organisms → cellular organisms → Bacteria	1258	Open in IMG/M
3300005764\|Ga0066903_101793804	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1172	Open in IMG/M
3300005843\|Ga0068860_101369689	All Organisms → cellular organisms → Bacteria	729	Open in IMG/M
3300005843\|Ga0068860_101748317	All Organisms → cellular organisms → Bacteria	644	Open in IMG/M
3300005937\|Ga0081455_10009806	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	9809	Open in IMG/M
3300005937\|Ga0081455_10056319	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	3340	Open in IMG/M
3300006058\|Ga0075432_10461172	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodovibrionaceae → Limibacillus → Limibacillus halophilus	559	Open in IMG/M
3300006172\|Ga0075018_10661861	Not Available	561	Open in IMG/M
3300006573\|Ga0074055_11825707	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1712	Open in IMG/M
3300006575\|Ga0074053_11169861	Not Available	555	Open in IMG/M
3300006575\|Ga0074053_11929796	All Organisms → cellular organisms → Bacteria	681	Open in IMG/M
3300006575\|Ga0074053_11959199	All Organisms → cellular organisms → Bacteria	1076	Open in IMG/M
3300006852\|Ga0075433_11016597	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	722	Open in IMG/M
3300006953\|Ga0074063_12876833	All Organisms → cellular organisms → Bacteria → Proteobacteria	887	Open in IMG/M
3300006954\|Ga0079219_10114304	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	1359	Open in IMG/M
3300006954\|Ga0079219_11788916	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	574	Open in IMG/M
3300009093\|Ga0105240_11531019	Not Available	699	Open in IMG/M
3300009094\|Ga0111539_10613775	All Organisms → cellular organisms → Bacteria	1267	Open in IMG/M
3300009100\|Ga0075418_12960309	All Organisms → cellular organisms → Bacteria	518	Open in IMG/M
3300009101\|Ga0105247_10068361	All Organisms → cellular organisms → Bacteria → Proteobacteria	2215	Open in IMG/M
3300009147\|Ga0114129_10126149	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	3518	Open in IMG/M
3300009156\|Ga0111538_10673583	All Organisms → cellular organisms → Bacteria	1311	Open in IMG/M
3300009553\|Ga0105249_13111672	Not Available	533	Open in IMG/M
3300009792\|Ga0126374_10002980	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	5462	Open in IMG/M
3300010043\|Ga0126380_10010055	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4204	Open in IMG/M
3300010043\|Ga0126380_12265346	Not Available	503	Open in IMG/M
3300010046\|Ga0126384_11935752	Not Available	562	Open in IMG/M
3300010047\|Ga0126382_10023348	All Organisms → cellular organisms → Bacteria	3265	Open in IMG/M
3300010154\|Ga0127503_11293979	All Organisms → cellular organisms → Bacteria	1032	Open in IMG/M
3300010358\|Ga0126370_10738322	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodovibrionaceae → Limibacillus → Limibacillus halophilus	870	Open in IMG/M
3300010362\|Ga0126377_12889313	Not Available	554	Open in IMG/M
3300010366\|Ga0126379_12442110	Not Available	622	Open in IMG/M
3300010371\|Ga0134125_10059041	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	4264	Open in IMG/M
3300010371\|Ga0134125_10383790	All Organisms → cellular organisms → Bacteria	1558	Open in IMG/M
3300010373\|Ga0134128_10267530	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1917	Open in IMG/M
3300010373\|Ga0134128_11439687	All Organisms → cellular organisms → Bacteria → Proteobacteria	759	Open in IMG/M
3300010396\|Ga0134126_10202657	All Organisms → cellular organisms → Bacteria → Proteobacteria	2373	Open in IMG/M
3300010398\|Ga0126383_10030714	All Organisms → cellular organisms → Bacteria	4261	Open in IMG/M
3300010399\|Ga0134127_11118712	All Organisms → cellular organisms → Bacteria	852	Open in IMG/M
3300010401\|Ga0134121_10271627	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	1491	Open in IMG/M
3300010868\|Ga0124844_1063379	All Organisms → cellular organisms → Bacteria	1341	Open in IMG/M
3300011119\|Ga0105246_10818849	All Organisms → cellular organisms → Bacteria	828	Open in IMG/M
3300012494\|Ga0157341_1008095	Not Available	851	Open in IMG/M
3300012514\|Ga0157330_1018255	Not Available	774	Open in IMG/M
3300012912\|Ga0157306_10024059	All Organisms → cellular organisms → Bacteria	1335	Open in IMG/M
3300012958\|Ga0164299_10003718	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	4917	Open in IMG/M
3300012971\|Ga0126369_13710461	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	500	Open in IMG/M
3300012982\|Ga0168317_1040548	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1216	Open in IMG/M
3300012985\|Ga0164308_10095760	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2072	Open in IMG/M
