| Basic Information | |
|---|---|
| Family ID | F042544 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 158 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MRRFPAPWTVEQIPGGYKVLDANGQSLAYVYGRETKADA |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 158 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 30.00 % |
| % of genes near scaffold ends (potentially truncated) | 81.01 % |
| % of genes from short scaffolds (< 2000 bps) | 91.77 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (57.595 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.392 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.152 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.165 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.48% β-sheet: 23.88% Coil/Unstructured: 71.64% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 158 Family Scaffolds |
|---|---|---|
| PF09538 | FYDLN_acid | 1.90 |
| PF00582 | Usp | 1.27 |
| PF00275 | EPSP_synthase | 1.27 |
| PF09361 | Phasin_2 | 1.27 |
| PF03350 | UPF0114 | 0.63 |
| PF03466 | LysR_substrate | 0.63 |
| PF03625 | DUF302 | 0.63 |
| PF10576 | EndIII_4Fe-2S | 0.63 |
| PF01068 | DNA_ligase_A_M | 0.63 |
| PF13442 | Cytochrome_CBB3 | 0.63 |
| PF14248 | DUF4345 | 0.63 |
| PF05448 | AXE1 | 0.63 |
| PF02735 | Ku | 0.63 |
| PF02796 | HTH_7 | 0.63 |
| PF06041 | DUF924 | 0.63 |
| PF00528 | BPD_transp_1 | 0.63 |
| PF06347 | SH3_4 | 0.63 |
| PF02780 | Transketolase_C | 0.63 |
| PF00589 | Phage_integrase | 0.63 |
| PF05656 | DUF805 | 0.63 |
| PF13396 | PLDc_N | 0.63 |
| PF13239 | 2TM | 0.63 |
| PF13439 | Glyco_transf_4 | 0.63 |
| PF13561 | adh_short_C2 | 0.63 |
| PF05532 | CsbD | 0.63 |
| COG ID | Name | Functional Category | % Frequency in 158 Family Scaffolds |
|---|---|---|---|
| COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 0.63 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.63 |
| COG1506 | Dipeptidyl aminopeptidase/acylaminoacyl peptidase | Amino acid transport and metabolism [E] | 0.63 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.63 |
| COG2862 | Uncharacterized membrane protein YqhA | Function unknown [S] | 0.63 |
| COG3152 | Uncharacterized membrane protein YhaH, DUF805 family | Function unknown [S] | 0.63 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.63 |
| COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 0.63 |
| COG3458 | Cephalosporin-C deacetylase or related acetyl esterase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.63 |
| COG3803 | Uncharacterized conserved protein, DUF924 family | Function unknown [S] | 0.63 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 57.59 % |
| All Organisms | root | All Organisms | 42.41 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459002|F0B48LX02G9YMD | Not Available | 513 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104294892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 644 | Open in IMG/M |
| 3300000886|AL3A1W_1014041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1070 | Open in IMG/M |
| 3300000955|JGI1027J12803_106236167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1163 | Open in IMG/M |
| 3300001991|JGI24743J22301_10145783 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
| 3300002077|JGI24744J21845_10052798 | Not Available | 748 | Open in IMG/M |
| 3300002239|JGI24034J26672_10011965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1304 | Open in IMG/M |
| 3300004157|Ga0062590_100907369 | Not Available | 826 | Open in IMG/M |
| 3300004463|Ga0063356_105774847 | Not Available | 531 | Open in IMG/M |
| 3300004479|Ga0062595_100381140 | Not Available | 999 | Open in IMG/M |
| 3300004798|Ga0058859_11812887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 985 | Open in IMG/M |
| 3300004803|Ga0058862_12633043 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
| 3300005093|Ga0062594_100621253 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 953 | Open in IMG/M |
| 3300005093|Ga0062594_102593677 | Not Available | 559 | Open in IMG/M |
| 3300005332|Ga0066388_101152186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1319 | Open in IMG/M |
| 3300005332|Ga0066388_101561767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1158 | Open in IMG/M |
| 3300005332|Ga0066388_101897844 | Not Available | 1063 | Open in IMG/M |
