NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F042622

Metagenome Family F042622

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F042622
Family Type Metagenome
Number of Sequences 158
Average Sequence Length 40 residues
Representative Sequence MSEDLERLKQRIPLLEYLQRHNWKPCRAGSRQEFVGLCPL
Number of Associated Samples 138
Number of Associated Scaffolds 158

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 91.72 %
% of genes near scaffold ends (potentially truncated) 97.47 %
% of genes from short scaffolds (< 2000 bps) 94.94 %
Associated GOLD sequencing projects 131
AlphaFold2 3D model prediction Yes
3D model pTM-score0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.937 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(27.848 % of family members)
Environment Ontology (ENVO) Unclassified
(33.544 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(42.405 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 27.94%    β-sheet: 0.00%    Coil/Unstructured: 72.06%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.29
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 158 Family Scaffolds
PF01695IstB_IS21 2.53
PF00239Resolvase 1.27
PF02371Transposase_20 1.27
PF08843AbiEii 0.63
PF04266ASCH 0.63
PF01343Peptidase_S49 0.63
PF13701DDE_Tnp_1_4 0.63
PF06685DUF1186 0.63
PF02518HATPase_c 0.63
PF14460Prok-E2_D 0.63

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 158 Family Scaffolds
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 2.53
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 1.27
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 1.27
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 1.27
COG3547TransposaseMobilome: prophages, transposons [X] 1.27
COG2253Predicted nucleotidyltransferase component of viral defense systemDefense mechanisms [V] 0.63
COG2411Predicted RNA-binding protein, contains PUA-like ASCH domainGeneral function prediction only [R] 0.63
COG3097Uncharacterized conserved protein YqfB, UPF0267 familyFunction unknown [S] 0.63
COG4405Predicted RNA-binding protein YhfF, contains PUA-like ASCH domainGeneral function prediction only [R] 0.63


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.94 %
UnclassifiedrootN/A5.06 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918007|ConsensusfromContig19101All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium753Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_103900486All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium500Open in IMG/M
3300000567|JGI12270J11330_10107674All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1186Open in IMG/M
3300000955|JGI1027J12803_108949016All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1286Open in IMG/M
3300001453|JGI20197J15136_1015030All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium700Open in IMG/M
3300005175|Ga0066673_10158391All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1265Open in IMG/M
3300005343|Ga0070687_101366240All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300005764|Ga0066903_103530978All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium842Open in IMG/M
3300005994|Ga0066789_10193616All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium858Open in IMG/M
3300006028|Ga0070717_11399705All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium635Open in IMG/M
3300006086|Ga0075019_10247069All Organisms → cellular organisms → Bacteria1064Open in IMG/M
3300006086|Ga0075019_10773162All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium611Open in IMG/M
3300006846|Ga0075430_100595938All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300006954|Ga0079219_12297358All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300009012|Ga0066710_101921800All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium884Open in IMG/M
3300009012|Ga0066710_103962979All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300009078|Ga0105106_10492896Not Available881Open in IMG/M
3300009166|Ga0105100_10604942Not Available672Open in IMG/M
3300009525|Ga0116220_10612923All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300009551|Ga0105238_12922654Not Available514Open in IMG/M
3300009633|Ga0116129_1138477All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium695Open in IMG/M
3300009792|Ga0126374_10125363All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1510Open in IMG/M