3300013105\|Ga0157369_12330764	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	542	Open in IMG/M
3300013306\|Ga0163162_10219798	All Organisms → cellular organisms → Bacteria	2030	Open in IMG/M
3300015371\|Ga0132258_10462051	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3166	Open in IMG/M
3300015371\|Ga0132258_11570632	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	1661	Open in IMG/M
3300015371\|Ga0132258_12943506	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1182	Open in IMG/M
3300015371\|Ga0132258_13736514	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1038	Open in IMG/M
3300015374\|Ga0132255_104083158	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodovibrionaceae → Limibacillus → Limibacillus halophilus	619	Open in IMG/M
3300015374\|Ga0132255_104235298	Not Available	608	Open in IMG/M
3300015374\|Ga0132255_104487529	Not Available	592	Open in IMG/M
3300016404\|Ga0182037_10000020	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	59853	Open in IMG/M
3300017792\|Ga0163161_10230645	All Organisms → cellular organisms → Bacteria	1437	Open in IMG/M
3300017944\|Ga0187786_10129221	All Organisms → cellular organisms → Bacteria → Proteobacteria	888	Open in IMG/M
3300017947\|Ga0187785_10000557	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	13746	Open in IMG/M
3300017947\|Ga0187785_10011055	All Organisms → cellular organisms → Bacteria	3066	Open in IMG/M
3300017947\|Ga0187785_10016692	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	2561	Open in IMG/M
3300017970\|Ga0187783_11007060	Not Available	600	Open in IMG/M
3300017973\|Ga0187780_10165734	All Organisms → cellular organisms → Bacteria	1535	Open in IMG/M
3300018029\|Ga0187787_10000343	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	7897	Open in IMG/M
3300018058\|Ga0187766_11207278	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodovibrionaceae → Limibacillus → Limibacillus halophilus	548	Open in IMG/M
3300018072\|Ga0184635_10000047	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	21495	Open in IMG/M
3300021344\|Ga0193719_10080112	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	1419	Open in IMG/M
3300021560\|Ga0126371_10029118	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	5154	Open in IMG/M
3300021560\|Ga0126371_10409043	All Organisms → cellular organisms → Bacteria	1499	Open in IMG/M
3300021560\|Ga0126371_10801852	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1088	Open in IMG/M
3300022880\|Ga0247792_1015398	All Organisms → cellular organisms → Bacteria	1224	Open in IMG/M
3300023266\|Ga0247789_1001398	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	3739	Open in IMG/M
3300024254\|Ga0247661_1082457	Not Available	603	Open in IMG/M
3300025549\|Ga0210094_1078621	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium HGW-Alphaproteobacteria-5	609	Open in IMG/M
3300025903\|Ga0207680_11098360	All Organisms → cellular organisms → Bacteria	569	Open in IMG/M
3300025907\|Ga0207645_10547803	All Organisms → cellular organisms → Bacteria → Proteobacteria	785	Open in IMG/M
3300025907\|Ga0207645_10661499	All Organisms → cellular organisms → Bacteria → Proteobacteria	710	Open in IMG/M
3300025911\|Ga0207654_10893998	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodovibrionaceae → Limibacillus → Limibacillus halophilus	644	Open in IMG/M
3300025912\|Ga0207707_10661906	All Organisms → cellular organisms → Bacteria	879	Open in IMG/M
3300025915\|Ga0207693_10062305	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2922	Open in IMG/M
3300025916\|Ga0207663_10603919	All Organisms → cellular organisms → Bacteria	862	Open in IMG/M
3300025918\|Ga0207662_10876502	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella	635	Open in IMG/M
3300025919\|Ga0207657_10052740	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	3528	Open in IMG/M
3300025927\|Ga0207687_10226163	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	1476	Open in IMG/M
3300025932\|Ga0207690_11219729	All Organisms → cellular organisms → Bacteria → Proteobacteria	628	Open in IMG/M
3300025933\|Ga0207706_10142548	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2108	Open in IMG/M
3300025936\|Ga0207670_11098114	Not Available	671	Open in IMG/M
3300025937\|Ga0207669_10313340	All Organisms → cellular organisms → Bacteria	1198	Open in IMG/M
3300025938\|Ga0207704_10347733	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodovibrionaceae → Limibacillus → Limibacillus halophilus	1153	Open in IMG/M
3300025939\|Ga0207665_10027282	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	3773	Open in IMG/M
3300025942\|Ga0207689_10401495	All Organisms → cellular organisms → Bacteria → Proteobacteria	1143	Open in IMG/M