| 3300005332|Ga0066388_102018761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Tistrella → Tistrella mobilis | 1034 | Open in IMG/M |
| 3300005332|Ga0066388_102362745 | Not Available | 963 | Open in IMG/M |
| 3300005332|Ga0066388_103067761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 853 | Open in IMG/M |
| 3300005332|Ga0066388_107435142 | Not Available | 550 | Open in IMG/M |
| 3300005332|Ga0066388_107588290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 544 | Open in IMG/M |
| 3300005347|Ga0070668_100184101 | Not Available | 1708 | Open in IMG/M |
| 3300005347|Ga0070668_100790347 | Not Available | 842 | Open in IMG/M |
| 3300005364|Ga0070673_100072991 | Not Available | 2761 | Open in IMG/M |
| 3300005439|Ga0070711_101146864 | Not Available | 671 | Open in IMG/M |
| 3300005440|Ga0070705_100152149 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1536 | Open in IMG/M |
| 3300005536|Ga0070697_101728231 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 560 | Open in IMG/M |
| 3300005548|Ga0070665_101736680 | Not Available | 631 | Open in IMG/M |
| 3300005713|Ga0066905_100952072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 754 | Open in IMG/M |
| 3300005713|Ga0066905_101221627 | Not Available | 673 | Open in IMG/M |
| 3300005764|Ga0066903_102312349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1038 | Open in IMG/M |
| 3300005764|Ga0066903_104224804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 768 | Open in IMG/M |
| 3300005764|Ga0066903_105640877 | Not Available | 659 | Open in IMG/M |
| 3300005764|Ga0066903_106593536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 604 | Open in IMG/M |
| 3300005764|Ga0066903_107313395 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 571 | Open in IMG/M |
| 3300005764|Ga0066903_108702169 | Not Available | 516 | Open in IMG/M |
| 3300005841|Ga0068863_102233000 | Not Available | 557 | Open in IMG/M |
| 3300005843|Ga0068860_101246653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 764 | Open in IMG/M |
| 3300005844|Ga0068862_102348728 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300006049|Ga0075417_10007780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3809 | Open in IMG/M |
| 3300006172|Ga0075018_10092419 | Not Available | 1330 | Open in IMG/M |
| 3300006175|Ga0070712_101015289 | Not Available | 718 | Open in IMG/M |
| 3300006237|Ga0097621_101415968 | Not Available | 658 | Open in IMG/M |
| 3300006845|Ga0075421_102034016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 611 | Open in IMG/M |
| 3300006847|Ga0075431_100966188 | Not Available | 820 | Open in IMG/M |
| 3300006854|Ga0075425_101052412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 928 | Open in IMG/M |
| 3300006854|Ga0075425_101609419 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 732 | Open in IMG/M |
| 3300006854|Ga0075425_102521666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 569 | Open in IMG/M |
| 3300006871|Ga0075434_101451436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 696 | Open in IMG/M |
| 3300006904|Ga0075424_100145194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 2513 | Open in IMG/M |
| 3300006904|Ga0075424_101511190 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 713 | Open in IMG/M |
| 3300006954|Ga0079219_10046620 | Not Available | 1838 | Open in IMG/M |
| 3300009093|Ga0105240_11730135 | Not Available | 652 | Open in IMG/M |
| 3300009094|Ga0111539_10919977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1017 | Open in IMG/M |
| 3300009101|Ga0105247_10067929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2222 | Open in IMG/M |
| 3300009148|Ga0105243_10206848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1725 | Open in IMG/M |
| 3300009162|Ga0075423_10886874 | Not Available | 945 | Open in IMG/M |
| 3300009166|Ga0105100_10628847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 659 | Open in IMG/M |
| 3300009551|Ga0105238_10593758 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1115 | Open in IMG/M |
| 3300010048|Ga0126373_12482744 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 577 | Open in IMG/M |
| 3300010358|Ga0126370_12249184 | Not Available | 538 | Open in IMG/M |
