| Basic Information | |
|---|---|
| Family ID | F043032 |
| Family Type | Metagenome |
| Number of Sequences | 157 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MKIFFFDIETVPTDKSLQENGLLEEQIKLDEAELIKKLSLSAATAKII |
| Number of Associated Samples | 146 |
| Number of Associated Scaffolds | 157 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 51.59 % |
| % of genes near scaffold ends (potentially truncated) | 98.09 % |
| % of genes from short scaffolds (< 2000 bps) | 91.72 % |
| Associated GOLD sequencing projects | 138 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.363 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil (10.828 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.217 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (36.306 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.32% β-sheet: 0.00% Coil/Unstructured: 73.68% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 157 Family Scaffolds |
|---|---|---|
| PF12705 | PDDEXK_1 | 71.34 |
| PF13361 | UvrD_C | 20.38 |
| PF03104 | DNA_pol_B_exo1 | 1.27 |
| PF00580 | UvrD-helicase | 0.64 |
| PF01019 | G_glu_transpept | 0.64 |
| COG ID | Name | Functional Category | % Frequency in 157 Family Scaffolds |
|---|---|---|---|
| COG0417 | DNA polymerase B elongation subunit | Replication, recombination and repair [L] | 1.27 |
| COG0210 | Superfamily I DNA or RNA helicase | Replication, recombination and repair [L] | 0.64 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.64 |
| COG1074 | 3’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V) | Replication, recombination and repair [L] | 0.64 |
| COG3973 | DNA helicase IV | Replication, recombination and repair [L] | 0.64 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.36 % |
| Unclassified | root | N/A | 0.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918013|NODE_2454_length_1260_cov_9.802381 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae | 1292 | Open in IMG/M |
| 2228664022|INPgaii200_c1051295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101764513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1379 | Open in IMG/M |
| 3300000550|F24TB_13615636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 684 | Open in IMG/M |
| 3300000891|JGI10214J12806_10138351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 957 | Open in IMG/M |
| 3300000955|JGI1027J12803_103892927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300002104|C687J26621_10192892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 608 | Open in IMG/M |
| 3300002121|C687J26615_10198836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 510 | Open in IMG/M |
| 3300002128|JGI24036J26619_10059153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 753 | Open in IMG/M |
| 3300002899|JGIcombinedJ43975_10035460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 820 | Open in IMG/M |
| 3300003994|Ga0055435_10030041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1216 | Open in IMG/M |
| 3300003998|Ga0055472_10281651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300004156|Ga0062589_102260525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300004463|Ga0063356_104770694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 583 | Open in IMG/M |
| 3300004463|Ga0063356_105573722 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300004479|Ga0062595_101438215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 631 | Open in IMG/M |
| 3300004480|Ga0062592_101601958 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300005093|Ga0062594_100719544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 905 | Open in IMG/M |
| 3300005183|Ga0068993_10014156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1885 | Open in IMG/M |
| 3300005218|Ga0068996_10217863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300005332|Ga0066388_103240175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 832 | Open in IMG/M |
| 3300005332|Ga0066388_107370442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300005335|Ga0070666_10084332 | All Organisms → cellular organisms → Bacteria | 2174 | Open in IMG/M |
| 3300005340|Ga0070689_100944823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 765 | Open in IMG/M |
| 3300005345|Ga0070692_10386814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 879 | Open in IMG/M |
| 3300005406|Ga0070703_10220238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 755 | Open in IMG/M |
| 3300005440|Ga0070705_100859905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 726 | Open in IMG/M |
| 3300005441|Ga0070700_101066036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 668 | Open in IMG/M |
| 3300005467|Ga0070706_101907021 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300005536|Ga0070697_100528665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1033 | Open in IMG/M |
| 3300005549|Ga0070704_100185115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1669 | Open in IMG/M |