3300025972\|Ga0207668_10230958	All Organisms → cellular organisms → Bacteria	1492	Open in IMG/M
3300025972\|Ga0207668_10392970	All Organisms → cellular organisms → Bacteria	1171	Open in IMG/M
3300025972\|Ga0207668_10429003	All Organisms → cellular organisms → Bacteria	1123	Open in IMG/M
3300026089\|Ga0207648_11252463	All Organisms → cellular organisms → Bacteria	697	Open in IMG/M
3300026740\|Ga0207439_101903	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	686	Open in IMG/M
3300026745\|Ga0207576_102152	All Organisms → cellular organisms → Bacteria	670	Open in IMG/M
3300026786\|Ga0207497_106143	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	501	Open in IMG/M
3300028796\|Ga0307287_10172740	All Organisms → cellular organisms → Bacteria → Proteobacteria	821	Open in IMG/M
3300028802\|Ga0307503_10002051	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	4740	Open in IMG/M
3300030829\|Ga0308203_1037124	All Organisms → cellular organisms → Bacteria	700	Open in IMG/M
3300030844\|Ga0075377_11101508	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	611	Open in IMG/M
3300031226\|Ga0307497_10009265	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2748	Open in IMG/M
3300031538\|Ga0310888_10055885	All Organisms → cellular organisms → Bacteria	1867	Open in IMG/M
3300031544\|Ga0318534_10032383	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2860	Open in IMG/M
3300031547\|Ga0310887_10108514	All Organisms → cellular organisms → Bacteria	1389	Open in IMG/M
3300031716\|Ga0310813_10133808	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	1974	Open in IMG/M
3300031716\|Ga0310813_11097604	All Organisms → cellular organisms → Bacteria	729	Open in IMG/M
3300031879\|Ga0306919_10078829	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	2265	Open in IMG/M
3300031940\|Ga0310901_10049945	All Organisms → cellular organisms → Bacteria	1365	Open in IMG/M
3300031944\|Ga0310884_10469351	All Organisms → cellular organisms → Bacteria	734	Open in IMG/M
3300031996\|Ga0308176_11123144	All Organisms → cellular organisms → Bacteria → Proteobacteria	832	Open in IMG/M
3300032122\|Ga0310895_10001688	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	5711	Open in IMG/M
3300032205\|Ga0307472_100335661	Not Available	1233	Open in IMG/M
3300032770\|Ga0335085_10041863	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	6274	Open in IMG/M
3300033004\|Ga0335084_10043272	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	4636	Open in IMG/M
3300033004\|Ga0335084_11189224	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	762	Open in IMG/M
3300033004\|Ga0335084_11320229	Not Available	717	Open in IMG/M
3300033412\|Ga0310810_10161466	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2589	Open in IMG/M
3300033433\|Ga0326726_10001545	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	21360	Open in IMG/M
3300033433\|Ga0326726_10240769	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.	1682	Open in IMG/M
3300033513\|Ga0316628_101831411	All Organisms → cellular organisms → Bacteria	807	Open in IMG/M
3300034817\|Ga0373948_0028991	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	1105	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	66.03%
Host-Associated	Host-Associated	33.33%
Engineered	Engineered	0.64%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	63.46%
Plants	Host-Associated → Plants	33.33%
Aquatic	Environmental → Aquatic	2.56%
Modeled	Engineered → Modeled	0.64%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	61.54%
Rhizosphere	Host-Associated → Plants → Rhizosphere	19.87%
Rhizoplane	Host-Associated → Plants → Rhizoplane	13.46%
Sediment	Environmental → Aquatic → Sediment	1.28%
Peat	Environmental → Terrestrial → Peat	1.28%
Freshwater	Environmental → Aquatic → Freshwater	0.64%
Marine	Environmental → Aquatic → Marine	0.64%
Geologic	Environmental → Terrestrial → Geologic	0.64%
Simulated Communities (Sequence Read Mixture)	Engineered → Modeled → Simulated Communities (Sequence Read Mixture)	0.64%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	42.31%
Soil	Host-Associated → Plants → Rhizosphere → Soil	11.54%
Loam	Environmental → Terrestrial → Soil → Loam	10.90%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	8.97%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	8.33%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	8.33%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	4.49%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.28%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	1.28%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.64%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.64%
Mine	Environmental → Terrestrial → Geologic → Mine	0.64%