3300010046|Ga0126384_11967643All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300010048|Ga0126373_10028115All Organisms → cellular organisms → Bacteria → Acidobacteria4834Open in IMG/M
3300010048|Ga0126373_10580298All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1172Open in IMG/M
3300010361|Ga0126378_12158677All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium635Open in IMG/M
3300010361|Ga0126378_13457006All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300010366|Ga0126379_11098203All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium901Open in IMG/M
3300010376|Ga0126381_101608816All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium939Open in IMG/M
3300010398|Ga0126383_12276797All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium628Open in IMG/M
3300011270|Ga0137391_11502454All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300012096|Ga0137389_10542827All Organisms → cellular organisms → Bacteria998Open in IMG/M
3300012210|Ga0137378_10784050All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300012211|Ga0137377_10594259All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1044Open in IMG/M
3300012362|Ga0137361_10684498All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium937Open in IMG/M
3300012532|Ga0137373_10203242All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1630Open in IMG/M
3300012918|Ga0137396_10826953All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium681Open in IMG/M
3300012924|Ga0137413_10386808All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1002Open in IMG/M
3300012982|Ga0168317_1012508All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2708Open in IMG/M
3300013296|Ga0157374_12558205All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300014157|Ga0134078_10170938All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300014200|Ga0181526_10646686All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium667Open in IMG/M
3300014501|Ga0182024_11007476All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium993Open in IMG/M
3300015241|Ga0137418_10570693Not Available892Open in IMG/M
3300016270|Ga0182036_10949089All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium707Open in IMG/M
3300016270|Ga0182036_11743353All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300016294|Ga0182041_11210056All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium689Open in IMG/M
3300016294|Ga0182041_11816052All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium565Open in IMG/M
3300016294|Ga0182041_12196816Not Available516Open in IMG/M
3300016404|Ga0182037_10386790All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1149Open in IMG/M
3300016422|Ga0182039_11370837All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium642Open in IMG/M
3300017970|Ga0187783_11017148All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium597Open in IMG/M
3300018012|Ga0187810_10074755All Organisms → cellular organisms → Bacteria1306Open in IMG/M
3300018037|Ga0187883_10634711All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium555Open in IMG/M
3300018058|Ga0187766_10867640All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium634Open in IMG/M
3300018060|Ga0187765_11323115All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300018064|Ga0187773_10252620All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium964Open in IMG/M
3300019786|Ga0182025_1143949All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1185Open in IMG/M
3300020580|Ga0210403_11508300All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M
3300021439|Ga0213879_10267493All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300021476|Ga0187846_10085963All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1362Open in IMG/M
3300021476|Ga0187846_10362291All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium597Open in IMG/M
3300021560|Ga0126371_10941619All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1007Open in IMG/M
3300021560|Ga0126371_12152156All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium673Open in IMG/M
3300022875|Ga0224553_1054413All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium865Open in IMG/M
3300025463|Ga0208193_1085767All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium624Open in IMG/M
3300025922|Ga0207646_11162764All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium677Open in IMG/M