| 3300005563|Ga0068855_101336641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 740 | Open in IMG/M |
| 3300005616|Ga0068852_102844780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300005843|Ga0068860_101095461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 816 | Open in IMG/M |
| 3300005844|Ga0068862_101264651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 738 | Open in IMG/M |
| 3300005890|Ga0075285_1022444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 759 | Open in IMG/M |
| 3300006049|Ga0075417_10051019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1786 | Open in IMG/M |
| 3300006173|Ga0070716_100956559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 674 | Open in IMG/M |
| 3300006358|Ga0068871_101753821 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300006844|Ga0075428_100285620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1775 | Open in IMG/M |
| 3300006844|Ga0075428_102387101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300006845|Ga0075421_100753099 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300006847|Ga0075431_101462657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 642 | Open in IMG/M |
| 3300006853|Ga0075420_101409083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300006865|Ga0073934_10504159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 723 | Open in IMG/M |
| 3300006871|Ga0075434_101071186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 820 | Open in IMG/M |
| 3300006903|Ga0075426_10541508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 867 | Open in IMG/M |
| 3300006904|Ga0075424_100678341 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300006904|Ga0075424_100687417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1093 | Open in IMG/M |
| 3300006969|Ga0075419_10903078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 637 | Open in IMG/M |
| 3300007004|Ga0079218_11281625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 769 | Open in IMG/M |
| 3300009053|Ga0105095_10396103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 762 | Open in IMG/M |
| 3300009088|Ga0099830_10005918 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 7086 | Open in IMG/M |
| 3300009100|Ga0075418_10850769 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300009137|Ga0066709_102886411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 635 | Open in IMG/M |
| 3300009153|Ga0105094_10824243 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300009157|Ga0105092_10208406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1093 | Open in IMG/M |
| 3300009157|Ga0105092_10233990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1030 | Open in IMG/M |
| 3300009157|Ga0105092_10276560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 945 | Open in IMG/M |
| 3300009545|Ga0105237_11832263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 614 | Open in IMG/M |
| 3300009792|Ga0126374_11376204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 573 | Open in IMG/M |
| 3300009816|Ga0105076_1003699 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae | 2366 | Open in IMG/M |
| 3300010335|Ga0134063_10006505 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 4404 | Open in IMG/M |
| 3300010366|Ga0126379_12294214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300010373|Ga0134128_11821808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 670 | Open in IMG/M |
| 3300010391|Ga0136847_11230662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1761 | Open in IMG/M |
| 3300010399|Ga0134127_10941414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 921 | Open in IMG/M |
| 3300010399|Ga0134127_12301569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 618 | Open in IMG/M |
| 3300011417|Ga0137326_1142505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300011420|Ga0137314_1187503 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300011423|Ga0137436_1132544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 666 | Open in IMG/M |
| 3300011427|Ga0137448_1203689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300011438|Ga0137451_1150525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 728 | Open in IMG/M |
| 3300011440|Ga0137433_1255603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 572 | Open in IMG/M |
| 3300011442|Ga0137437_1219738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 660 | Open in IMG/M |
| 3300011443|Ga0137457_1341334 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300012034|Ga0137453_1004356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1801 | Open in IMG/M |
| 3300012160|Ga0137349_1019527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1060 | Open in IMG/M |
| 3300012166|Ga0137350_1074082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 680 | Open in IMG/M |
| 3300012179|Ga0137334_1073040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 752 | Open in IMG/M |