Unclassified	Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified	0.64%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	26.92%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	11.54%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	8.97%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	8.33%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	8.33%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.77%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	5.13%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	4.49%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	4.49%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	4.49%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	3.85%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	2.56%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.28%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	1.28%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.64%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.64%
Unclassified	Environmental → Terrestrial → Geologic → Mine → Unclassified	0.64%
Unclassified	Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified	0.64%

Habitat	Taxonomy	Distribution
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	8.33%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	7.69%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	5.77%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	5.13%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	5.13%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	4.49%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	4.49%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	4.49%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	3.85%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.85%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	3.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	3.85%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	3.21%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	2.56%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	2.56%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	2.56%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.92%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.92%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.92%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.28%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.28%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.28%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.28%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	1.28%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	1.28%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.28%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.28%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.28%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.28%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.28%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.64%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.64%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.64%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.64%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.64%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.64%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.64%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.64%
Weathered Mine Tailings	Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings	0.64%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.64%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.64%
Rhizosphere Soil	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil	0.64%
Simulated	Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated	0.64%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2035918004	Soil microbial communities from sample at FACE Site 2 North Carolina CO2-	Environmental	Open in IMG/M
2088090015	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
2124908007	Soil microbial communities from sample at FACE Site Metagenome WIR_ElevOz2	Environmental	Open in IMG/M
2166559005	Simulated microbial communities from Lyon, France	Engineered	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000580	Forest soil microbial communities from Amazon forest - 2010 replicate II A01	Environmental	Open in IMG/M
3300000787	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000789	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300005162	Soil and rhizosphere microbial communities from Laval, Canada - mgLAB	Environmental	Open in IMG/M
3300005164	Soil and rhizosphere microbial communities from Laval, Canada - mgLAC	Environmental	Open in IMG/M