3300025928|Ga0207700_10662092All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium931Open in IMG/M
3300025944|Ga0207661_12121841All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium508Open in IMG/M
3300025960|Ga0207651_10925010All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium777Open in IMG/M
3300026078|Ga0207702_11888964All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300026323|Ga0209472_1130897All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium970Open in IMG/M
3300026328|Ga0209802_1208287All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300026480|Ga0257177_1066370All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium573Open in IMG/M
3300026528|Ga0209378_1288135All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300026530|Ga0209807_1325561All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium522Open in IMG/M
3300026555|Ga0179593_1162111All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1642Open in IMG/M
3300027645|Ga0209117_1183408All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium534Open in IMG/M
3300027748|Ga0209689_1353347All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300027825|Ga0209039_10043546All Organisms → cellular organisms → Bacteria2077Open in IMG/M
3300027842|Ga0209580_10137750All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1197Open in IMG/M
3300027898|Ga0209067_10227547All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1009Open in IMG/M
3300027911|Ga0209698_11043273All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium608Open in IMG/M
(restricted) 3300028043|Ga0233417_10541382Not Available549Open in IMG/M
3300028808|Ga0302228_10365731All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium642Open in IMG/M
3300028906|Ga0308309_10662081All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium907Open in IMG/M
3300029922|Ga0311363_10102456All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli3928Open in IMG/M
3300030053|Ga0302177_10102696All Organisms → cellular organisms → Bacteria1653Open in IMG/M
3300030490|Ga0302184_10307477All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium635Open in IMG/M
3300031231|Ga0170824_101557512All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium822Open in IMG/M
3300031446|Ga0170820_10186045All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium596Open in IMG/M
3300031525|Ga0302326_12422824All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium661Open in IMG/M
3300031543|Ga0318516_10380029All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium814Open in IMG/M
3300031543|Ga0318516_10844031All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300031546|Ga0318538_10772190All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300031564|Ga0318573_10653192All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium566Open in IMG/M
3300031572|Ga0318515_10501762All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium647Open in IMG/M
3300031573|Ga0310915_10398188All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium977Open in IMG/M
3300031640|Ga0318555_10615346All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300031668|Ga0318542_10499428All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium632Open in IMG/M
3300031680|Ga0318574_10657419All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium614Open in IMG/M
3300031680|Ga0318574_10864493All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300031682|Ga0318560_10350429All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium797Open in IMG/M
3300031682|Ga0318560_10420996All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium723Open in IMG/M
3300031707|Ga0315291_10689440All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium909Open in IMG/M
3300031715|Ga0307476_11029980All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium606Open in IMG/M
3300031723|Ga0318493_10568485All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium630Open in IMG/M
3300031723|Ga0318493_10619187All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium604Open in IMG/M
3300031724|Ga0318500_10176476All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1015Open in IMG/M
3300031747|Ga0318502_10179438All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1219Open in IMG/M