| 3300012189|Ga0137388_10311539 | All Organisms → cellular organisms → Bacteria | 1445 | Open in IMG/M |
| 3300012200|Ga0137382_10517937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 848 | Open in IMG/M |
| 3300012207|Ga0137381_11217672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 646 | Open in IMG/M |
| 3300012208|Ga0137376_10038425 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 3851 | Open in IMG/M |
| 3300012672|Ga0137317_1027042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 564 | Open in IMG/M |
| 3300012911|Ga0157301_10366598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300012916|Ga0157310_10238185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 682 | Open in IMG/M |
| 3300012930|Ga0137407_11335557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 681 | Open in IMG/M |
| 3300012930|Ga0137407_11413154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 661 | Open in IMG/M |
| 3300012948|Ga0126375_11182275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 635 | Open in IMG/M |
| 3300012985|Ga0164308_10061227 | All Organisms → cellular organisms → Bacteria | 2487 | Open in IMG/M |
| 3300014265|Ga0075314_1104898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 615 | Open in IMG/M |
| 3300014296|Ga0075344_1039077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 817 | Open in IMG/M |
| 3300014305|Ga0075349_1140695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300014315|Ga0075350_1131246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 618 | Open in IMG/M |
| 3300014872|Ga0180087_1099776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300014873|Ga0180066_1080107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 668 | Open in IMG/M |
| 3300014876|Ga0180064_1054919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 803 | Open in IMG/M |
| 3300014885|Ga0180063_1216416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 615 | Open in IMG/M |
| 3300015200|Ga0173480_11087331 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300015241|Ga0137418_10423040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1082 | Open in IMG/M |
| 3300015372|Ga0132256_100745377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1096 | Open in IMG/M |
| 3300015373|Ga0132257_100432337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1605 | Open in IMG/M |
| 3300015374|Ga0132255_102007029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 880 | Open in IMG/M |
| 3300015374|Ga0132255_102579939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 776 | Open in IMG/M |
| 3300017997|Ga0184610_1097363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 929 | Open in IMG/M |
| 3300018052|Ga0184638_1043858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1626 | Open in IMG/M |
| 3300018053|Ga0184626_10022882 | All Organisms → cellular organisms → Bacteria | 2547 | Open in IMG/M |
| 3300018073|Ga0184624_10363290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 648 | Open in IMG/M |
| 3300018076|Ga0184609_10318465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 727 | Open in IMG/M |
| 3300018077|Ga0184633_10513644 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300018078|Ga0184612_10162474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1167 | Open in IMG/M |
| 3300018079|Ga0184627_10171795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1148 | Open in IMG/M |
| 3300018422|Ga0190265_10485444 | All Organisms → cellular organisms → Bacteria | 1346 | Open in IMG/M |
| 3300019377|Ga0190264_10354526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 923 | Open in IMG/M |
| 3300019878|Ga0193715_1024778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1302 | Open in IMG/M |
| 3300019885|Ga0193747_1067945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 880 | Open in IMG/M |
| 3300020001|Ga0193731_1163559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 538 | Open in IMG/M |
| 3300021063|Ga0206227_1117598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 532 | Open in IMG/M |
| 3300022898|Ga0247745_1061020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 609 | Open in IMG/M |
| 3300024055|Ga0247794_10219193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 619 | Open in IMG/M |
| 3300025165|Ga0209108_10180829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1099 | Open in IMG/M |
| 3300025313|Ga0209431_11220845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300025322|Ga0209641_10406513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 981 | Open in IMG/M |
| 3300025326|Ga0209342_10736746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 784 | Open in IMG/M |
| 3300025580|Ga0210138_1051882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 945 | Open in IMG/M |
| 3300025903|Ga0207680_10078539 | All Organisms → cellular organisms → Bacteria | 2067 | Open in IMG/M |
| 3300025915|Ga0207693_10095945 | Not Available | 2325 | Open in IMG/M |