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Host-Associated	Open in IMG/M
3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Environmental	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Environmental	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300006058	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Host-Associated	Open in IMG/M
3300006172	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014	Environmental	Open in IMG/M
3300006573	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006575	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006953	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010154	Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300010868	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300012494	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610	Host-Associated	Open in IMG/M
3300012514	Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510	Environmental	Open in IMG/M
3300012912	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012982	Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfield	Environmental	Open in IMG/M
3300012985	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG	Environmental	Open in IMG/M
3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016404	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082	Environmental	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300017944	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG	Environmental	Open in IMG/M
3300017947	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG	Environmental	Open in IMG/M
3300017970	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300017973	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG	Environmental	Open in IMG/M
3300018029	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG	Environmental	Open in IMG/M
3300018058	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG	Environmental	Open in IMG/M
3300018072	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2	Environmental	Open in IMG/M
3300021344	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300022880	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6	Environmental	Open in IMG/M
3300023266	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4	Environmental	Open in IMG/M
3300024254	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02	Environmental	Open in IMG/M
3300025549	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes)	Environmental	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026740	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A1w-12 (SPAdes)	Environmental	Open in IMG/M
3300026745	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08K1-12 (SPAdes)	Environmental	Open in IMG/M
3300026786	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A5a-11 (SPAdes)	Environmental	Open in IMG/M
3300028796	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141	Environmental	Open in IMG/M
3300028802	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S	Environmental	Open in IMG/M
3300030829	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030844	Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031226	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S	Environmental	Open in IMG/M
3300031538	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1	Environmental	Open in IMG/M
3300031544	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26	Environmental	Open in IMG/M
3300031547	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4	Environmental	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031879	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)	Environmental	Open in IMG/M
3300031940	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2	Environmental	Open in IMG/M
3300031944	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1	Environmental	Open in IMG/M
3300031996	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2	Environmental	Open in IMG/M
3300032122	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental	Open in IMG/M
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300033513	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C	Environmental	Open in IMG/M
3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.34
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.34
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F043582

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
FACENCA_6470570	2035918004	Soil	MKMPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARPTSQR
GPICI_00450640	2088090015	Soil	MPLLFYFPYIVWMGMMQIVQDEMRVPVKIKARPPIRH
FWIRElOz_09810590	2124908007	Soil	MPLLFYFPLIVWMGMMEIANDEMRVPVDVRTRPPARR
cont_0015.00000590	2166559005	Simulated	MPLLFYFPFIVWMGLMEIAQDEMRVPVRVKTRSTSQH