3300031748|Ga0318492_10321125All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium807Open in IMG/M
3300031754|Ga0307475_10105702All Organisms → cellular organisms → Bacteria → Acidobacteria2202Open in IMG/M
3300031768|Ga0318509_10221024All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1055Open in IMG/M
3300031768|Ga0318509_10271871All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium947Open in IMG/M
3300031768|Ga0318509_10377082All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium793Open in IMG/M
3300031780|Ga0318508_1237096All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300031781|Ga0318547_10528365All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium729Open in IMG/M
3300031792|Ga0318529_10194722All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium939Open in IMG/M
3300031793|Ga0318548_10352033All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium723Open in IMG/M
3300031833|Ga0310917_10997909All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium561Open in IMG/M
3300031845|Ga0318511_10226526All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium835Open in IMG/M
3300031846|Ga0318512_10356845All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium731Open in IMG/M
3300031890|Ga0306925_11403761All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium688Open in IMG/M
3300031902|Ga0302322_101270171All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium894Open in IMG/M
3300031912|Ga0306921_10904878All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1001Open in IMG/M
3300031912|Ga0306921_11525217All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium729Open in IMG/M
3300031941|Ga0310912_10521988All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium925Open in IMG/M
3300031942|Ga0310916_11316983All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium594Open in IMG/M
3300031945|Ga0310913_10580459All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium795Open in IMG/M
3300031954|Ga0306926_11204816All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium889Open in IMG/M
3300032010|Ga0318569_10060807All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1654Open in IMG/M
3300032044|Ga0318558_10414585All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium670Open in IMG/M
3300032044|Ga0318558_10420827All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium665Open in IMG/M
3300032054|Ga0318570_10580996All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300032059|Ga0318533_10493402All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium897Open in IMG/M
3300032059|Ga0318533_11245860All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium544Open in IMG/M
3300032063|Ga0318504_10509923All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300032089|Ga0318525_10471931All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium642Open in IMG/M
3300032089|Ga0318525_10667677All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium529Open in IMG/M
3300032090|Ga0318518_10683478All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium522Open in IMG/M
3300032094|Ga0318540_10574443All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium543Open in IMG/M
3300032118|Ga0315277_10728981All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium948Open in IMG/M
3300032156|Ga0315295_12209497All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium512Open in IMG/M
3300032173|Ga0315268_11707752All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium642Open in IMG/M
3300032180|Ga0307471_101045010All Organisms → cellular organisms → Bacteria983Open in IMG/M
3300032180|Ga0307471_102472362All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium657Open in IMG/M
3300032205|Ga0307472_100884235All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium825Open in IMG/M
3300032258|Ga0316191_11215090All Organisms → cellular organisms → Bacteria → Acidobacteria545Open in IMG/M
3300032401|Ga0315275_11384146All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium759Open in IMG/M
3300032783|Ga0335079_10514749All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1274Open in IMG/M
3300032805|Ga0335078_10244314All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2455Open in IMG/M
3300032828|Ga0335080_10008175All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia10900Open in IMG/M
3300033158|Ga0335077_10475953All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1326Open in IMG/M