| 3300010359|Ga0126376_11706649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 665 | Open in IMG/M |
| 3300010366|Ga0126379_10188541 | Not Available | 1970 | Open in IMG/M |
| 3300010371|Ga0134125_12655794 | Not Available | 544 | Open in IMG/M |
| 3300010373|Ga0134128_10323310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1725 | Open in IMG/M |
| 3300010376|Ga0126381_100982160 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1218 | Open in IMG/M |
| 3300010379|Ga0136449_100961491 | Not Available | 1381 | Open in IMG/M |
| 3300010379|Ga0136449_103230314 | Not Available | 629 | Open in IMG/M |
| 3300010396|Ga0134126_12052730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 625 | Open in IMG/M |
| 3300012362|Ga0137361_10744523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 894 | Open in IMG/M |
| 3300012899|Ga0157299_10127839 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300012903|Ga0157289_10288032 | Not Available | 575 | Open in IMG/M |
| 3300012907|Ga0157283_10019729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1261 | Open in IMG/M |
| 3300012908|Ga0157286_10097805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 856 | Open in IMG/M |
| 3300012951|Ga0164300_10222653 | Not Available | 939 | Open in IMG/M |
| 3300012951|Ga0164300_10326960 | Not Available | 813 | Open in IMG/M |
| 3300012957|Ga0164303_10078207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1569 | Open in IMG/M |
| 3300012957|Ga0164303_10782763 | Not Available | 654 | Open in IMG/M |
| 3300012960|Ga0164301_11124966 | Not Available | 626 | Open in IMG/M |
| 3300012960|Ga0164301_11149343 | Not Available | 620 | Open in IMG/M |
| 3300012960|Ga0164301_11847063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 509 | Open in IMG/M |
| 3300012971|Ga0126369_10525098 | Not Available | 1245 | Open in IMG/M |
| 3300012971|Ga0126369_11935303 | Not Available | 678 | Open in IMG/M |
| 3300012989|Ga0164305_10332568 | Not Available | 1136 | Open in IMG/M |
| 3300013096|Ga0157307_1070422 | Not Available | 692 | Open in IMG/M |
| 3300013105|Ga0157369_11081518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter methanicus | 820 | Open in IMG/M |
| 3300013297|Ga0157378_10643699 | Not Available | 1075 | Open in IMG/M |
| 3300013764|Ga0120111_1103309 | Not Available | 671 | Open in IMG/M |
| 3300014969|Ga0157376_12665052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 540 | Open in IMG/M |
| 3300015077|Ga0173483_10072450 | Not Available | 1372 | Open in IMG/M |
| 3300015077|Ga0173483_10554752 | Not Available | 623 | Open in IMG/M |
| 3300015371|Ga0132258_12608356 | Not Available | 1262 | Open in IMG/M |
| 3300016294|Ga0182041_10670682 | Not Available | 917 | Open in IMG/M |
| 3300016319|Ga0182033_10288071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloligella | 1350 | Open in IMG/M |
| 3300016319|Ga0182033_10667989 | Not Available | 908 | Open in IMG/M |
| 3300016357|Ga0182032_11728241 | Not Available | 546 | Open in IMG/M |
| 3300016371|Ga0182034_10113066 | Not Available | 1973 | Open in IMG/M |
| 3300016371|Ga0182034_11736934 | Not Available | 549 | Open in IMG/M |
| 3300016445|Ga0182038_10223381 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
| 3300017792|Ga0163161_10948422 | Not Available | 732 | Open in IMG/M |
| 3300017961|Ga0187778_10086534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter | 1938 | Open in IMG/M |
| 3300017995|Ga0187816_10120377 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300018014|Ga0187860_1313209 | Not Available | 605 | Open in IMG/M |
| 3300018058|Ga0187766_10041210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter | 2701 | Open in IMG/M |
| 3300018081|Ga0184625_10143581 | Not Available | 1246 | Open in IMG/M |
| 3300020078|Ga0206352_10831567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 985 | Open in IMG/M |
| 3300021078|Ga0210381_10411866 | Not Available | 501 | Open in IMG/M |
| 3300021560|Ga0126371_10720849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 1145 | Open in IMG/M |
| 3300021560|Ga0126371_11700613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 755 | Open in IMG/M |
| 3300022220|Ga0224513_10485716 | Not Available | 504 | Open in IMG/M |
| 3300022467|Ga0224712_10146874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1042 | Open in IMG/M |