INPhiseqgaiiFebDRAFT_1044028511	3300000364	Soil	MPLLLYFPLIIWMGMLGAMQDEMRPATAKVRRRN*
AF_2010_repII_A01DRAFT_10000713	3300000580	Forest Soil	MPLLFYFPFIVWMGLMEIAQDEMRVPVRVKTRTATQR*
JGI11643J11755_116727881	3300000787	Soil	MPLLFYFPYIVWMGMMQIVHDEMRVPVKIKARPPVRH*
JGI1027J11758_130096152	3300000789	Soil	MPLLFYFPYIVWMGMMQIVQDEMRVPVKIKARPPIRH*
Ga0066814_100752032	3300005162	Soil	LGFRTDARYKKMPLLFYFPFIVWMGLMEVAQDEMRIPIKVKARPPSQR*
Ga0066815_101181382	3300005164	Soil	LEFRTDARYKKMPLLFYFPFIVWMGMMEIAQDEMRAPVRVKAQKPSQR*
Ga0070666_101045263	3300005335	Switchgrass Rhizosphere	LGFRTDARYKKMPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPPSQR*
Ga0070661_1001499373	3300005344	Corn Rhizosphere	LGFRTDARYKKMPLLFYFPFIVWMGLMEVAQDEMRIPIKVKA*
Ga0070713_1002903923	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	AQKMPLLFYFPLIIWMGMMEIAHDEMRVPVNDRTRTPARR*
Ga0070705_1003559293	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	MKMPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARPTSQR*
Ga0070741_1000869623	3300005529	Surface Soil	MPLLFYFPLIVWMGMAEIMRDEMKVPDTADTRRRTQKQ*
Ga0070672_1001988393	3300005543	Miscanthus Rhizosphere	MPLLFYFPFIVWMGLMEVAQDEMRIPIKVKARPPSQR*
Ga0070695_1012226922	3300005545	Corn, Switchgrass And Miscanthus Rhizosphere	VTRDTKMPLLFYFPLIVWMGMLEAMQDEMRVPVTAKPRR*
Ga0070665_1015996792	3300005548	Switchgrass Rhizosphere	MPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPPSQR*
Ga0068855_1008088701	3300005563	Corn Rhizosphere	KKMPLLFYFPLIIWMGVLEAMQDEMRVAATAKARR*
Ga0070664_1001402482	3300005564	Corn Rhizosphere	MPLLFYFPLIVWMGMLGALQDEMRVPATVKARREV*
Ga0070664_1003959483	3300005564	Corn Rhizosphere	MPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPTAQR*
Ga0070664_1009768211	3300005564	Corn Rhizosphere	KMPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPPSQR*
Ga0068857_1011795482	3300005577	Corn Rhizosphere	LGFRTDARYKKMPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPTAQR*
Ga0068856_1000381866	3300005614	Corn Rhizosphere	MPLLFYFPLIIWMGMMEIAHDEMRVPVNDRTRTPARR*
Ga0068852_1019154831	3300005616	Corn Rhizosphere	QKMPLLFYFPLIVWMGMLEAMQDEMRVPATAKPRR*
Ga0066905_1000399402	3300005713	Tropical Forest Soil	MPLLFYFPYIVWMGMMQLVQDEMRVPVKIKARPPVRN*
Ga0066905_1000822044	3300005713	Tropical Forest Soil	MPLLFYFPYIVWMGMMQLVQDEMRVPVKIKARPPIRH*
Ga0066905_1002711372	3300005713	Tropical Forest Soil	MPLLFYFPYIIWMGMMQIAQDEMRVPVKIKPRPPVRN*
Ga0066903_1000201902	3300005764	Tropical Forest Soil	MPLLFYFPFIIWTGMLQLAQDEMCVPAKVKAPVQR*
Ga0066903_1000716536	3300005764	Tropical Forest Soil	MPLLFYFPFIVWMGMLEIAQDEMRVPVKVRTPVPR*
Ga0066903_1015379042	3300005764	Tropical Forest Soil	EMPLLFYFPFIIWMGMLEIAHDEMRVPIKVKAPVR*
Ga0066903_1017938042	3300005764	Tropical Forest Soil	MPLLLYFPLIIWMGMLEAMQDEMRPATAKVRRRN*
Ga0068860_1013696892	3300005843	Switchgrass Rhizosphere	MPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARPTSQR*
Ga0068860_1017483172	3300005843	Switchgrass Rhizosphere	LLFYFPLIIWMGMMEIAHDEMRVPVNDRTRTPARR*
Ga0081455_1000980611	3300005937	Tabebuia Heterophylla Rhizosphere	MPLLFYFPYIIWMGMMQIVQDEMRVPVKIKARPPVRN*
Ga0081455_100563194	3300005937	Tabebuia Heterophylla Rhizosphere	MPLLFYFPYIVWMGMMQFVQDEMRVPVKIKARPPVRN*
Ga0075432_104611721	3300006058	Populus Rhizosphere	MPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARTPSQR*
Ga0075018_106618612	3300006172	Watersheds	MPLLFYFPLIIWMGMMEIAHDEMRGPVNVRTRTPARR*
Ga0074055_118257071	3300006573	Soil	QKMPLLFYFPLIIWMGMLEAMQDEMRVPATAKPRR*
Ga0074053_111698612	3300006575	Soil	MPLLFYFPFIVWMGMMEIAQDEMRAPVRVKAQKPSQR*
Ga0074053_119297962	3300006575	Soil	QKMPLLFYFPLIVWMGMLEAIQDEMRVPATAKARR*
Ga0074053_119591991	3300006575	Soil	KMPLLFYFPLIIWMGMMEIAHDEMRVPVNVRTRTPARR*
Ga0075433_110165972	3300006852	Populus Rhizosphere	LGFRTDARYKKMPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARTPSQR*
Ga0074063_128768332	3300006953	Soil	KGEKQKMPLLFYFPLIIWMGMLEAMQDEMRVPATAKPRR*
Ga0079219_101143042	3300006954	Agricultural Soil	MPLLLYFPLIVWMGLMGVAQDQMRVPVKVKATPSLPR*
Ga0079219_117889162	3300006954	Agricultural Soil	MPLLFYFPLIIWMGMLEAVQDEMRVPATVRVRRPDRRQ*
Ga0105240_115310192	3300009093	Corn Rhizosphere	MKMPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARTPSQR*
Ga0111539_106137751	3300009094	Populus Rhizosphere	TGTRDKKMPLFLYFPLIIWMGMLEAMQDEMRASAPVKLRR*
Ga0075418_129603091	3300009100	Populus Rhizosphere	MPLLFYFPYIVWMGMMQIVQDEMRVPVKIKARPPVRN*
Ga0105247_100683615	3300009101	Switchgrass Rhizosphere	MPLLFYFPLIIWMGMMEIAQDEMRAPVNVRTPTPARR*
Ga0114129_101261491	3300009147	Populus Rhizosphere	DNMPLLFYFPYIVWMGMMQLVQDEMRIPVKIKARPPARN*
Ga0111538_106735832	3300009156	Populus Rhizosphere	ARYMKMPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARPTSQR*