3300033290|Ga0318519_10562625All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium690Open in IMG/M
3300033487|Ga0316630_11777539Not Available562Open in IMG/M
3300033983|Ga0371488_0195346All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1023Open in IMG/M
3300034199|Ga0370514_184432All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium542Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil27.85%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.33%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.43%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment3.80%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.16%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.16%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.53%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.53%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.53%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.90%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.27%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.27%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.27%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.27%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.27%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.27%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.27%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm1.27%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.63%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.63%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.63%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.63%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow0.63%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.63%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.63%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.63%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.63%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.63%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.63%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.63%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.63%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.63%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.63%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.63%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.63%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.63%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.63%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.63%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.63%
Weathered Mine TailingsEnvironmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings0.63%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.63%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.63%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.63%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918007Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_allEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001453Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-092012EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009166Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009633Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012982Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfieldEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300019786Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021439Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03EnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022875Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 10-14EnvironmentalOpen in IMG/M
3300025463Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026480Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-BEnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300026555Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028043 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MGEnvironmentalOpen in IMG/M
3300028808Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030490Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032118Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032258Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cmEnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033487Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_AEnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M
3300034199Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
A_all_C_000109602140918007SoilMRGDLEQLKQRIPLLEYLQRHNWTARRVGAREEFVGLCPL
INPhiseqgaiiFebDRAFT_10390048613300000364SoilMATDLQRLKQSIPLLEYLQRHNWRPCRAATRQEFV
JGI12270J11330_1010767433300000567Peatlands SoilMYQDLEQLKRRLPLLEYLQRSHWQARRAGTRAEFVGLCP
JGI1027J12803_10894901633300000955SoilQRLKQRIPLLQYLQQHNWSGRPVAARSEFVGLCPLHEETH
JGI20197J15136_101503023300001453Arctic Peat SoilMERDLQYIKHQAPLLEYLRRHNWTARQVGSGQEFVGLCPLHPET
Ga0066673_1015839133300005175SoilMGKDLEHLKQRFPLLEYLQRHHWTGHPVGKGSEFVGLCPLHEET
Ga0070687_10136624023300005343Switchgrass RhizosphereMREDLEQLKQRISLLEYLQRCNWRSRRVGVRQEFVGLCPLHAETR
Ga0066903_10353097823300005764Tropical Forest SoilMTHDLERLKQRIPLLEYLQRHNWKPCRAGTRQELVGL
Ga0066789_1019361623300005994SoilMHEDLEQLKQRIPLMEYLQRRRWTGCRVAAREEFVGLCPLH
Ga0070717_1139970523300006028Corn, Switchgrass And Miscanthus RhizosphereMAHDLERLKQRIPLLEYLHHHNWKPCRAGTRQELVGLCP
Ga0075019_1024706933300006086WatershedsMAENLERLKQRVPLLEYLQRHNWKPCRTGSRQEFV
Ga0075019_1077316213300006086WatershedsMVENLERLKQRIPLLEYLQRHNWKPCRAGTRQEFVGLCHLHQETR
Ga0075430_10059593813300006846Populus RhizosphereMREDLEQLKQRISLLEYLQRRNWTPRRVGTRQELVGFCPLHSETRPSFYVNAR
Ga0079219_1229735823300006954Agricultural SoilMHQDLQQLKQRISLLEYLQRHHWTPRRSGSRQEFVGFCPFHAESRP
Ga0066710_10192180013300009012Grasslands SoilMAAMGEDWERLKQRIPLLEYLQRHHWTGHRADARS
Ga0066710_10396297913300009012Grasslands SoilMSEDLEQLKRRIPLLEYLQRYNWRPSRAGRQQELVGLCPLHLETR
Ga0105106_1049289623300009078Freshwater SedimentMNHNLQYLKERIPLLDYLRHHNWTARPIGAHQEFVGLCPL
Ga0105100_1060494213300009166Freshwater SedimentMNHELQSLKERIPLLDYLKRHNWTARPVGAHQEFV
Ga0116220_1061292313300009525Peatlands SoilLEGKNSTVGEDLERLKQRFPLLEYLQRHNWSARPAGTPQEFVGLCPLH
Ga0105238_1292265423300009551Corn RhizosphereMAENLERLKQRIPLLEYLQRHNWKPCRAGTRQEFVGLCSLHRKSRPSFYVKGAK
Ga0116129_113847723300009633PeatlandMDPVLEQLKQHLPMLEYLQRHNWKPRRRSARQEFVGLCP
Ga0126374_1012536333300009792Tropical Forest SoilMSEDLEQLKRRIPLLEYLQRYNWKPCRAGTRQELVGLCPL
Ga0126384_1196764323300010046Tropical Forest SoilMLLNERKPEPMAEDLERLKQHFPLLEYLQRHTWRGHRTGARPEFVGLCPLYQETHPSLY
Ga0126373_1002811513300010048Tropical Forest SoilMAENLERLKQLIPLLEYLQRHNWKPCRAGTRQEFV
Ga0126373_1058029813300010048Tropical Forest SoilMAENLERLKQRIPLLEYLQRHNWKPCRAGSRQELVGLCP
Ga0126378_1215867723300010361Tropical Forest SoilMSEDLERFKQRIPLLEYLQRHHWRGHRVGVGTEFAG
Ga0126378_1345700613300010361Tropical Forest SoilMREDLEEFTQRISLLEYLQRRNWTARRVGSRPEFVGFCPLHAEN
Ga0126379_1109820323300010366Tropical Forest SoilMEEDLERLKQRLPLLEYLQQHHWTPCRTGPRQEFVGLCPL
Ga0126381_10160881613300010376Tropical Forest SoilMREDLEELKQRISLFEYLQRHNWTAGRVGNRQEFVGF
Ga0126383_1227679713300010398Tropical Forest SoilMHKDLEQIKQRISLLEYLQRRNWTGCRVGAREEFVGLCPLRPETRPSFYVN
Ga0137391_1150245413300011270Vadose Zone SoilMRKDVEQLKERISLLEYLQRHNWTGRRVGAREEFVGLCPLH
Ga0137389_1054282733300012096Vadose Zone SoilMREDLEQLKQRIPLLQYLQRRHWTGCRVAAREEFVGLCPL
Ga0137378_1078405023300012210Vadose Zone SoilMTDELEYLKQRIPLLDYLQQRNWTARRVGAHLEFVGLCPLH
Ga0137377_1059425913300012211Vadose Zone SoilMGEDLERLKQRFPLLEYLQRHHWTGRPVGTGSEFVGLCPL
Ga0137361_1068449813300012362Vadose Zone SoilVDADLEQLKQRLPLLAYLQRHNWTARPADIPQEFVGLCPLHRDSRRH
Ga0137373_1020324233300012532Vadose Zone SoilMAENVERLKQRIPLLEYLQRHNWKPCRTATRQELVGLRPLHQETRPSFYV
Ga0137396_1082695313300012918Vadose Zone SoilMREDLEQIKNRIPLLEYLQQRNWTPHRVSAREEFVGLCPLHR
Ga0137413_1038680813300012924Vadose Zone SoilMGDDIERLKQRIPLLEYLQRHNWSARPAGQREEFA
Ga0168317_101250813300012982Weathered Mine TailingsMGEDVERIKQRIPLLEYLQRHNWTAQRSGPRQEFVGLCPLHRDTR
Ga0157374_1255820513300013296Miscanthus RhizosphereMAENLERLKQRIPLLEYLQRHNWKPCRAGTRQEFVG
Ga0134078_1017093823300014157Grasslands SoilMMTDELEYLKQRIPLLDYLQQRNWTARRVGAHLEFVGLC
Ga0181526_1064668613300014200BogMAEDLERLKQRIPLLEYLQRHNWKPCRAGSRQEFVGLCP
Ga0182024_1100747623300014501PermafrostMDLKRLKQHLPLLEYLQQHNWSARCTGSSQEFVGLC
Ga0137418_1057069313300015241Vadose Zone SoilVDADLEQLKQRLPLLAYLQRHNWTARPADIPQEFVGLCPLHRD
Ga0182036_1094908923300016270SoilMREDLERLKQRIPLLEYLQRHHWSGHPAGAREEFVGLCPL
Ga0182036_1174335313300016270SoilMKQDLERLKQRLPLLEYLQQHHWTPCRTGSRQELVGLCP
Ga0182041_1121005623300016294SoilMGKDSERLKQHFPLLEYLQRLHWTGRPVGNGSEFVGLCPLHEEN
Ga0182041_1181605213300016294SoilMEEDLERLKQRLPLLEYLQQHHWTACRTGPRQEWV