| 3300023102|Ga0247754_1098597 | Not Available | 705 | Open in IMG/M |
| 3300025917|Ga0207660_10936988 | Not Available | 707 | Open in IMG/M |
| 3300025919|Ga0207657_10328297 | Not Available | 1209 | Open in IMG/M |
| 3300025920|Ga0207649_10260208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1254 | Open in IMG/M |
| 3300025932|Ga0207690_11467960 | Not Available | 570 | Open in IMG/M |
| 3300025960|Ga0207651_10476167 | Not Available | 1075 | Open in IMG/M |
| 3300025961|Ga0207712_11300309 | Not Available | 650 | Open in IMG/M |
| 3300025986|Ga0207658_12136333 | Not Available | 509 | Open in IMG/M |
| 3300026088|Ga0207641_11961216 | Not Available | 587 | Open in IMG/M |
| 3300026118|Ga0207675_100191348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1962 | Open in IMG/M |
| 3300026118|Ga0207675_101627935 | Not Available | 666 | Open in IMG/M |
| 3300027662|Ga0208565_1153720 | Not Available | 670 | Open in IMG/M |
| 3300028587|Ga0247828_10756670 | Not Available | 611 | Open in IMG/M |
| 3300028587|Ga0247828_10876094 | Not Available | 576 | Open in IMG/M |
| 3300028592|Ga0247822_11080536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 665 | Open in IMG/M |
| 3300028592|Ga0247822_11499149 | Not Available | 570 | Open in IMG/M |
| 3300028791|Ga0307290_10154180 | Not Available | 842 | Open in IMG/M |
| 3300031226|Ga0307497_10165565 | Not Available | 931 | Open in IMG/M |
| 3300031226|Ga0307497_10373666 | Not Available | 674 | Open in IMG/M |
| 3300031573|Ga0310915_10472299 | Not Available | 891 | Open in IMG/M |
| 3300031573|Ga0310915_11158929 | Not Available | 536 | Open in IMG/M |
| 3300031640|Ga0318555_10824110 | Not Available | 501 | Open in IMG/M |
| 3300031719|Ga0306917_10168001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1641 | Open in IMG/M |
| 3300031740|Ga0307468_100096063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1745 | Open in IMG/M |
| 3300031744|Ga0306918_10356241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. | 1136 | Open in IMG/M |
| 3300031854|Ga0310904_10578869 | Not Available | 763 | Open in IMG/M |
| 3300031890|Ga0306925_11332100 | Not Available | 712 | Open in IMG/M |
| 3300031910|Ga0306923_10364947 | Not Available | 1646 | Open in IMG/M |
| 3300031910|Ga0306923_10880085 | Not Available | 983 | Open in IMG/M |
| 3300031912|Ga0306921_10298472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 1887 | Open in IMG/M |
| 3300031912|Ga0306921_11439280 | Not Available | 756 | Open in IMG/M |
| 3300031942|Ga0310916_11220033 | Not Available | 621 | Open in IMG/M |
| 3300031946|Ga0310910_10848855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 718 | Open in IMG/M |
| 3300031952|Ga0315294_11201609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 615 | Open in IMG/M |
| 3300031954|Ga0306926_12488867 | Not Available | 568 | Open in IMG/M |
| 3300032075|Ga0310890_10806184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 744 | Open in IMG/M |
| 3300032076|Ga0306924_11937651 | Not Available | 609 | Open in IMG/M |
| 3300032261|Ga0306920_101604613 | Not Available | 925 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.39% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 10.13% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.16% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.53% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.90% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.90% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.27% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.27% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.27% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.27% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 