| 3300025917|Ga0207660_10181626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1634 | Open in IMG/M |
| 3300025918|Ga0207662_11074487 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300025935|Ga0207709_10401130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1048 | Open in IMG/M |
| 3300025938|Ga0207704_10217640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1410 | Open in IMG/M |
| 3300026025|Ga0208778_1005856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1128 | Open in IMG/M |
| 3300026118|Ga0207675_100256505 | All Organisms → cellular organisms → Bacteria | 1694 | Open in IMG/M |
| 3300027364|Ga0209967_1031936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 789 | Open in IMG/M |
| 3300027722|Ga0209819_10000609 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10609 | Open in IMG/M |
| 3300027722|Ga0209819_10063702 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300027748|Ga0209689_1259219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 703 | Open in IMG/M |
| 3300027873|Ga0209814_10118619 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300027907|Ga0207428_10195126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1525 | Open in IMG/M |
| 3300027909|Ga0209382_10679929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1110 | Open in IMG/M |
| 3300028380|Ga0268265_12217404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300030606|Ga0299906_10095886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2360 | Open in IMG/M |
| 3300030606|Ga0299906_10761358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 723 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10074399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 898 | Open in IMG/M |
| 3300031852|Ga0307410_10100237 | All Organisms → cellular organisms → Bacteria | 2075 | Open in IMG/M |
| 3300031946|Ga0310910_10572249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 896 | Open in IMG/M |
| 3300031954|Ga0306926_11270808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 861 | Open in IMG/M |
| 3300032002|Ga0307416_102943186 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300032013|Ga0310906_10530836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 801 | Open in IMG/M |
| 3300032157|Ga0315912_10827332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 737 | Open in IMG/M |
| 3300032174|Ga0307470_10138592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1468 | Open in IMG/M |
| 3300032829|Ga0335070_10193592 | All Organisms → cellular organisms → Bacteria | 2029 | Open in IMG/M |
| 3300033004|Ga0335084_10696991 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300033811|Ga0364924_170379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300034147|Ga0364925_0333844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 570 | Open in IMG/M |
| 3300034819|Ga0373958_0200079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 523 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 10.83% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.64% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.73% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.10% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.10% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.82% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.55% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 2.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.55% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.91% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.27% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.27% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.27% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.27% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.27% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.27% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.27% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.64% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.64% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.64% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.64% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.64% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.64% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.64% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.64% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.64% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.64% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.64% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.64% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.64% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.64% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.64% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918013 | Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies) | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002104 | Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2 | Environmental | Open in IMG/M |