Ga0182041_1219681613300016294SoilMSEDLEEIKRRIPLLGYLQRHNWRPCRAGSRQEFIGLC
Ga0182037_1038679013300016404SoilMAENLERLKQRIPLLEYLQRHNWKPCRAGSRQEFVGLCGLHRETQLSFYV
Ga0182039_1137083713300016422SoilMGDDLERLKQRLPLLEYLQRHNRTPHRATAAQEFVGLCPL
Ga0187783_1101714813300017970Tropical PeatlandMGEDLERLKRRVPLLEYLNRHHWKGHRVSTGPEFVGLCPLH
Ga0187810_1007475513300018012Freshwater SedimentMAAMGEDLERLKQRIPLLEYLQRHHWTGHRAGARSEF
Ga0187883_1063471123300018037PeatlandVAADRERLKQRLPLLAYLGRHNWIARPAGTPQEFVGLCPLHRKAALPS
Ga0187766_1086764023300018058Tropical PeatlandMGEDLERLKRRVPLLEYLNRHHWKGHRVSTGPEFLGLCPLHAET
Ga0187765_1132311513300018060Tropical PeatlandMGEDLERLKQRIPLLEYLQQHHWRGHRVGAGPEFAGLCPLHEDN
Ga0187773_1025262013300018064Tropical PeatlandMSEDLEQLKQRLPLLEYLQQHNWTGYHVGAGDEFVGLCP
Ga0182025_114394933300019786PermafrostLREDLEHLKQRISLLDYLQQRNWTACRVSAREEFVGLCPLHA
Ga0210403_1150830023300020580SoilMGKDLERLKQHFPLLEYLQRHHWTGRPVGNGSEFVG
Ga0213879_1026749313300021439Bulk SoilMREDVAQIKQRLPLLEYLQRHNWTGCRVGTREEFVGLCPLHA
Ga0187846_1008596323300021476BiofilmMRENLEQLKQRIPLLEYLQRRHWTGCRVAAREEFVGLCPLHQVPDRIYLVTR
Ga0187846_1036229123300021476BiofilmMYQDLEQLKRHFPLLEYLWRHHWKARRAGTSAEFVGLCPLHRET
Ga0126371_1094161923300021560Tropical Forest SoilMARDVERLKERMSLLEYLQRYNWKPCRAGSRQELVGLCPLHH
Ga0126371_1215215613300021560Tropical Forest SoilMEEDLERLKQRLPLLEYLQQHHWTPCRTGPRQEFVGL
Ga0224553_105441323300022875SoilMAENLERLKQRIPLLEYLQRHNWKPCRASSREEFVVLCPL
Ga0208193_108576713300025463PeatlandMDPVLEQLKQHLPMLEYLQRHNWKPRRRSARQEFVGL
Ga0207646_1116276423300025922Corn, Switchgrass And Miscanthus RhizosphereMSEDLERLKQRVPLLEYLQRHHWRGHRVGAGHEFAGLCPLHDDTH
Ga0207700_1066209223300025928Corn, Switchgrass And Miscanthus RhizosphereMGEDLERLKQRVPLLEYLQRHHWRGHRVGAGHEFAGLCPLHEDTHP
Ga0207661_1212184113300025944Corn RhizosphereMAEYLERLKQRIPLLEYLQRHNWKPCRAGARQEFVGLCP
Ga0207651_1092501013300025960Switchgrass RhizosphereMREDLEQLKQRISLLEYLQRCNWRSRRVGVRQEFVGLCPLHAETRP
Ga0207702_1188896413300026078Corn RhizosphereMGEDLERLKQRLPLLEYLQRHNWNAHPAGSAQEFVGLCPLH
Ga0209472_113089733300026323SoilMGKDLEHLKQRFPLLEYLQRHHWTGHPVGKGSEFV
Ga0209802_120828723300026328SoilMTDELEYLKQHFPLLDYLQQRNWTARRVGAHLEFVGLCPLHPD
Ga0257177_106637023300026480SoilMREDLEQLKQRIPLLQYLQRRHWTGCRVAAREEFVG
Ga0209378_128813523300026528SoilMAAMGEDWERLKQRIPLLEYLQRHHWTGHRADARSQF
Ga0209807_132556123300026530SoilMAAMGEDWERLKQRIPLLEYLQRHHWTGHRADARSQFVGLCP
Ga0179593_116211143300026555Vadose Zone SoilMSEDLEQLKQRLPLLKYLQRHNWTGNPVGASGEFVGLC
Ga0209117_118340813300027645Forest SoilMDADLAELKRRVPLLEYLQRRHWQAQRVGTQQEFVGLCPLH
Ga0209689_135334713300027748SoilMTDELEYLKQRIPLLDYLQQRNWTARRVGAHLEFVGL
Ga0209039_1004354613300027825Bog Forest SoilMPHPIDTEALQDLKQRIPLLDYLQQRHWAGRRVGGRAEFV
Ga0209580_1013775013300027842Surface SoilMAENLERLKQRVPLLEYLQRHNWKPCRTGSRQEFVGLCP
Ga0209067_1022754723300027898WatershedsMAENLERLKQRIPLLEYLQRHNWKPCRAGTRQEFVGLCHLHQET
Ga0209698_1104327323300027911WatershedsMSEDLEQLKQRLPLLEYLQRHNWTGNHVGAGDEFVGLCPLHPD
(restricted) Ga0233417_1054138213300028043SedimentMQHDLQHLKQRLPLLQYLRRLNWTARPIGSHHEFV
Ga0302228_1036573123300028808PalsaMGENLERLKQRVSLLEYLQRHNWKPCRTGSRQEFVGL
Ga0308309_1066208113300028906SoilVSENLEHLKQRIPLLEYLQRHNWSAHPAGAAQEFVGLCPLHRDSR
Ga0311363_1010245683300029922FenMGMDLERLKHCIPLLEYLQQHNWTARSAGISQEFAGLCQLHRDTRPS
Ga0311342_1095798523300029955BogMDPDLEQLKQHLPMLEYLQRHNWTPRRRNARQEFV
Ga0302177_1010269643300030053PalsaMGEDAERIKQRIPLLEYLQRHNWTAQRTGARQELVGLC
Ga0302184_1030747723300030490PalsaVDPDLERLKQHLPLLEYLQRHNWTPRRRSARQEFVGL
Ga0170824_10155751213300031231Forest SoilMTNDLERLKHRISLLEYLQRHNWKPCRAGTRQELVGLSPL
Ga0170820_1018604513300031446Forest SoilMTNDLERLKHRISLLEYLQRHNWKPCRAGTRQELVGLCPLHQET
Ga0302326_1242282413300031525PalsaMDLERLKHCIPLLEYLQQHNWTARSTGISQEFAGLCPLHR
Ga0318516_1038002913300031543SoilMSKDLERLKQHFPLLEYLQRHHWTGRPVGNGSEFVGLCPLHEE
Ga0318516_1084403123300031543SoilMGKDLERLKQHFPLLEYLQRHHWTGRPVGNGSEFVGLCPLHEE
Ga0318538_1077219013300031546SoilMGKDLERLKQHFPLLEYLQRHHWTGRPVGNGSEFVGLCPLHEEDHPS
Ga0318573_1065319223300031564SoilMREDLEQLKQRFSLLEYLQRRNWTARRVGTRQEFV
Ga0318515_1050176223300031572SoilMGKDLERLKQHFPLLEYLQRHHWTGRPVGNGSEFVGLCPLH
Ga0310915_1039818823300031573SoilMGKDLERLKQHFPLLEYLQRHHWTGRPVGNGSEFVGL
Ga0318555_1061534623300031640SoilMGKDLERLKQHFPLLEYLQRHHWSGRPVGNGSEFVGLCPLH
Ga0318542_1049942813300031668SoilMGKDSERLKQHFPLLEYLQRLHWTGRPVGNGSEFVGLCPLHEENH
Ga0318574_1065741923300031680SoilMAGDLEQLKQRIPLLTYLQRHHWSGRPTAVRSEIVGLCP