1.27% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.27% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.27% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.27% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.27% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.63% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.63% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.63% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.63% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.63% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.63% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.63% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.63% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.63% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.63% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.63% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.63% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.63% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.63% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.63% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.63% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000886 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-65cm-3A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
| 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Host-Associated | Open in IMG/M |
| 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022220 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300023102 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5 | Environmental | Open in IMG/M |
| 3300025766 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-three (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E1_09011340 | 2170459002 | Grass Soil | RRYPVPWTVETIPGGLKVCDANGQSLADVYSRENPKDAHMAKVLNED |
| INPhiseqgaiiFebDRAFT_1042948921 | 3300000364 | Soil | MAARRFPPPWTVEQIPGGFKVLDANNQSLAYVYGRE |
| AL3A1W_10140413 | 3300000886 | Permafrost | MPEQKTRRFPPPWSSEQIPGGYVVKDATGQSLAYVYGRENRADADTAK |
| JGI1027J12803_1062361671 | 3300000955 | Soil | MRRCPPPWTVEKIPGGFKVLDANGQSLAYVYLRETKANA |
| JGI24743J22301_101457832 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | MPEDRTRRFPPPWTVEQIAGGYKVKDANGQSLTYVYGRETQADADI |
| JGI24744J21845_100527981 | 3300002077 | Corn, Switchgrass And Miscanthus Rhizosphere | MTQRRFPPPWRVEEITAGYVVKNANGQSLAYVYGRETRADADT |
| JGI24034J26672_100119651 | 3300002239 | Corn, Switchgrass And Miscanthus Rhizosphere | MPEDRTRRFPPPWTVEQIAGGYKVKDANGQSLTYVYGRET |
| Ga0062593_1019229792 | 3300004114 | Soil | VCLLRRFPPPWFIEKIPGGLKVCDANGQSLAYVCSRENPNDADMAKVLT* |
| Ga0062590_1009073692 | 3300004157 | Soil | MRRFPPPWTVEKIPGGFKVIIAYVYSRDNDSDALIANVLTTDEAR |
| Ga0063356_1057748471 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MRRFPPPWTVEKIAGGFKVCDANGQSLAYVYSSENPNDAFMR |
| Ga0062595_1003811401 | 3300004479 | Soil | MSDSSELDEGHRRFPPPWTVEPIQVKDANGQSLAYVYGRET |
| Ga0058859_118128871 | 3300004798 | Host-Associated | MPEDRTRRFPPPWTVEQIAGGYKVKDANGQSLTYVYGRETQADAD |
| Ga0058862_126330431 | 3300004803 | Host-Associated | MPEDRTRRFPPPWTVEQIAGGYKVKDANGQSLTYVYGRETQADADIA |
| Ga0062594_1006212532 | 3300005093 | Soil | MRRFPAPWTVEKIPGGFKVIDANGQSLAYVYGRETKADADIAKC* |
| Ga0062594_1025936772 | 3300005093 | Soil | MRRFPAPWTVEKIPGGFKVIDANGQSLAYVYSRDNPNDAK* |
| Ga0066388_1011521861 | 3300005332 | Tropical Forest Soil | VRRFPAPWTVEQIPGGYKVLDASGQSLAYVYGRETKADAARC* |
| Ga0066388_1015617672 | 3300005332 | Tropical Forest Soil | MSEQHTRRFPPPWTVEPIERGFKVVDANKQSIAYVYGRETKAGADYRAWALLMVP* |
| Ga0066388_1018978442 | 3300005332 | Tropical Forest Soil | MTRGRFPPSWTVEQIPGGYKVIDANGQPLAYVYGRETKADAD |
| Ga0066388_1020187611 | 3300005332 | Tropical Forest Soil | KRFPAPWSIEQIPGGYKVKDANGQSLAYVYGRETKADAE* |
| Ga0066388_1023627453 | 3300005332 | Tropical Forest Soil | MTRGRFPPPWTVERIPGGYKVKDANGQSLAYVYRRETSGC* |
| Ga0066388_1030677611 | 3300005332 | Tropical Forest Soil | MLEQNTRCFPPPWTVEQIPGGFKVKDANGQSLAYIYGRESRAD |
| Ga0066388_1074351421 | 3300005332 | Tropical Forest Soil | VRRFSAPWTVEQIPGGYKVKDANRQSLAYVYGRETKADADT |
| Ga0066388_1075882903 | 3300005332 | Tropical Forest Soil | MARRFPPPWIVEKIPGGFKVLDANGHSLAYVYSCETKEAAN |
| Ga0070668_1001841014 | 3300005347 | Switchgrass Rhizosphere | RFPAPWTVEKIPGGFKVIDANGQSLAYVYGRETKADADIAKC* |
| Ga0070668_1007903471 | 3300005347 | Switchgrass Rhizosphere | MATDRHFPPPWTVEQIAAAYKVKDATGQALAYIYGREARA |
| Ga0070674_1010756232 | 3300005356 | Miscanthus Rhizosphere | SIGFNRRSVCLLRRFPPPWFIEKIPGGLKVCDANGQSLAYVCSRENPNDADMAKVLT* |
| Ga0070674_1014741972 | 3300005356 | Miscanthus Rhizosphere | MSDSSELDEGHRRFPPPWTVEPIQVKDANGQSLAYVYGRETRAAADIAHVLS* |
| Ga0070673_1000729918 | 3300005364 | Switchgrass Rhizosphere | MPEQSTRRFPPPWSVEQIPGGYKVKDAHGQSLVYVYGREI |
| Ga0070711_1011468641 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LTIARKLPTSWKAERIPGGYVVKDATSQSLAYVYAGETKADADTPLPNV |