| 3300002121 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 | Environmental | Open in IMG/M |
| 3300002128 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Environmental | Open in IMG/M |
| 3300002899 | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) | Environmental | Open in IMG/M |
| 3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300003998 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300005218 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005890 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011417 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2 | Environmental | Open in IMG/M |
| 3300011420 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2 | Environmental | Open in IMG/M |
| 3300011423 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2 | Environmental | Open in IMG/M |
| 3300011427 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2 | Environmental | Open in IMG/M |
| 3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
| 3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
| 3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300012034 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2 | Environmental | Open in IMG/M |
| 3300012160 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT630_2 | Environmental | Open in IMG/M |
| 3300012166 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT660_2 | Environmental | Open in IMG/M |
| 3300012179 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012672 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT266_2 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300014265 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 | Environmental | Open in IMG/M |
| 3300014296 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300014305 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014315 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014872 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10D | Environmental | Open in IMG/M |
| 3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
| 3300014876 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200_16_10D | Environmental | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
| 3300021063 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4 | Environmental | Open in IMG/M |
| 3300022898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025580 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026025 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Iowa-Corn-GraphCirc_00148950 | 2140918013 | Soil | MKIFYFDIETVPTEKALEENGLLDAQIKLDEPELIXXXXXX |
| INPgaii200_10512951 | 2228664022 | Soil | MKILFFDIETVPTQQSLQDNNLLEAQMVLNEAEIIKKL |
| INPhiseqgaiiFebDRAFT_1017645132 | 3300000364 | Soil | MKILFFDIETVPTEQSLQDNGLLESQIRLDEAEIIKKLSLAAATSRILCLAYAMEPPLDSFVE |
| F24TB_136156361 | 3300000550 | Soil | MKICFLDIETVPTDRSLEENGLLEPQIQLDESEIIKKLSLSAATAKIICICYAI |
| JGI10214J12806_101383512 | 3300000891 | Soil | MKILFFDIETVPTEPSLQENGLLEEQIRLDEAEVLKKLSLSAATAKIICLCYAIEPSVSG |
| JGI1027J12803_1038929271 | 3300000955 | Soil | MKILFFDIETVPTEQSLQDNGLLESQIRLDEAEIIKKLSLAAATSRILCLAYA |
| C687J26621_101928922 | 3300002104 | Groundwater | MKIFFFDIETVPTEQSLQDNGLLESQIKLDEAELLKKLSLSAATARILCLA |
| C687J26615_101988361 | 3300002121 | Soil | MKIFFFDIETVPTEQSLQDNGLLESQIKLDEAELLKKLSLSAATARIL |
| JGI24036J26619_100591531 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVIFLDIETVPTDQALLEHGLLEPQLQLNEGDLIKK |
| JGIcombinedJ43975_100354601 | 3300002899 | Soil | MKVIFLDIETVPTDQALLEHGLLEPQLQLNEGDLLKKLSLSATTAKILCLCYATEPAAQPAIEVLDGDE |
| Ga0055435_100300412 | 3300003994 | Natural And Restored Wetlands | MKIMYLDIETVPTDKALQENGLLESQIQLDEAELIKKLSLSAATAK |
| Ga0055472_102816511 | 3300003998 | Natural And Restored Wetlands | MNVFFFDIETVPTDRALKDNGLLDPQLKLEEPELIKKLSLSGATA |
| Ga0062589_1022605251 | 3300004156 | Soil | MKVIFLDIETVPTDQALLEHGLLEPQLQLNEGDLIKKLSLSATTAKILCLC |
| Ga0063356_1047706941 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKIFYFDIETVPTDKSLQDNGLLEPQIKLDEAEIIKKLSLSAITAKIICLCYAT |
| Ga0063356_1055737222 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKTLFLDIETVPTDRALAESGILEPQIQLEENEIIKKLSLSAATAKILCIGYAIEPPVGAEVQVL |
| Ga0062595_1014382151 | 3300004479 | Soil | MKILFFDIETVPTDQSLQDNGLLESQIRLDEAEIIKKLSLAAATSRILCLAYALEPP |
| Ga0062592_1016019581 | 3300004480 | Soil | MSSMKIFFFDIETIPTDQSVLDNNLLAAQMRLDEPEIIKKLSLSAATARILCLAYAIE |
| Ga0062594_1007195441 | 3300005093 | Soil | MKICFFDIETVPTEPSLQENGLLEEQIRLDEAEILKKLSLSAATAK |
| Ga0068993_100141561 | 3300005183 | Natural And Restored Wetlands | MKIFYFDIETVPTDHALKENGLLDAQIKLDEPELIKKLSLSAATAKIICLCYAFEPSL |
| Ga0068996_102178631 | 3300005218 | Natural And Restored Wetlands | MKIFYFDIETVPTDQSLKENGLLDAQIKLDEPELIKRLSLSAATAKIICLCYAFE |
| Ga0066388_1032401751 | 3300005332 | Tropical Forest Soil | MKVIFLDIETVPTDQALLEHGLLEPQLQLNEGDLLKKLSLSATTAKILCLCY |
| Ga0066388_1073704422 | 3300005332 | Tropical Forest Soil | MKVIFLDIETVPTDQALLEHGLLEPQLQFNEAELIKKLSLSATTAKIVCLCYA |
| Ga0070666_100843321 | 3300005335 | Switchgrass Rhizosphere | MKVIFLDIETVPTDQALLEHGLLEPQLQLNEGDLIKKLSLSATTAKILCL |
| Ga0070689_1009448231 | 3300005340 | Switchgrass Rhizosphere | MKVIFLDIETVPTDQALREHGLLEPQLQLNEGDLIKKLSLSATTAKILCLCYAMEPAVHTAIEVLD |
| Ga0070692_103868141 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MKILFFDIETVPTEPSLQENGLLEEQIRLDEAEVLKKLSLSAATAKIICLCYAIEPSV |
| Ga0070703_102202381 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVILLDIETVPTDQALLEHGLLEPQLQLNEGDLIKKLSLSATTAKILCLCYAM |
| Ga0070705_1008599051 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIFFFDIETVPTNKSLQENGLLEEQIKLDEPELIKKLSLSAATAKIICL |
| Ga0070700_1010660361 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MAMKIIFLDIETVPTDLSLQENGLLEPQIQLNETELIKKLSLSAA |
| Ga0070706_1019070212 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKILFFDIETVPTEPSLQENGLLEEQIRLDEAEVLKKLSLSAATAKIICLCYAIEPSVSGTIE |
| Ga0070697_1005286651 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVIFLDIETVPTDQALREHGLLEPQLQLNEGDLIKKLSLSATTAKILCLCYAMEPAVHTAIEVLDGDEREII |
| Ga0070704_1001851152 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MKILFFDIETVPTEPSLQENGLLEEQIRLDEAEVLKKLSLSAATAKIICL |
| Ga0068855_1013366412 | 3300005563 | Corn Rhizosphere | MKVIFLDIETVPTDQALREHGLLEPQLQLNEGDLIKKLSLSATTAKILCLCYAMEPAVHTAIEVLDGDERE |
| Ga0068852_1028447801 | 3300005616 | Corn Rhizosphere | MKVIFLDIETVPTDQALREHGLLEPQLQLNEGDLIKKLSLSATTAKIL |
| Ga0068860_1010954611 | 3300005843 | Switchgrass Rhizosphere | MAMKIIFLDIETVPTDLSLQENGLLEPQIQLNETELIKKLSLSAATAKILCLCYAIEPS |
| Ga0068862_1012646512 | 3300005844 | Switchgrass Rhizosphere | MKVIFLDIETVPTDQALLEHGLLEPQLQLNEGDLIKKLSLSATTA |
| Ga0075285_10224442 | 3300005890 | Rice Paddy Soil | MDIETVPTDRSLEENGLLEAQLQLDEGDLIKKLSLSAAT |
| Ga0075417_100510192 | 3300006049 | Populus Rhizosphere | MPMKIIFLDIETVPTDLSLQENGLLEAQIQLNETELLKKLSLSAVT |
| Ga0070716_1009565592 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTIFLDIETVPTDPSLQENGLLEAQIQLNEAELLKKLSLSAVTAKIICI |
| Ga0068871_1017538212 | 3300006358 | Miscanthus Rhizosphere | MRIFFFDIETVPTERSLEECGLLDKEVTPENTELLKRLSLSAATAKILCLAYAVEPPGDAPVQILHGDEREIL |
| Ga0075428_1002856201 | 3300006844 | Populus Rhizosphere | MKILFFDIETVPTERSLQDNGLLESQIRLDEAEIIKKLSLAAATSRILCLAYALEPPL |
| Ga0075428_1023871012 | 3300006844 | Populus Rhizosphere | MKVIFLDIETVPTDQALLEHGLLEPQLQLNEGDLIKKLSL |
| Ga0075421_1007530992 | 3300006845 | Populus Rhizosphere | MKILFFDIETVPTEQSLQDNGLLESQIRLDEAEIIKKLSLA |
| Ga0075431_1014626571 | 3300006847 | Populus Rhizosphere | MKVIFLDIETVPTDQALLEHGLLEPQLQLNEGDLLKKLSLSATTAKILCLCYATEPAAQP |
| Ga0075420_1014090832 | 3300006853 | Populus Rhizosphere | MKILFFDIETVPTEQSLQDNGLLESQIRLDEAEIIKKLSLAG |
| Ga0073934_105041591 | 3300006865 | Hot Spring Sediment | MKILFFDIETIPTEQFLRENGVLEAQMQLDEAEIIKRLSLSA |
| Ga0075434_1010711862 | 3300006871 | Populus Rhizosphere | MKILFFDIETVPTEQSLQDNGLLESQIRLDEAEIIKKLSLAAATSR |
| Ga0075426_105415082 | 3300006903 | Populus Rhizosphere | MKVIFLDIETVPTDQALREHGLLEPQLQLNEGDLIKKLSLSATTAKILCLCYAMEPAVHTAIEVLDGDE |
| Ga0075424_1006783412 | 3300006904 | Populus Rhizosphere | MKILFFDIETVPTEQSLQDNGLLESQIRLDEAEIIKKLSL |
| Ga0075424_1006874172 | 3300006904 | Populus Rhizosphere | MKILFFDIETVPTDQSLQDNGLLESQIRLDEAEIIKKLSLAA |
| Ga0075419_109030782 | 3300006969 | Populus Rhizosphere | MKVIFLDIETVPTDQALLEHGLLEPQLQLNEGDLLKKLSLSATTAKILCLCYATEPAAQPAI |
| Ga0079218_112816251 | 3300007004 | Agricultural Soil | MKIIFFDIETVPTDQALQASGLLESQMQLDEADLIKRLSLSAMTAKICCLGYAVEPPLDSTVEVLH |
| Ga0105095_103961031 | 3300009053 | Freshwater Sediment | MKIFYFDIETVPTDKALQENGLLDAQIKLDEPELIKKLSLSAVTAKIICL |
| Ga0099830_100059183 | 3300009088 | Vadose Zone Soil | MKILFLDIETVPTPEALAESGLLDSQIQLDEQEIIKRL |
| Ga0075418_108507692 | 3300009100 | Populus Rhizosphere | MKILFFDIETVPTEQSLQDNGLLESQIRLDEAEIIKKL |
| Ga0066709_1028864112 | 3300009137 | Grasslands Soil | MKILFFDIETVPTEQSLQHSGLLEAQMQLDEAEIIKRLSL |
| Ga0105094_108242432 | 3300009153 | Freshwater Sediment | MKIFYFDIETVPTDKALQENGLLDAQIKLDEAELIKKLSLSAATAKI |
| Ga0105092_102084061 | 3300009157 | Freshwater Sediment | MKVLFFDIETVPTEQSLQDNGLLESQIRLDEAEIIKKLSLAAATSRILCLAY |
| Ga0105092_102339901 | 3300009157 | Freshwater Sediment | MKILFFDIETVPTEQSLQDNGLLESQIRLDEAEIIKKLSLAAATSRILCLAYAL |
| Ga0105092_102765601 | 3300009157 | Freshwater Sediment | MKILFFDIETVPTEQSLQDNGLLESQIKLDEAEIIKKLSLAAATSRILCLAYALEPPFD |
| Ga0105237_118322632 | 3300009545 | Corn Rhizosphere | MKVIFLDIETVPTDQALLEHGLLEPQLQLNEGDLIKKLSLSATTAKILCLCYAMEPAV |
| Ga0126374_113762041 | 3300009792 | Tropical Forest Soil | MRILFFDIETVPTEQSLQDNGLLETQLKLDEAEIVKKLSLSGATARILCL |
| Ga0105076_10036993 | 3300009816 | Groundwater Sand | MKILFFDIETVPTEQALQDNGLLESQIRLDEAEIIKKLSLAAATA |
| Ga0134063_100065051 | 3300010335 | Grasslands Soil | MKILFFDIETVPTEQSLQHSGLLEAQMQLDEAEIIKRLSLSAATARILCLAYALEPPADS |
| Ga0126379_122942142 | 3300010366 | Tropical Forest Soil | MKVIFLDIETVPTDQALLEHGLLEPQLQFNEAELIKKLSLSATTAKIVCLCY |