Ga0318574_1086449313300031680SoilMGEDLEQLKQRIPLLTYLQRHHWSGRPAAVRSEFV
Ga0318560_1035042913300031682SoilMGKDLERLKQHFPLLEYLQRHHWTGRPVGNGSEFVGLCPLHEENHP
Ga0318560_1042099623300031682SoilMAGDLEQLKQRIPLLTYLQRHHWSGRPTAVRSEIVGLC
Ga0315291_1068944013300031707SedimentMDEDLERLKRRIPLLEYLQRHNWTARRVGAQPEFVGL
Ga0307476_1102998013300031715Hardwood Forest SoilVHEDLEQLKQSIPLLEYLQRHRWTGCRVAAREEFVGL
Ga0318493_1056848513300031723SoilMVKDLEWLKQCIPLLEYLQRHNWRPCRAGSRQEFIGLC
Ga0318493_1061918713300031723SoilMKEDLERLKQRLPLLEYLQQHHWTPCRTGPRQELVGL
Ga0318500_1017647613300031724SoilMGEDLERLKRRIPLLQYLQHHHWSGRPAGAHSEFVGLCPLHED
Ga0318502_1017943823300031747SoilMGEDLERLKQRMPLLEYLQRHHWSGRPAGARSEFVGLCPLHAET
Ga0318492_1032112513300031748SoilMSKDLERLKQHFPLLEYLQRHHWTGRPVGNGSEFVGLCPLH
Ga0307475_1010570233300031754Hardwood Forest SoilMGEDLERLKRRVPLLEYLNRHHWKGHRVSTGPEFVGLCPLHEETHASFYVN
Ga0318509_1022102423300031768SoilMKEDLERLKQRLPLLEYLQQHHWTACRTGPRQELVG
Ga0318509_1027187113300031768SoilMKEDLERLKQRLPLLEYLQQHHWTACRTGPRQEWVG
Ga0318509_1037708223300031768SoilMGKDLERLKQHFPLLEYLQRHHWTGRPVGNGSEFVGLCPLHEEN
Ga0318508_123709623300031780SoilMGEDLERLKQRVPLLQYLNRHQWTGHRVGTSPEFVGLCPLHEETHP
Ga0318547_1052836513300031781SoilMGKDSERLKQHFPLLEYLQRLHWTGRPVGNGSEFVGLCPLHEE
Ga0318529_1019472213300031792SoilMGKDLERLKQHFPLLEYLQRHHWTGRPVGNGSEFVGLCPL
Ga0318548_1035203323300031793SoilMGEDLERLKRRVPLLEYLNRHHWKGHRVSTGPEFLGLCPLHEETHASFYVNTQ
Ga0310917_1099790913300031833SoilMCPDVESLKQRIPLLEYLQRQNWSARPVGTHSEYVGLCPLHAE
Ga0318511_1022652613300031845SoilMSKDLERLKQHFPLLEYLQRHHWTGRPVGNGSEFVGLC
Ga0318512_1035684523300031846SoilMGKDLERLKQHFPLLEYLQRHHWTGRPVGNGSEFVGLC
Ga0306925_1140376123300031890SoilMSKDLERLKQHFPLLEYLQRHHWTGRPVGNGSEFVGLCPLHE
Ga0302322_10127017113300031902FenMAENLERLKQRVPLLEYLQRHNWKPCRTGSRQEFVGLCPL
Ga0306921_1090487823300031912SoilMKEDLERLKQRLPLLEYLQQHHWTSCRTGSRQELVGLCP
Ga0306921_1152521723300031912SoilVSGDLDRFKEHIPLLEYLQRHNWRGHRAGTGPEFVGL
Ga0310912_1052198813300031941SoilMVEELERLKDSIPLLEYLQRHNWKPCRAGSRQEWVG
Ga0310916_1131698323300031942SoilMAENLERLKQRIPLLEYLQRHNWKPCRAGARQEFVGLCPL
Ga0310913_1058045913300031945SoilMAGDLEQLKQRIPLLTYLQRHHWSGRPAAVRSEFVGLCP
Ga0306926_1120481623300031954SoilMGKDLEQLKHRFPLLEFLQQHHWTGRPVGNGSEFVGLCPLHEETHPSFY
Ga0318569_1006080723300032010SoilMSKDLEQLKHRFPLLEYLQRHHWTGRPVGNGSEFVGLCPLHEETHPSFY
Ga0318558_1041458523300032044SoilMSKDLERLKQHFPLLEYLQRHHWTGRPVGNGSEFVG
Ga0318558_1042082723300032044SoilMREDLEQLKQRFSLLEYLQRRNWTARRVGTRQEFVGLC
Ga0318570_1058099623300032054SoilMKEDLERLKQRLPLLEYLQQHHWTWCRTGPRQEWDRTVSLT
Ga0318533_1049340223300032059SoilVSEDLDRFKEHIPLLEYLQRHHWRGHRAGMGPEFVGLCPL
Ga0318533_1124586023300032059SoilMAENLERLKQRIPLLEYLQRHNWKPCRAGAQQEFVG
Ga0318504_1050992313300032063SoilMKEDLERLKQRLPLLEYLQQHHWTSCRTGPRQEWVG
Ga0318525_1047193123300032089SoilMGKDLERLKQHFPLLEYLQRHHWTGRPVGNGSEFVGLCPLHEEDHPSFY
Ga0318525_1066767713300032089SoilMGKDLESLKQHFPLVEYLQRHHWTGHPVGNGSELVGLC
Ga0318518_1068347813300032090SoilMGEDLERLKRRIPLLQYLQHHHWSGRPAGAHSEFVGLC
Ga0318540_1057444313300032094SoilMGEDLDQLKQRIPLLTYLQRHHWSGRPAAVRSEFV
Ga0315277_1072898123300032118SedimentMQHDELQYLKQRVTLLDYLRRRNWTARQIGSHKEFVGLCPLHPESRP
Ga0315295_1220949723300032156SedimentMGEDVERLKQRIPLLEYLQRHNWTARRAGPRQEFVGLCPL
Ga0315268_1170775223300032173SedimentMSEDLERLKQRIPLLEYLQRHNWKPCRAGSRQEFVGLCPL
Ga0307471_10104501013300032180Hardwood Forest SoilMADMGQDLERLKQRIPLLDYLQRHHWTGHRAGAARE
Ga0307471_10247236213300032180Hardwood Forest SoilMRKDVEQLKHHISLLQYLQQRHWRAHRVTEREEFVGLC
Ga0307472_10088423523300032205Hardwood Forest SoilMGEDLERLKQRVPLLEFLQRHHWRGYRVGAGPEFAGFC
Ga0316191_1121509023300032258Worm BurrowMAENLERLKQRLPLVEYLRRHHWTPRRRGGRQELVG
Ga0315275_1138414613300032401SedimentVGEDVKRLKQRIPLLEYLQRHNWTVRRAGPRQEFVG
Ga0335079_1051474913300032783SoilMAENLERLKQRIPLLEYLQRHNWKPCRAGTRQEFVGLC
Ga0335078_1024431413300032805SoilMAENLERLKQRIPLLEYLQRHNWKPCRAGARQEFVG
Ga0335080_1000817513300032828SoilMRENLELLKQRIPLLEYLQQHYWRGHRVGAGPEFAGLCPLHEDTH
Ga0335077_1047595313300033158SoilMSEDLEQLKQRMPLLEYLRRRHWTGCRVGTREEFVGLCPLHLDT
Ga0318519_1056262513300033290SoilMGEDLERLKQRVPLLQYLNRHQWTGHRVGTSPEFVGLCPLHE
Ga0316630_1177753923300033487SoilMNHDLQSLKERIPLLDYLRRHDWTARPIGAHQEFVGLCPLHP
Ga0371488_0195346_903_10223300033983Peat SoilMDLERLKQRISLLEYLQHHNWTARPAGASQEFVGLCPLHR
Ga0370514_184432_2_1213300034199Untreated Peat SoilMGENLERLKQRVSLLEYLQRHNWKPCRTGSRQEFVGLCPL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.