Ga0105249_131116722	3300009553	Switchgrass Rhizosphere	MPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPTSQR*
Ga0126374_100029802	3300009792	Tropical Forest Soil	MPLLFYFPFIVWMGLMEIAQDEMRVPVRVKTRTPTQR*
Ga0126380_100100553	3300010043	Tropical Forest Soil	MPLLFYFPFIVWMGLIEIAQDEMRVPVRVKTRTPTQR*
Ga0126380_122653462	3300010043	Tropical Forest Soil	MPLLFYFPFIVWMGLMEVAQNEMRIPIKVKARTPSQR*
Ga0126384_119357521	3300010046	Tropical Forest Soil	MPLLFYFPYIIWMGMIELAQEEMRVAIKVKARPTARG*
Ga0126382_100233483	3300010047	Tropical Forest Soil	MPLLFYFPYIVWMGMMQFVQDEMRVPAKVKMRPPVRN*
Ga0127503_112939791	3300010154	Soil	QKMPLLFYFPLIIWMGMMEIAHDEMRVPVNARTRTPARR*
Ga0126370_107383222	3300010358	Tropical Forest Soil	MPLLFYFPFIVWMGLMEVAQDEMRVPVRVKTRAPTQR*
Ga0126377_128893132	3300010362	Tropical Forest Soil	MPLLFYFPFIVWMGMLEIAREEMRVPVKVKTPVRR*
Ga0126379_124421102	3300010366	Tropical Forest Soil	MPLLFYFPFIVWMGMLEIAQDEMRVPAKVRTPVPR*
Ga0134125_100590412	3300010371	Terrestrial Soil	MPLLLYFPLIIWMGMLEALRDETRVPATVKARRG*
Ga0134125_103837902	3300010371	Terrestrial Soil	MKMPLLFYFPFIVWMGLMEVAQDEMRIPIKVKARPPSQR*
Ga0134128_102675302	3300010373	Terrestrial Soil	MPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARPPSQR*
Ga0134128_114396871	3300010373	Terrestrial Soil	LLLYFPLIVWMGLMGVAQDQMRVPVKVKATPSLPR*
Ga0134126_102026572	3300010396	Terrestrial Soil	MPLLFHFPFIVWMGLMEVAQDEMRIPVKVKARPPSQR*
Ga0126383_100307147	3300010398	Tropical Forest Soil	MPLLFYFPYIVWMGMMQFVQDEMRVPAKVKARPPIRN*
Ga0134127_111187123	3300010399	Terrestrial Soil	MKMPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPTSQR*
Ga0134121_102716273	3300010401	Terrestrial Soil	AQKMPLLFYFPLIIWMGMMEIAQDEMRAPVNVRTPTPARR*
Ga0124844_10633793	3300010868	Tropical Forest Soil	MPLLFYFPFIVWMGLMEIAQDEMRVPVMVKTRTPTQR*
Ga0105246_108188491	3300011119	Miscanthus Rhizosphere	KMPLLFYFPLIVWMGMLGALQDEMRVPATVKARREV*
Ga0157341_10080952	3300012494	Arabidopsis Rhizosphere	MPLLFYFPFIVWLGLMEVAQDEMRIPVKVKARPTAQR*
Ga0157330_10182553	3300012514	Soil	MPLLFYFPFIVWMGLMEVAQDEMRIPVNVKARPTAQR*
Ga0157306_100240591	3300012912	Soil	KMPLLFYFPLIVWMGMLEAMQDEMRVPVTAKPRR*
Ga0164299_100037186	3300012958	Soil	MPLLFYFPFIVWMFLLAVVQDEMRIPVKVKARPTSQR*
Ga0126369_137104611	3300012971	Tropical Forest Soil	MPLLFYFPFIVWMGMLEIAQDEMRVPVKVRTPVPR
Ga0168317_10405482	3300012982	Weathered Mine Tailings	MPMLLYFPLIIWMGMFGVVQDEMRVPVKAKASQRR*
Ga0164308_100957602	3300012985	Soil	MKMPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPPSQR*
Ga0157369_123307641	3300013105	Corn Rhizosphere	KMPLLFYFPLIVWMGMLEAMQDEMRVPATAKPRR*
Ga0163162_102197984	3300013306	Switchgrass Rhizosphere	MKMPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARPPSQR*
Ga0132258_104620513	3300015371	Arabidopsis Rhizosphere	MPLLFYFPFIVWMGMLEIAHDEMRVPLKVKAPVGR*
Ga0132258_115706321	3300015371	Arabidopsis Rhizosphere	LALGFRTDARYKKMPLLFYFPFIVWMGLMEVAQDEMRIPIKVKARPPSQR*
Ga0132258_129435062	3300015371	Arabidopsis Rhizosphere	MPLLFYFPLIIWMGMMEIAHDEMRVPVNVRTRTLARP*
Ga0132258_137365142	3300015371	Arabidopsis Rhizosphere	MPLLFYFPLIVWMGMLEIAHDEMRVPLKTPVRRLDRELT*
Ga0132255_1040831582	3300015374	Arabidopsis Rhizosphere	FRTDARYKKMPLLFYFPFIVWMGLMEVAQDEMRIPIKVKARPPSQR*
Ga0132255_1042352981	3300015374	Arabidopsis Rhizosphere	MPLLFYFPFIVWMGLMEIAQDEMRVPVRVKTRTPTHG*
Ga0132255_1044875292	3300015374	Arabidopsis Rhizosphere	MPLLFYFPLIVWMGLMEVAQDEMRIPVKVKARPTAQR*
Ga0182037_1000002026	3300016404	Soil	MPLLLYFPFIVWMGLMEVAQDEMRVPVRVKTRTPTQR
Ga0163161_102306451	3300017792	Switchgrass Rhizosphere	DARYMKMPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARPTAQR
Ga0187786_101292212	3300017944	Tropical Peatland	MPLLFYFPFIVWMGLMEVAQDEMRIPVRVKAQTPPHR
Ga0187785_100005575	3300017947	Tropical Peatland	MPLLLYFPLIIWIGMVEIVQGEMLTRAKSKVPTPPRRR
Ga0187785_100110553	3300017947	Tropical Peatland	MPLLFYFPLIVWMGLMEVAQDEMRIPVRVKAQTPPHR
Ga0187785_100166924	3300017947	Tropical Peatland	MPLLFYFPFIVWMGLMEVAQDEMRVPVRVKTRAPTQR
Ga0187783_110070601	3300017970	Tropical Peatland	MPLLFYFPFIVWMGMLEIAHDEMRVPLKVKAPVQR
Ga0187780_101657343	3300017973	Tropical Peatland	KREAYAMPLLLYFPLIVWMGMMEIARQEMHVPVRVKAQSRQQ
Ga0187787_100003435	3300018029	Tropical Peatland	MPLLLYFPLIIWMGMMEIVQGEMRVPVRTRVPTQPQR
Ga0187766_112072781	3300018058	Tropical Peatland	KMPLLFYFPFIVWMGLMEVAQDEMRIPVRVKAQTPPHR
Ga0184635_1000004722	3300018072	Groundwater Sediment	MPLLFYFPYIVWMGMMEYARDEGRVPVKIKTQPPPR
Ga0193719_100801123	3300021344	Soil	PLLFYFPLIIWMGMMEIAHDEMRGPVNVRTRTPARR
Ga0126371_100291182	3300021560	Tropical Forest Soil	MPLLFYFPFIIWMGMLEIAHDEMRVPIKVKAPVIRR
Ga0126371_104090432	3300021560	Tropical Forest Soil	MPLLFYFPFIVWMGLMEIAQDEMRVPVRVKTRTATQR
Ga0126371_108018521	3300021560	Tropical Forest Soil	MPLLFYFPYIIWMGMMQIVQDEMRVPVKIKARPPVRN
Ga0247792_10153982	3300022880	Soil	EKKMPLLFYFPLIIWMGVLEAMQDEMRVAATAKARR