| Ga0134128_118218082 | 3300010373 | Terrestrial Soil | MKICFLDIETVPTERSLEENGLLEPQIHLDEAELIKKLSLSAATAKILCICYAI* |
| Ga0136847_112306621 | 3300010391 | Freshwater Sediment | MKIFYFDIETVPTEHALKENGLLDSQIKLDEPELI |
| Ga0134127_109414141 | 3300010399 | Terrestrial Soil | MKICFLDIETVPTDRSLEENGLLDAQIQLDEADLIKKLSLSA |
| Ga0134127_123015692 | 3300010399 | Terrestrial Soil | MKIFFFDIETVPTNKSLQENGLLEEQIKLDEPELIKKLSLSAATAKIICLCYA |
| Ga0137326_11425052 | 3300011417 | Soil | MKIFYFDIETVPTDKALQENGLLDEQIKLDEAEII |
| Ga0137314_11875031 | 3300011420 | Soil | MKIFFFDIETVPTDKALQENGLLDAQIKLDEAEIIKK |
| Ga0137436_11325442 | 3300011423 | Soil | MKIFYFDIETVPTDKALQENGLLDEQIKLDEAEIIKKLSLSAATAKI |
| Ga0137448_12036892 | 3300011427 | Soil | MKIFFFDIETVPTEQSLQDNGLLESQIKLDEAELLKKLSLSAATA |
| Ga0137451_11505251 | 3300011438 | Soil | MKIFYFDIETVPTDKALQENGLLDEQIKLDEAEIIKKLSL |
| Ga0137433_12556031 | 3300011440 | Soil | MKIFYFDIETVPTDKALQENGLLDEQIKLDEAEIIKKLSLSAATAKIICLC |
| Ga0137437_12197382 | 3300011442 | Soil | MKIFFFDIETVPTDQSLQDNGLLESQIKLDEAELLKKLSLSAATARILCLAY |
| Ga0137457_13413341 | 3300011443 | Soil | MKIFYFDIETVPTDKALQENGLLDAQIKLDEAEIIKKLSLSAVTAKII |
| Ga0137453_10043562 | 3300012034 | Soil | MKIFFFDIETVPTDKSLQENGLLDSQIKLDEAELI |
| Ga0137349_10195272 | 3300012160 | Soil | MKILFFDIETVPTQQSLHDNGLLESQIRLDEAEIIKKLSLAAATSRILCLAYALE |
| Ga0137350_10740822 | 3300012166 | Soil | MKIFYFDIETVPTDKALQENGLLDEQIKLDEAEIIKKLSLSAATAKIICLCYAFEPSVSG |
| Ga0137334_10730401 | 3300012179 | Soil | MKIFFFDIETVPTDESLRDNGLLDAQIKLDEAELLKKLSLSAATAKIICLGYAIDPPADS |
| Ga0137388_103115391 | 3300012189 | Vadose Zone Soil | MKILFFDIETVPTEQSLQDNGLLEAQMQLDEAAIIKKLSLAAATSRILCLAYALEP |
| Ga0137382_105179372 | 3300012200 | Vadose Zone Soil | MAMKIIFLDIETVPTDLSLQENGLLEPQIQLNETELIKKLSLSA |
| Ga0137381_112176722 | 3300012207 | Vadose Zone Soil | MAMKIIFLDIETVPTDLSLQENGLLEPQIQLNETELIKKLSLSAATAKILCLCYAIE |
| Ga0137376_100384253 | 3300012208 | Vadose Zone Soil | MKTIFLDIETVPTDQSLKENGLLDLQMQLDEAELIKKLSLS |
| Ga0137317_10270422 | 3300012672 | Soil | MKIFFFDIETVPTEKSLQENGLLEEQIKLDEPELIKKLSLSAA |
| Ga0157301_103665982 | 3300012911 | Soil | MKVIFLDIETVPTDQALREHGLLEPQLQLNEGDLIKKLSLSATTAK |
| Ga0157310_102381851 | 3300012916 | Soil | MKVIFLDIETVPTDQALREHGLLEPQLQLNEGDLIKK |
| Ga0137407_113355572 | 3300012930 | Vadose Zone Soil | MKILFFDIETVPTEQSLQDNGLLESQIRLDEAEIIKKLSLAAATSRILCLAYALE |
| Ga0137407_114131541 | 3300012930 | Vadose Zone Soil | MKILFFDIETVPTDQSLQDNGLLESQIRLDEAEIIKKLSLAAATSRILCLAYALE |
| Ga0126375_111822752 | 3300012948 | Tropical Forest Soil | MKILFLDIETVPTEQSLQDNGLFEPQLKLDEAEIIKKLSLSGATARILCLAYALEPP |
| Ga0164308_100612271 | 3300012985 | Soil | MKVIFLDIETVPTDQALLEHGLLEPQLQLNEGDLIKKLSLSATTAKILCLCYA |
| Ga0075314_11048981 | 3300014265 | Natural And Restored Wetlands | MKIFFFDIETVPTERALRDNGLLDSQIKLDEAEVIKKLSLSAATAKIFCIAYAIEPPPDSPVNV |
| Ga0075344_10390772 | 3300014296 | Natural And Restored Wetlands | MKVLFFDIETVPTEQSLKDNGLREAQIKLDEAEIIKKLSLSAATSRILCLAYALEPPMDS |
| Ga0075349_11406952 | 3300014305 | Natural And Restored Wetlands | MKIFYFDIETVPTEKALQENGLLEAQIKLDEAEIIKKLSLSAVTAKIICLCYTIEPSVSGTIEVL |
| Ga0075350_11312461 | 3300014315 | Natural And Restored Wetlands | MKIFYFDIETVPTEKALQENGLLEAQIKLDEAEIIKKLSLSAVTAKIICLCYTIEPSVSG |
| Ga0180087_10997762 | 3300014872 | Soil | MKILFFDIETVPTEQSLKDNGLLESQIKLDEADIIKKLSLAGATSRILCLAYALE |
| Ga0180066_10801072 | 3300014873 | Soil | MKIFFFDIETVPTDKSLQDNGLLDSQIKLDEAELIKKLSLS |
| Ga0180064_10549192 | 3300014876 | Soil | MKIFYFDIETVPTDKALQENGLLDEQIKLDEAEIIKKLSLSAATAKII |
| Ga0180063_12164161 | 3300014885 | Soil | MKICFLDIETVPTDQSLQENGLLDSQIKIDEAELIKKLSLS |
| Ga0173480_110873312 | 3300015200 | Soil | MKIFFFDIETVPTDKSLQENGLLEEQIKLDEAELIKKLSLSAATAKII |
| Ga0137418_104230402 | 3300015241 | Vadose Zone Soil | MKTIFLDIETVPTDPSLQENGLLEAQIQLNEAELLKKLSLS |
| Ga0132256_1007453772 | 3300015372 | Arabidopsis Rhizosphere | MKVIFLDIETVPTDQALLEHGLLEPQLQLNEGDLIKKLSLSATTAKILCLCY |
| Ga0132257_1004323371 | 3300015373 | Arabidopsis Rhizosphere | MKVIFLDIETVPTDQALLEHGLLEPQLQLNEGDLIKKLSLSATTAKILCLCYAM |
| Ga0132255_1020070292 | 3300015374 | Arabidopsis Rhizosphere | MKVIFLDIETVPTDQALLEHGLLEPQLQLNEGDLI |
| Ga0132255_1025799391 | 3300015374 | Arabidopsis Rhizosphere | MKVIFLDIETVPTDQALREHGLLEPQLQLNEGDLIKKLSLSATTAKILCLCYAMEPAVH |
| Ga0184610_10973631 | 3300017997 | Groundwater Sediment | MKTIFLDIETVPTDQSLKENGLLESQIQLDEAELIKKLSLS |
| Ga0184638_10438582 | 3300018052 | Groundwater Sediment | MKILFFDIETVPTEQSLHDNGLLESQIKLDEAEIIKKLSLAAA |
| Ga0184626_100228822 | 3300018053 | Groundwater Sediment | MKIFFFDIETVPTDKSLQENGLLEEQIKLDEPELIKKLSLSAATAKIICLCYAID |
| Ga0184624_103632901 | 3300018073 | Groundwater Sediment | MKILFFDIETVPTEQSLQDNGLLESQIRLDEAEIIKKLSLAAATSRILCLAYALEPPFDSPF |
| Ga0184609_103184652 | 3300018076 | Groundwater Sediment | MKIFFFDIETVPTDKSLQENGLLEEQIKLDEPELIKKLSLS |
| Ga0184633_105136442 | 3300018077 | Groundwater Sediment | MKIFFLDIETVPTDHALKENGLLEAQIKLDEPELIKKLSLSAATAKIICLCYAVEPSLTNSIEV |
| Ga0184612_101624742 | 3300018078 | Groundwater Sediment | MKIFFFDIETVPTNKSLQENGLLDAQIKLDEAELIKKLSLSAATAKIICLCYAIDPPGD |
| Ga0184627_101717952 | 3300018079 | Groundwater Sediment | MKTIFLDIETVPTDQSLKENGLLESQIQLDEAELIKKLSLSAATAKILCLCYAFDPPADS |
| Ga0190265_104854441 | 3300018422 | Soil | MKIFFFDIETIPTDQSVLDNNLLAAQIRLDEPEIIKKLSLSAATARI |
| Ga0190264_103545261 | 3300019377 | Soil | MKIFFFDIETVPTEQSLQENGLLDAQIQLNEEEIIKKLSLSAMTAKIICLCYAIEPSVSGTVE |
| Ga0193715_10247782 | 3300019878 | Soil | MKTIFLDIETVPTDPSLQENGLLEAQIQLNEAELLKKLSLSAVTA |
| Ga0193747_10679451 | 3300019885 | Soil | MKTIFLDIETVPTDPSLQENGLLEAQIQLNEAELLKKLSLSAVTAKIICIG |
| Ga0193731_11635592 | 3300020001 | Soil | MKTIFLDIETVPTDPSLQENGLLEAQIQLNEAELLKKLSLSAVTAKIICIGYAVEPPVGCEVQAL |
| Ga0206227_11175982 | 3300021063 | Deep Subsurface Sediment | MKIFFFDIETVPTDQSLQDNGLLDSQIKLDEAELLKKL |
| Ga0247745_10610201 | 3300022898 | Soil | MKVIFLDIETVPTDQALREHGLLEPQLQLNEGDLIKKLSLS |
| Ga0247794_102191931 | 3300024055 | Soil | MKVIFLDIETVPTDQALREHGLLEPQLQLNEGDLIK |
| Ga0209108_101808291 | 3300025165 | Soil | MKIFFFDIETVPTDQSLQDNGLLGSQIKLDEAELLKKLSLSAATARILCLGYAI |
| Ga0209431_112208451 | 3300025313 | Soil | MKIFFFDIETVPTDRSLQDNGLLESQIKLDEAELI |
| Ga0209641_104065131 | 3300025322 | Soil | VKIFFFDIETVPTEQSLQDNGLLDSQIKLDEAELLKKLSLSAATAKILCLGYAIDPPADSPV |
| Ga0209342_107367461 | 3300025326 | Soil | MKIFFFDIETAPTDQSLQDNGLLESQIKLDEAELLKKLSLSAATAKILCLGY |
| Ga0210138_10518821 | 3300025580 | Natural And Restored Wetlands | MKILFFDIETVPTDQSLQDNGLLEAQMQLDEADIIKKLSLAAA |
| Ga0207680_100785392 | 3300025903 | Switchgrass Rhizosphere | MKVIFLDIETVPTDQALREHGLLEPQLQLNEGDLIKKLSLSATTAKILCLCYAMEPAVHT |
| Ga0207693_100959452 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVIFLDIETVPTDQALREHGLLEPQLQLNEGDLI |
| Ga0207660_101816262 | 3300025917 | Corn Rhizosphere | MKICFLDIETVPTDRSLEENGLLEPQIHLDEAELIKKLSLSAATAKILCICYAIEP |
| Ga0207662_110744872 | 3300025918 | Switchgrass Rhizosphere | MKILFFDIETVPTEPSLQENGLLEEQIRLDEAEVRVD |
| Ga0207709_104011301 | 3300025935 | Miscanthus Rhizosphere | MAMKIIFLDIETVPTDLSLQENGLLEPQIQLNETELIKKLSLSAAT |
| Ga0207704_102176402 | 3300025938 | Miscanthus Rhizosphere | MKVIFLDIETVPTDQALLEHGLLEPQLQLNEGDLIKKLSLSATTAKILCLCYAMEPAVHT |
| Ga0208778_10058562 | 3300026025 | Rice Paddy Soil | MDIETVPTDRSLEENGLLEAQLQLDEGDLIKKLSLSAA |
| Ga0207675_1002565053 | 3300026118 | Switchgrass Rhizosphere | MAMKIIFLDIETVPTDLSLQENGLLEPQIQLNETELIK |
| Ga0209967_10319361 | 3300027364 | Arabidopsis Thaliana Rhizosphere | MKICFMDIETVPTDRSLEENGLFEAQLQLDEADVIKKLSLSAATAKILCLCYAIEPPV |
| Ga0209819_100006091 | 3300027722 | Freshwater Sediment | MKILFFDIETVPTEQSLQDNGLLESQIRLDEAEIIKKLSLAAATSRILCLAY |
| Ga0209819_100637021 | 3300027722 | Freshwater Sediment | MKILFFDIETVPTEQSLQDNGLLESQIKLDEAEIIKKLSLA |
| Ga0209689_12592191 | 3300027748 | Soil | MKILFFDIETVPTEQSLQDNGLLESQIRLDEAEIIKKLSLAAA |
| Ga0209814_101186192 | 3300027873 | Populus Rhizosphere | MKILFFDIETVPTEQSLQDNGLLESQIRLDEAEIIKKLSLAAATSRILCLAYALEP |
| Ga0207428_101951261 | 3300027907 | Populus Rhizosphere | MKVIFLDIETVPTDQALREHGLLEPQLQLNEGDLIKKLSLSATTAKILCLCYAMEPAVHTAIEVLDGDER |
| Ga0209382_106799292 | 3300027909 | Populus Rhizosphere | MKIFFFDIETVPTEKSLQENGLLEEQIKLDEPELIKKLSL |
| Ga0268265_122174042 | 3300028380 | Switchgrass Rhizosphere | MKVIFLDIETVPTDQALLEHGLLEPQLQLNEGDLIKKLSLSATTAKIL |
| Ga0299906_100958862 | 3300030606 | Soil | MKILFFDIETIPTEDSLEHSGLLEAQLQLDEADIIKRLSLSAATARILCLAYALEPP |
| Ga0299906_107613581 | 3300030606 | Soil | MKICFLDIETVPTDRSLEENGLLESQIQLDEAELIKKLSLSAATAKILCLCYA |
| (restricted) Ga0255310_100743992 | 3300031197 | Sandy Soil | MKICFLDIETVPTDQSLQENGLLESQIKIDEAELI |
| Ga0307410_101002371 | 3300031852 | Rhizosphere | MKIFYFDIETVPTDKSLQDNGLLEPQIKLDEAEIIKKLSLSAITAKI |
| Ga0310910_105722492 | 3300031946 | Soil | MKVIFLDIETVPTDQALLEHGLLEPQLQFNEGELIKKLSLSATTAKIVCLCYAIEPATQT |
| Ga0306926_112708081 | 3300031954 | Soil | MKILFLDIETVPTDQSLQDNGLLESQIRLDEAEIIKKLSLAAATSKILCL |
| Ga0307416_1029431862 | 3300032002 | Rhizosphere | MSSMKIFFFDIETIPTDQSVLDHNLLAAQMRLDEPEIIKKLSLSAATARILCLA |
| Ga0310906_105308361 | 3300032013 | Soil | MKVIFLDIETVPTDQALLEHGLLEPQLQLNEGDLIKKLSLSATTAKILCLCYAMEPAVHTAI |
| Ga0315912_108273322 | 3300032157 | Soil | MKTCFMDIETVPTDRSLEENGLLESQIKLDEADLIKKLSLSAATAKILCLCYAIEPPMGS |
| Ga0307470_101385921 | 3300032174 | Hardwood Forest Soil | MAMKIIFLDIETVPTDLSLQENGLLEPQIQLNETELIKKLSLSAATAKILCLCYAIEPST |
| Ga0335070_101935921 | 3300032829 | Soil | MKIMFFDIETVPTEAALQEYGLLEAQIQLNEAEIIKKLSLSAATAKI |
| Ga0335084_106969912 | 3300033004 | Soil | MKILFLDIETVPTQQSLQENNLLEAQMQLDEAEIIKKLSLAAITSRIICLAYALEPPTDS |
| Ga0364924_170379_407_517 | 3300033811 | Sediment | MKILFFDIETVPTEQSLKDNGLLESQIKLDEADIIKK |
| Ga0364925_0333844_396_569 | 3300034147 | Sediment | MKILFFDIETVPTQQSLHDNGLLESQIRLDEAEIIKKLSLAAATSRILCLAYALEPPL |
| Ga0373958_0200079_2_175 | 3300034819 | Rhizosphere Soil | MKILFFDIETVPTDQSLQDNGLLESQIRLDQAEIIKKLSLAAATSRILCLAYALEPPL |
| ⦗Top⦘ |