| Ga0070705_1001521491 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRFPPPWTVEKIPGGFKVIDANGQSLAYVYGRETKADADIAKC* |
| Ga0070697_1017282311 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRFPPPWTVKTIPGGLKVCDANGQSLAYVYLREKPSDAHIGS |
| Ga0070665_1017366802 | 3300005548 | Switchgrass Rhizosphere | MSDSSELDEGHRRFPPPWTVEPIQVKDANGQSLAYVYGRETQA |
| Ga0066905_1009520721 | 3300005713 | Tropical Forest Soil | MRRFPAPWTVEKIAGGFKVCDANGQSLAYVYSSENPNDAFMR |
| Ga0066905_1012216271 | 3300005713 | Tropical Forest Soil | MTEQNIRRFPPPWTVEQIPGGYKVNDANGQSVAYVYGR |
| Ga0066903_1023123491 | 3300005764 | Tropical Forest Soil | RRFPPPWTVEQIPGGFNVKDATGQPLAYVYGRRQKPMPT* |
| Ga0066903_1042248043 | 3300005764 | Tropical Forest Soil | VNALKQKRFPAPWSIEQIPGGYKVKDANGQSLAYVYGRETKADAE* |
| Ga0066903_1056408772 | 3300005764 | Tropical Forest Soil | LLLFPPPWSVEQIPGGYNEGANGQSLAYVYGRET* |
| Ga0066903_1065935362 | 3300005764 | Tropical Forest Soil | PMRRFPPPWTVEQIPGGFKVLDATGQSLAYVYGCETKADARMC* |
| Ga0066903_1073133952 | 3300005764 | Tropical Forest Soil | MRRFPPPWTVEQIPGGYKILDANGQSLAYVYGRETKADAD |
| Ga0066903_1087021691 | 3300005764 | Tropical Forest Soil | MRRFPPPWTVEKIPGGYKVKDANGQSLAYVYGRETKADADI |
| Ga0068863_1022330001 | 3300005841 | Switchgrass Rhizosphere | MRRFPAPWTVEKIPGGFKVIDANGQSLAYVYSRDN |
| Ga0068860_1012466531 | 3300005843 | Switchgrass Rhizosphere | MSDSSELDEGHRRFPPPWTVEPIQVKDANGQSLAYVYGR* |
| Ga0068862_1023487282 | 3300005844 | Switchgrass Rhizosphere | MTQRNDRTRLSPPWSVEKIPGGLKGRDANGQSLAYVYSRENPNDA |
| Ga0075417_100077801 | 3300006049 | Populus Rhizosphere | MPEQNTRRFPPPWTVEQIPATYKVKDTNGRSLAYVYGRETRADADTAH |
| Ga0075017_1016868331 | 3300006059 | Watersheds | MTERRFPPPWTVVKIPGGLKVCDANGQSLAYIYSRETPADAITAHVLTE |
| Ga0075018_100924193 | 3300006172 | Watersheds | MRRFPPPWTVETIPGGFKVIDANGQSLAYVYSRETRQT* |
| Ga0070712_1010152891 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRRFPPPWTGEEIPGGFKVIDANGQSLAYCYGRETQADADI |
| Ga0097621_1010915982 | 3300006237 | Miscanthus Rhizosphere | MSDSSELDEGHRRFPPPWTVEPIQVKDANGQSLAYVYGRETQADADIAHVLTMDETGREGT* |
| Ga0097621_1014159681 | 3300006237 | Miscanthus Rhizosphere | MRRFPAPWTVEKIPGGFKVIDANGQSLAYVYSRDNPNDA |
| Ga0075421_1020340163 | 3300006845 | Populus Rhizosphere | LRRFPPPWTVEHIPGGYKVKDANGQSLAYVYGRETRAD |
| Ga0075431_1009661881 | 3300006847 | Populus Rhizosphere | MRRFPAPWTVEKIPGGFKLYDANGQSLAYVYARDNPNDAQI |
| Ga0075425_1010524123 | 3300006854 | Populus Rhizosphere | LRRFPPPWTVEHIPGGYKVKDANGQSLAYVYGRET |
| Ga0075425_1016094191 | 3300006854 | Populus Rhizosphere | MRRFPAPWTVEQIPGGYKVLDANGQSLAYVYGRETK |
| Ga0075425_1025216662 | 3300006854 | Populus Rhizosphere | MRRPPPWTVEKMPGGLKVVDAKGQSLAYVYSRENANDAAIAKD* |
| Ga0075434_1014514361 | 3300006871 | Populus Rhizosphere | MPARRFPKPWTVKQIPGGCRIIDASGVAVAYVYGR |
| Ga0075424_1001451941 | 3300006904 | Populus Rhizosphere | MTQRRFPPPWRVEEITAGYVVKNANGQSLAYVYGR |
| Ga0075424_1015111902 | 3300006904 | Populus Rhizosphere | MRRFPAPWTVEQIPGGYKVLDANGQSLAYVYGRETKADA* |
| Ga0079219_100466201 | 3300006954 | Agricultural Soil | PWTVEQIPGGYKVNDANGQSLAYIYGRETQADATSPAF* |
| Ga0105240_117301353 | 3300009093 | Corn Rhizosphere | MATDRCFPPPWTVEQIPGGYKVKDASGQALAYVYGRE |
| Ga0111539_109199773 | 3300009094 | Populus Rhizosphere | MRRFPAPWTVEKIPGGFKVNDANGQSLAYVYGRETRADADIAN |
| Ga0105247_100679294 | 3300009101 | Switchgrass Rhizosphere | MRRFPAPWTVEKIPGGFTVIDANGQSLAYVYSRDNPNDAK* |
| Ga0105243_102068481 | 3300009148 | Miscanthus Rhizosphere | MARRLPAPWTVEKIPGGFKVYDANGQSLAYVYSRDNPNDAK* |
| Ga0075423_108868742 | 3300009162 | Populus Rhizosphere | MSEQGPRQFPPPWTVEEIPGGYKVKDANGQSLAYVYGRETR |
| Ga0105100_106288473 | 3300009166 | Freshwater Sediment | VRRFPAPWTAEQIPGGFNVVDATGQAIAYCYGREKKADADI |
| Ga0105238_105937583 | 3300009551 | Corn Rhizosphere | MRRFPAPWTVEKIPGGFKVIDANGQSLAYVYGRETK |
| Ga0126373_124827442 | 3300010048 | Tropical Forest Soil | PPPWTVEQIPGGFKVVDANGQSLAYVYGRETKADADSA* |
| Ga0126370_122491842 | 3300010358 | Tropical Forest Soil | VNALKQKRFPAPWSIEQIPGGYKVKDANGQSLAYVYARETKADAE* |
| Ga0126376_117066491 | 3300010359 | Tropical Forest Soil | MRRFPAPWTVERVAGGFKVLDANGQSLAYVYSRETKDANK* |
| Ga0126379_101885411 | 3300010366 | Tropical Forest Soil | MRRFAPPWTVEQIPGGYKVKDAYGQSLAYVYGRETKAE |
| Ga0134125_126557941 | 3300010371 | Terrestrial Soil | MRRFPPPWTVEQCAGGYKVLDANGQSLAYVYGYAHPR |
| Ga0134128_103233101 | 3300010373 | Terrestrial Soil | MTGRRFPPPWTIERLAGGFKVVDANGQSLAYVYSRENPNDAHM |
| Ga0126381_1009821601 | 3300010376 | Tropical Forest Soil | MSRRFLPPWTVEQIPGGYKVKDANGQSLACVYGRETRADAWGNP* |
| Ga0136449_1009614911 | 3300010379 | Peatlands Soil | MWSWMRRFPPPWTKIPGGIKVLDANGQSLAYVYSRQDPRE |
| Ga0136449_1032303142 | 3300010379 | Peatlands Soil | MIERRFPPPWTVEKIPGGLKVGDANRQSLAYVYSRENEGDAVIA |
| Ga0134126_120527301 | 3300010396 | Terrestrial Soil | MSERRFPPPWTVETIPGGLKVCDANGQSLAYVYSREN |
| Ga0137361_107445232 | 3300012362 | Vadose Zone Soil | MSDQRTRRFPAPWTAEQIPGGYVVKDATGQALAYVYGRKDKG |
| Ga0157299_101278392 | 3300012899 | Soil | MSDSSELDEGHRRFPPPWTVEPIQVKDANGQSLAYVYG |
| Ga0157289_102880322 | 3300012903 | Soil | MSEQGPRQFPPPWTVEEIPGGYKVNDANGQSLAYVYGRETRAHAD |
| Ga0157283_100197294 | 3300012907 | Soil | MPEDRTRRFPPPWTVEQIAGGYKVKDANGQSLTYVYGR |
| Ga0157286_100978052 | 3300012908 | Soil | MPEQSTRRFPPPWTVEQIPGGYKVKDATGQALAYVYGRETRAEAD |
| Ga0164300_102226531 | 3300012951 | Soil | MTERRFPPPWTVEKIPGGLKVCDANGQSLAYVYSREFAPDFSRTYCV |
| Ga0164300_103269602 | 3300012951 | Soil | MSERRFSPPWSVETIPGGFKVCDANGQSLAYVDSRENAN |
| Ga0164303_100782074 | 3300012957 | Soil | MSERRFPPPWSVETIPGGFKVCDANGQSLAYVYSRENPNDAHMAKV |
| Ga0164303_107827633 | 3300012957 | Soil | MTQRRFPPPWRVEEITAGYVVKNANGQSLAYVYGRE |
| Ga0164301_111249662 | 3300012960 | Soil | MSERRFSPPWSVETIPGGFKVCDANGQSLAYVDSRENANNAHMAKVL |
| Ga0164301_111493431 | 3300012960 | Soil | RRFPPPWTVEKIPGGLKVIDANGQSLAYVYSRENANDAACQSADRG* |
| Ga0164301_118470631 | 3300012960 | Soil | MRRFPAPWSVEKIPAGLVVRDANGQSLAYVYYRENDSDA |
| Ga0126369_105250983 | 3300012971 | Tropical Forest Soil | MAHRRFPPPWTVEQIPGGYKVKDANGQSLGYVYARETKADADI |
| Ga0126369_119353031 | 3300012971 | Tropical Forest Soil | MPRHFPPPWTVEQIPGGYKVRDATGQSLAYVYGRETKADANIAH |
| Ga0164305_103325685 | 3300012989 | Soil | MRRFPVPWTVETIPGGFKVIDANGQSLAYVYSREDAHMAKV |
| Ga0157307_10704223 | 3300013096 | Soil | LPMRRFPAPWTVETIEGGFKVVDANKQVVAYVYVCR* |
| Ga0157369_110815182 | 3300013105 | Corn Rhizosphere | MPEQTTSRFPPPWTVEQIAGGYKVKDANGQSLAYVYGRET |
| Ga0157378_106436991 | 3300013297 | Miscanthus Rhizosphere | MRRFPAPWTVEKIPGGFKVIDVNGQSLAYVYSRDNPNDAK* |
| Ga0120111_11033092 | 3300013764 | Permafrost | MNTRRFPPPWSEQIPGGYVVKEATGQSLAYVYGRETR |
| Ga0157376_126650522 | 3300014969 | Miscanthus Rhizosphere | MPEQNTRRYTAVNSRADAGGYKVKDAHGQSLAYVYGRETRADADTAGVLTLNE |
| Ga0173483_100724501 | 3300015077 | Soil | MSDSSELDEGHRRFPPPWTVEPIQVKDANGQSLAYVYGRETQADAD |
| Ga0173483_105547522 | 3300015077 | Soil | MTQRRFPPPWAVEQIPGGYKVKDANGQSLAYVYGRETRADAD |
| Ga0132258_126083561 | 3300015371 | Arabidopsis Rhizosphere | MATDRCFPPPWTVEQIPGGYKVKDASGQAFAYVYGRETRA |
| Ga0182041_106706821 | 3300016294 | Soil | VVEHRNPPWTVEQIPGGYKVKVATGQSLAYVYGRET |
| Ga0182041_108660192 | 3300016294 | Soil | MQTRFPPPSTVEQIPGGYKVLDANGQSLAYVYARETKA |
| Ga0182033_102880713 | 3300016319 | Soil | MRRFPPPWSAEKIAGGFKVLDANGQSLVYVYSRETKD |
| Ga0182033_106679891 | 3300016319 | Soil | PGGRFFLMPEERTRHFPPPWTVEQIPGGHKVKDATGQSLL |
| Ga0182032_117282411 | 3300016357 | Soil | MRRFPAPWTVEQIPGGYKVLDANGQSLAYQVHGRAAVNV |
| Ga0182034_101130665 | 3300016371 | Soil | MNKTRRMRRFPPPWTVEQIPGGYKVLDANGQSLAYVYVREK |
| Ga0182034_117369341 | 3300016371 | Soil | MRRFPPPWTVEQIPGGYKVKDANGQSLAYVYGRETK |
| Ga0182038_102233812 | 3300016445 | Soil | MVDRARRFPLPWTVEQIRGGYKVLDANGQSLAYVYGRETKADADI |
| Ga0163161_109484222 | 3300017792 | Switchgrass Rhizosphere | MRRFPAPWTVEKIPGGFKVIDANGQSLAYVYSRDNPNDAK |
| Ga0187778_100865343 | 3300017961 | Tropical Peatland | MKTGRRFPPPWTVERIEGGFKVVDANRQSLAYVYSRETERDA |
| Ga0187816_101203774 | 3300017995 | Freshwater Sediment | PMRRFPPPWTVEKIPGGLKVCDANGQSLAYVSSREKPDDARDGKGG |
| Ga0187860_13132092 | 3300018014 | Peatland | MIERRFPPPWTVEKIPGGLKVCDANGQSLAYVYSREN |
| Ga0187766_100412105 | 3300018058 | Tropical Peatland | MKTGRRFPPPWTVERIEGGFKVVDADRQSLAYVYSRETERDA |
| Ga0184625_101435812 | 3300018081 | Groundwater Sediment | MSERKFPPPWSVEKIPDGLKVCDANGQSLAYVYSRENR |
| Ga0206352_108315673 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | MPEDRTRRFPPPWTVEQIAGGYKVKDANGQSLTYVYGRETQADTD |
| Ga0210381_104118661 | 3300021078 | Groundwater Sediment | MRRFPPPWTVEKIPGGFKVIDANGQPLAYVYSHEGALVHIAN |
| Ga0126371_107208491 | 3300021560 | Tropical Forest Soil | VRRFPPPWTVEQIPGGYKVKDANDQSLAYVYGRESE |
| Ga0126371_117006132 | 3300021560 | Tropical Forest Soil | MRRFPAPWTIESIPGGYKVLDANGQSLAYVYGRETKADADIAN |
| Ga0224513_104857161 | 3300022220 | Sediment | PRRRFPPPWSVEQIPGGYQVIDATGQALVYIYARVDLRKE |
| Ga0224712_101468741 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | MPEDRTRRFPPPWTVEQIAGGYKVKDANGQSLTYVYGRETQAD |
| Ga0222622_103588101 | 3300022756 | Groundwater Sediment | MSERKFTPPWSVEKIPGGLKVCDANGQSLAYYSRENSSDAHMAKVLTE |
| Ga0247754_10985972 | 3300023102 | Soil | MPEQSTRRFPPPWSVEQIPGGYKVKDAHGQSLVYVYGREIRADADTP |
| Ga0209280_10113821 | 3300025766 | Arctic Peat Soil | MNRRFPAPWSAEQIPGGFKVVDTAGQSLAYVYARETKAQADAAKV |
| Ga0207660_109369882 | 3300025917 | Corn Rhizosphere | PAPWTVEKIPGGFKVIDANGQSLAYVYSRDNPNDAK |
| Ga0207657_103282971 | 3300025919 | Corn Rhizosphere | RFPAPWTVEKIPGGFKVIDANGQSLAYVYGRETKADADIAKC |
| Ga0207649_102602081 | 3300025920 | Corn Rhizosphere | SPMRRFPAPWTVEKIPGGFKVIDANGQSLAYVYSRDNPNDAK |
| Ga0207690_114679601 | 3300025932 | Corn Rhizosphere | MPEQSTRRFPPPWSVEQIPGGYKVKDAHGQSLVYVYGREIRGRLP |
| Ga0207651_104761671 | 3300025960 | Switchgrass Rhizosphere | TSPVASPMRRFPAPWTVEKIPGGFKVIDANGQSLAYVYSRDNPNDAK |
| Ga0207712_113003092 | 3300025961 | Switchgrass Rhizosphere | MSDSSELDEGHRRFPPPWTVEPIQVKDANGQSLAYVYGRETQADADI |
| Ga0207658_121363331 | 3300025986 | Switchgrass Rhizosphere | MSDSSELDEGHRRFPPPWTVEPIQVKDANGQSLAYVYGRETQADA |
| Ga0207641_119612161 | 3300026088 | Switchgrass Rhizosphere | MPEQSTRRSPPPWSVEQIPGGFKVKGANGQSLAYVYGRETRTDAADL |
| Ga0207675_1001913481 | 3300026118 | Switchgrass Rhizosphere | KPAWLHRCTSPVASPMRRFPAPWTVEKIPGGFKVIDANGQSLAYVYSRDNPNDAK |
| Ga0207675_1016279351 | 3300026118 | Switchgrass Rhizosphere | MTERRFPPPWSVETFPGGLKVCDANGQSLAYVYSRENASDAHE |
| Ga0208565_11537201 | 3300027662 | Peatlands Soil | MIERRFPPPWTVEQIPGGLKVCDANGQSLAYVYSRENEGDA |
| Ga0247828_107566701 | 3300028587 | Soil | PWTVEKIPGGLKVCDANGQSLAYIYSRENPNDAHMG |
| Ga0247828_108760941 | 3300028587 | Soil | MSERKFPPPWTVETIPGGLKVCGANGQSLAYVYSRESPNDAYMAKF |
| Ga0247822_110805361 | 3300028592 | Soil | MRRFPPPWSVEKIPGGLKVCDADGQSLAYVYSRENANDAHMA |
| Ga0247822_114991491 | 3300028592 | Soil | ERRCPPPWTVEKIPGGLKVCNGNGQSLAYVYSRENPNDAHMG |
| Ga0307290_101541801 | 3300028791 | Soil | MSERKFPPPWSVEKIPGGLKVCDANGQSLAYVYSRENPRRP |
| Ga0307497_101655652 | 3300031226 | Soil | MRRFPAPWTVEAIEAGFKVLDANKQAIAYVYSREYPSDALIARY |
| Ga0307497_103736661 | 3300031226 | Soil | MRRFPAPWTVEAIEAGFKVLDANKQAIAYVYSREYPS |
| Ga0310915_104722993 | 3300031573 | Soil | WSVEQIPGGYKVLDADGQSLAYVYGCETKADADIAKY |
| Ga0310915_111589291 | 3300031573 | Soil | MRRFPPPWTVERIARVIDANGQSLAYVYSRETKDANK |
| Ga0318555_108241101 | 3300031640 | Soil | MRRFPPPWTIEQIPGGYKVLDANGQSLAYVYGRETKAAAD |
| Ga0306917_101680014 | 3300031719 | Soil | VTAATGLMRRFPAPWTVEKIAGGFKVIDANGQSLVYVYSRE |
| Ga0307468_1000960633 | 3300031740 | Hardwood Forest Soil | MRRFPPPWTVEKIAGGFKVCDANGQSLAYVYSSENPNDAF |
| Ga0306918_103562413 | 3300031744 | Soil | MAARRFPPPWTVEQIPGGYKVIDANGRSLAYVYGRETKADADIA |
| Ga0310904_105788691 | 3300031854 | Soil | MTQRRFPPPWRVEEITAGYVVKNANGQSLAYVYGRETRADA |
| Ga0306925_113321002 | 3300031890 | Soil | MARRFPPPWTVEQIPGGYKVLDANGQSLAYVYGRETAILE |
| Ga0306923_103649471 | 3300031910 | Soil | PWSVEQIPGGYKVLDADGQSLAYVYGCETKADADIAKY |
| Ga0306923_108800852 | 3300031910 | Soil | MRRFPAPWTVERIAGGFKVLDANRQSLAHVYSRETKDANK |
| Ga0306921_102984721 | 3300031912 | Soil | VRRFPPPWTVEQIPGGYKVLDKNGQSLAYVYGRETRA |
| Ga0306921_114392801 | 3300031912 | Soil | MRRFPPPWTVERIARVIDANGQSLAYVYSRETIDANKC |
| Ga0310916_112200331 | 3300031942 | Soil | LTLKAAGRRFPAPWTVEKIAGGFKVLDANGQALGYVYSRETK |
| Ga0310910_108488551 | 3300031946 | Soil | MTRRFLAPWTVQQIPNGFKVLDANGQSLAYVYGRETKADADI |
| Ga0315294_112016091 | 3300031952 | Sediment | VRRFPSPWTAERIPGGYVVKDATGQSLVYVYARETRAEADTAKVLTMDEA |
| Ga0306926_124888671 | 3300031954 | Soil | MARRFPPPWTVEQIPGGYKVLDATGQSLAYVYGRETRADA |
| Ga0310890_108061843 | 3300032075 | Soil | MRRFPAPWTVEKIPGGFKVIDANGQSLAYVYGRETKADADI |
| Ga0306924_119376511 | 3300032076 | Soil | MRRFPPPWSVEQIPGGYKVLDADGQSLAYVYGCETKADADIAKY |
| Ga0306920_1016046131 | 3300032261 | Soil | MRRFPPWTVEQIPGGYKVLDANGQSLAYVYGRETKADADI |
| ⦗Top⦘ |