Ga0247789_10013985	3300023266	Soil	TKMPLLFYFPLIVWMGMLEAMQDEMRVPVTAKPRR
Ga0247661_10824571	3300024254	Soil	MPLLFHFPFIVWMGLMEVAQDEMRIPVKVKARPTAQR
Ga0210094_10786212	3300025549	Natural And Restored Wetlands	MPLLFYFPLIIWMGMVEIMHDELRVPAKAKVGTPARL
Ga0207680_110983602	3300025903	Switchgrass Rhizosphere	KKMPLLFYFPLIIWMGVLEAIQDEMRVAATAKARR
Ga0207645_105478032	3300025907	Miscanthus Rhizosphere	MKMPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPPSQR
Ga0207645_106614991	3300025907	Miscanthus Rhizosphere	TVTRDAKMPLLFYFPLIVWMGMLEAMQDEMRVPVTAKPRR
Ga0207654_108939982	3300025911	Corn Rhizosphere	GFRTDARYKKMPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPPSQR
Ga0207707_106619062	3300025912	Corn Rhizosphere	EMPLLFYFPLIIWMGMMEIAQDEMRAPVNVRTPTPARR
Ga0207693_100623052	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	MPLLFYFPLIIWMGMMEIAHDEMRGPVNVRTRAPARR
Ga0207663_106039192	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	MPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARTPSQR
Ga0207662_108765022	3300025918	Switchgrass Rhizosphere	MPLLFYFPLIIWMGMMEIAHDELRVPVNVRTRTPARR
Ga0207657_100527401	3300025919	Corn Rhizosphere	DARYKKMPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARTPSQR
Ga0207687_102261633	3300025927	Miscanthus Rhizosphere	EAQKMPLLFYFPLIIWMGMMEIAHDEMRVPVNDRTRTPARR
Ga0207690_112197292	3300025932	Corn Rhizosphere	MPLLFYFPLIVWMGMLGALQDEMRVPATVKARREV
Ga0207706_101425482	3300025933	Corn Rhizosphere	MPLLFYFPLIIWMGMMEIAQDEMRAPVNVRTPTPARR
Ga0207670_110981141	3300025936	Switchgrass Rhizosphere	MPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPPSQ
Ga0207669_103133402	3300025937	Miscanthus Rhizosphere	KKMPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPPSQR
Ga0207704_103477332	3300025938	Miscanthus Rhizosphere	MPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARPPSQR
Ga0207665_100272824	3300025939	Corn, Switchgrass And Miscanthus Rhizosphere	MPLLFYFPLIIWMGMMEIAHDEMRVPVNVRTRTPARR
Ga0207689_104014952	3300025942	Miscanthus Rhizosphere	MKMPLLFYFPFIVWMGLMEVVQDEMRIPVKVKARTPSQR
Ga0207668_102309582	3300025972	Switchgrass Rhizosphere	MPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPTSQR
Ga0207668_103929701	3300025972	Switchgrass Rhizosphere	TGREAQKMPLLFYFPLIIWMGMMEIAHDEMRVPVNGRTRTTARR
Ga0207668_104290032	3300025972	Switchgrass Rhizosphere	ARKKMPLLFYFPLIIWMGVLEAMQDEMRVAATAKARR
Ga0207648_112524631	3300026089	Miscanthus Rhizosphere	MPLLFYFPFIVWMGMMEIAQDEMRAPVRVKAQTPSQR
Ga0207439_1019032	3300026740	Soil	PQREKKMPLLFYFPLIIWMGVLEAMQDEMRVAATAKARR
Ga0207576_1021521	3300026745	Soil	QREKKMPLLFYFPLIIWMGVLEAMQDEMRVAATAKARR
Ga0207497_1061432	3300026786	Soil	IQKMPLLFYFPLIVWMGMLEAMQDEMRVPATAKPRR
Ga0307287_101727402	3300028796	Soil	MPLLFYFPYIIWMGMMEIVQDEMRAPVKIKAQTPARR
Ga0307503_100020511	3300028802	Soil	MPLLLYFPLIIWMGMLEVARSEIRSPAEAKVRVPTRR
Ga0308203_10371241	3300030829	Soil	KMPLLFYFPFIVWMGLMEIAQDEMRVPVRVKTRSTSQH
Ga0075377_111015082	3300030844	Soil	MPLLFYFPLIIWMGMMEIAHDEMRVPVNVRTPTPARR
Ga0307497_100092653	3300031226	Soil	MPLLFYFPFIVWMGLIEVVQDEMRIPVKVKARPTSQR
Ga0310888_100558853	3300031538	Soil	MPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPTAQR
Ga0318534_100323833	3300031544	Soil	MPLLFYFPFIVWMGLMEVAQDEMRVPVRVKTRTPTQR
Ga0310887_101085141	3300031547	Soil	RTDARYMKMPLLFYFPFIVWMGLIEVVQDEMRIPVKVKARPTSQR
Ga0310813_101338083	3300031716	Soil	EAQKMPLLFYFPLIIWMGMLEVAHDEMRVPVNVRTRTPARR
Ga0310813_110976042	3300031716	Soil	RYKKMPLLFYFPFIVWMGLMEVAQDEMRIPIKVKARPPSQR
Ga0306919_100788291	3300031879	Soil	ARYKKMPLLFYFPFIVWMGLMEVAQDEMRVPVRVKTRTPTQR
Ga0310901_100499452	3300031940	Soil	MKMPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPTSQR
Ga0310884_104693512	3300031944	Soil	TVTRDTKMPLLFYFPLIVWMGMLEAMQDEMRVPVTAKPRR
Ga0308176_111231442	3300031996	Soil	MPLLLYFPLIVWVSMMEIVQQEMHIPVRVKAQVRQR
Ga0310895_100016881	3300032122	Soil	ITRDTKMPLLFYFPLIVWMGMLEAMQDEMRVPVTAKPRR
Ga0307472_1003356613	3300032205	Hardwood Forest Soil	MPLLFYFPFIVWMGLMEVAQDEMRIPVKVKARPSSQR
Ga0335085_100418637	3300032770	Soil	MPLLLYFPLIIWMGMVEIVQGEMRVPAKTRVPTQPRR
Ga0335084_100432724	3300033004	Soil	MPLLFYFPLIIWMGMLEIVQDEMRVPARVRVPPQR
Ga0335084_111892242	3300033004	Soil	MPLLLYFPLIIWMGMLEAMQDEMRVPVTAKASAKSELS
Ga0335084_113202292	3300033004	Soil	MPLLLYFPLIVWMGMMEFAHQEMRVPVKVKAQSPQR
Ga0310810_101614663	3300033412	Soil	MPLLFYFPLIIWMGMLEVAHDEMRVPVNVRTRTPARR
Ga0326726_100015452	3300033433	Peat Soil	MPLLFYLPLIIWMGMVEIVQEEMRVPARVRVPPQRRRDA
Ga0326726_102407693	3300033433	Peat Soil	MPLLFYFPLIIWMGMVEIMHDELRVFAKAKVGTPARL
Ga0316628_1018314112	3300033513	Soil	MPLLFYFPLIVWMGMMEIMQDEMRVPAKIKARRSEQR
Ga0373948_0028991_1000_1104	3300034817	Rhizosphere Soil	MPLLFYFPLIIWMGMMEIAHDEMRVPVNVRTRTPA

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign