NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F042367

Metagenome / Metatranscriptome Family F042367

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F042367
Family Type Metagenome / Metatranscriptome
Number of Sequences 158
Average Sequence Length 109 residues
Representative Sequence MDQFSRKFNKQNYLNAVEIAKELGAPLPRIHTWELLDKAFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLNAKYHDGEFVDPATIDPRDD
Number of Associated Samples 103
Number of Associated Scaffolds 158

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 46.20 %
% of genes near scaffold ends (potentially truncated) 21.52 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.68

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(42.405 % of family members)
Environment Ontology (ENVO) Unclassified
(68.354 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(85.443 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 52.55%    β-sheet: 1.46%    Coil/Unstructured: 45.99%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.68
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003701|Ga0005233J53080_1028257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani793Open in IMG/M
3300006356|Ga0075487_1430605All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani673Open in IMG/M
3300006384|Ga0075516_1387881All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani596Open in IMG/M
3300007513|Ga0105019_1153389All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1194Open in IMG/M
3300007957|Ga0105742_1043870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani602Open in IMG/M
3300008832|Ga0103951_10122286All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1152Open in IMG/M
3300009436|Ga0115008_10284854All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1173Open in IMG/M
3300009441|Ga0115007_10243338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1163Open in IMG/M
3300009593|Ga0115011_11751407All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani558Open in IMG/M
3300009606|Ga0115102_10511064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani790Open in IMG/M
3300009677|Ga0115104_10076564All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani760Open in IMG/M
3300009677|Ga0115104_10147742All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani619Open in IMG/M
3300009677|Ga0115104_10240138All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani513Open in IMG/M
3300009677|Ga0115104_10353651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani682Open in IMG/M
3300009677|Ga0115104_10444452All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani631Open in IMG/M
3300009677|Ga0115104_10519946All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani700Open in IMG/M
3300009677|Ga0115104_10794263All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani566Open in IMG/M
3300009677|Ga0115104_11270369All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani777Open in IMG/M
3300009679|Ga0115105_11094185All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani548Open in IMG/M
3300009679|Ga0115105_11106000All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani792Open in IMG/M
3300009679|Ga0115105_11239596All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani549Open in IMG/M
3300009679|Ga0115105_11259176All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani699Open in IMG/M
3300009705|Ga0115000_10608642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani680Open in IMG/M
3300009785|Ga0115001_10353846All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani924Open in IMG/M
3300010981|Ga0138316_10305247All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani820Open in IMG/M
3300010981|Ga0138316_10566591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani625Open in IMG/M
3300010981|Ga0138316_11286459All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani846Open in IMG/M
3300010981|Ga0138316_11619477All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani702Open in IMG/M
3300010985|Ga0138326_10494280All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani647Open in IMG/M
3300010987|Ga0138324_10128401All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1109Open in IMG/M
3300012953|Ga0163179_11682547All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani576Open in IMG/M
3300012970|Ga0129338_1590262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani810Open in IMG/M
3300016731|Ga0182094_1319402All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani604Open in IMG/M
3300018628|Ga0193355_1017292All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani672Open in IMG/M
3300018725|Ga0193517_1052383All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani717Open in IMG/M
3300018730|Ga0192967_1041566All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani770Open in IMG/M
3300018742|Ga0193138_1030464All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani708Open in IMG/M
3300018765|Ga0193031_1019665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani980Open in IMG/M
3300018765|Ga0193031_1053937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani672Open in IMG/M
3300018765|Ga0193031_1056802All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani656Open in IMG/M
3300018765|Ga0193031_1066259All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani610Open in IMG/M
3300018765|Ga0193031_1081778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani546Open in IMG/M
3300018779|Ga0193149_1030897All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani755Open in IMG/M
3300018796|Ga0193117_1053813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani673Open in IMG/M
3300018855|Ga0193475_1085815All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani508Open in IMG/M
3300018871|Ga0192978_1036905All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani918Open in IMG/M
3300018871|Ga0192978_1040012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani883Open in IMG/M
3300018881|Ga0192908_10051008All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani524Open in IMG/M
3300018928|Ga0193260_10151054All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani500Open in IMG/M
3300018967|Ga0193178_10050081All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani624Open in IMG/M
3300018968|Ga0192894_10245876All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani598Open in IMG/M
3300018974|Ga0192873_10194084All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani890Open in IMG/M
3300018975|Ga0193006_10154069All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani685Open in IMG/M
3300018977|Ga0193353_10217723All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani553Open in IMG/M
3300018980|Ga0192961_10197598All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani604Open in IMG/M
3300018982|Ga0192947_10145736All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani790Open in IMG/M
3300018982|Ga0192947_10153770All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani767Open in IMG/M
3300018988|Ga0193275_10065846All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani966Open in IMG/M
3300018989|Ga0193030_10078693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani969Open in IMG/M
3300018989|Ga0193030_10130857All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani800Open in IMG/M
3300018989|Ga0193030_10132268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani796Open in IMG/M
3300018989|Ga0193030_10150249All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani753Open in IMG/M
3300018989|Ga0193030_10174384All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani703Open in IMG/M
3300018989|Ga0193030_10196789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani663Open in IMG/M
3300018989|Ga0193030_10214916All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani633Open in IMG/M
3300018989|Ga0193030_10263811All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani563Open in IMG/M
3300018989|Ga0193030_10293977All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani527Open in IMG/M
3300018989|Ga0193030_10307284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani512Open in IMG/M
3300018989|Ga0193030_10315145All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani504Open in IMG/M
3300019022|Ga0192951_10329293All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani579Open in IMG/M
3300019031|Ga0193516_10104926All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani962Open in IMG/M
3300019031|Ga0193516_10104943All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani962Open in IMG/M
3300019031|Ga0193516_10113699All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani921Open in IMG/M
3300019031|Ga0193516_10258707All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani565Open in IMG/M
3300019032|Ga0192869_10418556All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani581Open in IMG/M
3300019043|Ga0192998_10280435All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani512Open in IMG/M
3300019048|Ga0192981_10223749All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani728Open in IMG/M
3300019049|Ga0193082_10476444All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani690Open in IMG/M
3300019051|Ga0192826_10115683All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani971Open in IMG/M
3300019051|Ga0192826_10188402All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani763Open in IMG/M
3300019051|Ga0192826_10238628All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani670Open in IMG/M
3300019051|Ga0192826_10253197All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani648Open in IMG/M
3300019051|Ga0192826_10315272All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani570Open in IMG/M
3300019103|Ga0192946_1044346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani665Open in IMG/M
3300019118|Ga0193157_1037357All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani509Open in IMG/M
3300019123|Ga0192980_1059604All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani722Open in IMG/M
3300019149|Ga0188870_10055826All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani961Open in IMG/M
3300019149|Ga0188870_10080522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani792Open in IMG/M
3300021169|Ga0206687_1142782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani772Open in IMG/M
3300021342|Ga0206691_1686714All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani911Open in IMG/M
3300021345|Ga0206688_10678602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1061Open in IMG/M
3300021345|Ga0206688_10810653All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani661Open in IMG/M
3300021345|Ga0206688_10812939All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani936Open in IMG/M
3300021345|Ga0206688_11015361All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani963Open in IMG/M
3300021348|Ga0206695_1788359All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani671Open in IMG/M
3300021350|Ga0206692_1006953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani691Open in IMG/M
3300021353|Ga0206693_1394808All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani597Open in IMG/M
3300021355|Ga0206690_10164852All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani957Open in IMG/M
3300021866|Ga0063109_104315All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani899Open in IMG/M
3300021869|Ga0063107_100820All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani954Open in IMG/M
3300021872|Ga0063132_103288All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani913Open in IMG/M
3300021872|Ga0063132_108024All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani772Open in IMG/M
3300021881|Ga0063117_1034215All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani644Open in IMG/M
3300021925|Ga0063096_1001743All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani948Open in IMG/M
3300021925|Ga0063096_1009213All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani959Open in IMG/M
3300021925|Ga0063096_1012787All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani943Open in IMG/M
3300021927|Ga0063103_1061372All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani632Open in IMG/M
3300021939|Ga0063095_1143550All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani583Open in IMG/M
3300021941|Ga0063102_1018210All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani940Open in IMG/M
3300021941|Ga0063102_1057375All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani772Open in IMG/M
3300021943|Ga0063094_1007383All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani852Open in IMG/M
3300021950|Ga0063101_1040801All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani922Open in IMG/M
3300021950|Ga0063101_1092029All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani745Open in IMG/M
3300021954|Ga0063755_1147387All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani677Open in IMG/M
3300021959|Ga0222716_10316602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani936Open in IMG/M
3300023565|Ga0228688_115695All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani621Open in IMG/M
3300023696|Ga0228687_1012727All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani938Open in IMG/M
3300025138|Ga0209634_1319049All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani525Open in IMG/M
3300026448|Ga0247594_1091485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani535Open in IMG/M
3300026449|Ga0247593_1106852All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani545Open in IMG/M
3300026461|Ga0247600_1057750All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani758Open in IMG/M
3300026466|Ga0247598_1148677All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani559Open in IMG/M
3300026495|Ga0247571_1101412All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani669Open in IMG/M
3300026513|Ga0247590_1180640All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani537Open in IMG/M
3300028106|Ga0247596_1070198All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani786Open in IMG/M
3300028134|Ga0256411_1270967All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani518Open in IMG/M
3300028137|Ga0256412_1123278All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani950Open in IMG/M
3300028137|Ga0256412_1184581All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani770Open in IMG/M
3300028137|Ga0256412_1229611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani685Open in IMG/M
3300028137|Ga0256412_1333323All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani557Open in IMG/M
3300028282|Ga0256413_1323261All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani542Open in IMG/M
3300028333|Ga0247595_1081317All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani544Open in IMG/M
3300028575|Ga0304731_10126337All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani625Open in IMG/M
3300028575|Ga0304731_10966879All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani820Open in IMG/M
3300028672|Ga0257128_1108682All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani557Open in IMG/M
3300030699|Ga0307398_10265193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani926Open in IMG/M
3300030699|Ga0307398_10399727All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani753Open in IMG/M
3300030724|Ga0308138_1023765All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani880Open in IMG/M
3300030780|Ga0073988_10033205All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani763Open in IMG/M
3300030780|Ga0073988_12336987All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani546Open in IMG/M
3300031032|Ga0073980_11308168All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani614Open in IMG/M
3300031038|Ga0073986_11912668All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani601Open in IMG/M
3300031542|Ga0308149_1022012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani798Open in IMG/M
3300031542|Ga0308149_1030005All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani683Open in IMG/M
3300031556|Ga0308142_1064254All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani546Open in IMG/M
3300031557|Ga0308148_1027001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani650Open in IMG/M
3300031638|Ga0302125_10170703All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani684Open in IMG/M
3300031709|Ga0307385_10243188All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani684Open in IMG/M
3300031710|Ga0307386_10252993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani870Open in IMG/M
3300031710|Ga0307386_10322276All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani781Open in IMG/M
3300031725|Ga0307381_10173008All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani747Open in IMG/M
3300031729|Ga0307391_10557730All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani646Open in IMG/M
3300031729|Ga0307391_10848804All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani525Open in IMG/M
3300031734|Ga0307397_10169555All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani952Open in IMG/M
3300031738|Ga0307384_10193262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani896Open in IMG/M
3300031738|Ga0307384_10268691All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani771Open in IMG/M
3300032481|Ga0314668_10382567All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani727Open in IMG/M
3300032540|Ga0314682_10412607All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani745Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine42.41%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine33.54%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater10.13%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater6.96%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous1.90%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.27%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.27%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.63%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.63%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.63%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.63%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003701Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI072_150m_A (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006356Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006384Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007957Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_3.0umEnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012970Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016731Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018725Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782256-ERR1712230)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018742Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000534 (ERX1789653-ERR1719224)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018779Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000698 (ERX1789670-ERR1719303)EnvironmentalOpen in IMG/M
3300018796Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000410 (ERX1789505-ERR1719432)EnvironmentalOpen in IMG/M
3300018855Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002191 (ERX1782341-ERR1711903)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018881Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782151-ERR1712094)EnvironmentalOpen in IMG/M
3300018928Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001111 (ERX1789573-ERR1719386)EnvironmentalOpen in IMG/M
3300018967Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000316 (ERX1789557-ERR1719488)EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018975Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002350 (ERX1782140-ERR1711881)EnvironmentalOpen in IMG/M
3300018977Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782322-ERR1711977)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018988Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782315-ERR1711974)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019043Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001784 (ERX1782103-ERR1712098)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019049Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019118Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000396 (ERX1782223-ERR1711898)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021866Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021869Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-135M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021881Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021939Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-37M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021943Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-27M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021954Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Euk ARK-5-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300023565Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 58R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023696Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 52R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026449Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 56R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026461Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 75R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026466Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 70R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026513Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028106Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028333Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 60R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300028672Metatranscriptome of marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030724Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_949_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030780Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S19_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031032Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031038Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S14_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031542Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_331_5m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031556Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_538_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031557Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_328_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031638Marine microbial communities from Western Arctic Ocean, Canada - CB4_surfaceEnvironmentalOpen in IMG/M
3300031709Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0005233J53080_102825713300003701MarineMDQFSRKFNKQNYVNAVEIAGKLGAPLPKVHSWELLDRAFSFPRIRRYQFVQENLDMLEHFEDNMNTNISNSVNVANFMKVGKTVVTNLANKYSNGEFVDPGLYDPRSEDDYAGMNA*
Ga0075487_143060523300006356AqueousMDQFSRKFNKQNYLNAVEIADKLGAPLPRVHTWDLLDKSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLANKYADGEFVDPATIDPRDEE*
Ga0075516_138788123300006384AqueousMDQFSRKFNKQNYLNAVEIADKLGAPLPRVHTWDLLDKSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLANKYADGEFVDPATIDPRDEE*RGKVI*
Ga0105019_115338923300007513MarineMDQFCRKFNKQSYLNAVEIAGKLGVSLPRVHTWELLDGAFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSINVANFIKVGKTVVANLNAKYHDGEFVDPASFDPRDE*
Ga0105742_104387023300007957Estuary WaterMDQFSRHFNLKNYDNARKIAGELGKPTPKVHYWALLNTAFTFPRIRRYQYVQENMDMLEHFEDNLNTNISNSVNVANFAKVGKTVVANLNAKYHNGEFADPANYDPRDDEE*
Ga0103951_1012228613300008832MarineMDQFSRKFNKQNYLNAVEIAKELGAPLPRIHTWELLDKSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLLNKYRDGEFVDPATIDPRDED*
Ga0115008_1028485423300009436MarineLNAVEIAGKLGVPAPRIHTWEILDTSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSINVANFIKVGKTVVANLSAKYADGEFIDPASVDPRG*
Ga0115007_1024333813300009441MarineMNAVEIAGKLGVSVPRVHTWELLDTAFSFPRIRRYQFVQENMDMLEHFEDNLNTNVSNSINVANFMKVGKTVVANLNAKYHDGEFVDPASVDPRDD*
Ga0115011_1175140713300009593MarineDALTPQKGHCEERLWISEDELNWQMDQFSRKFDKQNYDNAVTIAGALGKPLPKIHAWALNDVAFTFPRLRRYQFVQENMDMLEHFEDNLNTNVSNSVNVANFIKVGKTVVANLNAKYGNGEFVDPATIDPRDA*
Ga0115102_1051106423300009606MarineMDQFSRKFNKQNYLNAVEIADKLGAPLPRIHTWDLLDKSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLLNKYADGEFVDPATIDPRDEE*
Ga0115104_1007656423300009677MarineMDQFSRKFNKQNYLNAVEIAKELGSPLPRIHTWELLDKAFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLNAKYHDGEFDDPANTDPRDEE*
Ga0115104_1014774223300009677MarineMDQFSRKFNKQNYLNAVEIAKELGTALPRIHTWELLDKAFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLNAKYHDGEFDDPANTDPRDD*
Ga0115104_1024013813300009677MarineSRKFNKQNYLNAVEIAKELGAPLPRIHTWELLDKSFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLSNKYHDGEFVDPATIDPRDEE*
Ga0115104_1035365123300009677MarineMDQFSRKFNKQNYLNAVEIAKELGAPLPRVHTWELLDKAFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLSNKYHDGEFVDPATFDPREEEE*
Ga0115104_1044445233300009677MarineMDQFSRHFNLKNYENARKIAGELGKPTPKVHSWALLNTAFTFPRIRRYQYVQENMDMLEHFEDNLNTNISNSVNVANFAKVGKTVVANLNAKYHNGEFNDPA
Ga0115104_1051994623300009677MarineMDQFSRKFNKQNYLNAVEIAKELGTALPRIHTWELLDKSFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLNTKYHDGEFVDPATIDPRDEE*
Ga0115104_1079426323300009677MarineMDQFSRKFNKQNYLNAVEIAKELGSPLPRVHTWELLDKSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVNNLATKYHDGEFVDPATIDPR
Ga0115104_1127036923300009677MarineMDQFSRKFNKQNYLNAVEIAKELGAPLPRVHTWELLDKAFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVGNLNAKYHDGEFDDPANTDPRDD*
Ga0115105_1109418523300009679MarineMDQFSRKFNKQNYLNAVEIAKELGTSLPRIHSWELLDKSFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLLNKYRDGEFVDP
Ga0115105_1110600013300009679MarineMDQFSRKFNKQNYLNAVEIAKELGSPLPRIHTWELLDKSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLNAKYHDGEFDDPANTDPRDEDK*
Ga0115105_1123959613300009679MarineMDQFSRKFNKQNYLNAVEIAKELGSPLPRVHTWNLLDTAFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLLNKYHDGEFVDPGTIDPRDEE*
Ga0115105_1125917623300009679MarineMDQFSRKFNKQNYLNAVTIAGKLGTSVPRIHSWELLDTSFTFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLNAKYHDGEFDDPANTDPRDEE*
Ga0115000_1060864213300009705MarineVNAVEIAGKLGAPLPKVHSWELLDRAFSFPRIRRYQFVQENLDMLEHFEDNMNTNISNSVNVANFMKVGKTVVTNLANKYSNGEFVDPGLYDPRSEDDYAGMNA*
Ga0115001_1035384623300009785MarineMDQFSRHFDLKNYDNARKIAGELGKPTPKVHSWALLNTAFTFPRIRRYQYVQENMDMLEHFEDNMNTNISNTINVANFIKVGKTVVGNLAAKYHNGEFVNPADFDPRSEIDGWYEPDA*
Ga0138316_1030524723300010981MarineMDQFSRKFDIKNYNNAVFIAGKLGVPLPKIHTWALLDNAWSFRRIRRYAYVQENMDMLEHFEDNANTNISNSINIANFIKVGKTVVLNLKTKYHDGEFADPADFDPRDV*
Ga0138316_1056659113300010981MarineMDQFSRKFNKQNYLNAVEIAGKLGTAIPRIHTWELLDGSFTFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLNNKYRDGEFDDPANTDPRDE*
Ga0138316_1128645923300010981MarineMDQFSRKFNKQNYLNAVEIAGKLGVAVPRIHTWELLDTSFTFPRIRRYQFVQENMDMLEHFEDNLNTNISNSINVANFIKVGKTVVANLGNKYHDGEFIDPATIDPRDD*
Ga0138316_1161947723300010981MarineMDQFSRKFNKQNYLNAVEIAKELGAPLPRIHTWELLDKAFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLNAKYHDGEFVDPATIDPRDD*
Ga0138326_1049428023300010985MarineMDQFSRKFNKQNYLNAVEIAKELGAPLPRIHTWELLDKAFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLNAKYHDGEFDDPANTDPRDD*
Ga0138324_1012840113300010987MarineMDQFSRKFNKQNYLNAVEIAGKLGVAVPRIHTWELLDTSFTFPRIRRYQFVQENMDMLEHFEDNLNTNISNSINVANFIKVGKTVVANLGNKYHDGEFVDPATIDPRDD*
Ga0163179_1168254713300012953SeawaterMDQFSRKFNKQNYLNAVEIAKELGTSLPRIHTWELLDKSFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLLNKYRDGEFVDPATIDPRDEE*
Ga0129338_159026223300012970AqueousMDWQMDQFSRKFNKQNYLNAMEIAGKLGVKPPRVHTWELLDKSFSFPRVRRYESVQAGMDMVEHFQDNLNTNISNLVNVENFIKQAKVVVSQFNTKYHDGEFADPALFDPRDEKK*
Ga0182094_131940213300016731Salt MarshQDELEWQMDQFSRKFNKKNYNNAVEIAGKLGAPLPAVKTWELLDKSFSFPRVRRFETVQENMDMVEHFQDNMNMNPSNQVNVDNFIRAGKTAVNNIASRYHDGEFADPAAYDPREDK
Ga0193355_101729213300018628MarineRQMDQFSRKFDKTNYNNAAEIADELGLKLPKVHTYELIDKAFSFPRVRRYEDVQENMTMLEHFQDNLNTNISNQVNVDRFIRVGKAVVASLNEKYHNGEFADPANTDPREVQRAEEEG
Ga0193517_105238313300018725MarineRLWIDEDELNWQMDQFSRKFDITNYNNAVFIAGKLGVPLPKIHTWALLDNAWSFRRIRRYQYVQENMDMLEHFEDNANTNISNSINIANFIKVGKTVVANLKAKYHDGEFADPADFDPRD
Ga0192967_104156613300018730MarineMDQFSRKFNKQNYLNAVEIAGELGAPLPRIHSWELLDKSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLNGKYHDGEFVDPSSIDPRDE
Ga0193138_103046423300018742MarineMDQFSRKFNKQNYLNAVEIAKELGSPLPRIHTWELLDKSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLANKYHDGEFVDPATIDPRDE
Ga0193031_101966513300018765MarineLDQFSRKFNKQNYLNAVEIAGKLGVPLPRVHSWELLDTAFTFPRIRRYQFVQENMDMLEHFEDNLNTNISNSINVANFIKVGKTVVANLAAKYHDGEFVDPATFDPRDV
Ga0193031_105393723300018765MarineMDQFSRKFNKQNYLNAVEIAKELGTSLPRIHSWELLDKSFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVSNLLNKYRDGEFVDPGTVDPREEAKEE
Ga0193031_105680213300018765MarineWDYNNAVFIAGKLGVPLPKIHTWALLDNAWSFRRIRRYQYVQENMDMLEHFEDNANMNISNSINIANFIKVGKTVVLNLKAKYHDGEFADPADFDPRDA
Ga0193031_106625913300018765MarineMDQFSRKFNKQNYLNAVEIAKELGAPLPRIHTWELLDKSFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFMKVGKTVVANLLNKYRDGEFVDPATIDPRDEE
Ga0193031_108177823300018765MarineMDQFSRKFNKQNYLNAVEIAKELGTALPRIHTWELLDKSFSFPRLRRYQFVQENMDMLEHFEDNLNTNVSNSVNMANFMKVAQTVKRNLNAKYHNGEFKDPAADAYKDPDEECKGSACWI
Ga0193149_103089713300018779MarineMDQFSRKFNKQNYLNAVEIAGKLGVSVPRIHTWELLDTSFTFPRIRRYQFVQENMDMLEHFEDNLNTNISNSINVANFIKVGKTVVANLGAKYHDGEFDDPANHDPRDD
Ga0193117_105381313300018796MarineTNSRKFNKQNYLNAVEIAGKLGVAVPRIHTWELLDTSFTFPRIRRYQFVQENMDMLEHFEDNLNTNISNSINVANFIKVGKTVVANLGNKYHDGEFIDPATIDPRDD
Ga0193475_108581513300018855MarineMDQFSRKFNKQNYLNAVEIAKELGAPLPRVHTWELLDKAFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVGNLNAKYHDGEFDDPANTDPRDD
Ga0192978_103690523300018871MarineMDQFSRKFNKQSYLNAVEIAGKLGTAVPKIHTWELLDGSFTFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFMKVGKTVVANLSQKYHDGEFVDPATVDPRD
Ga0192978_104001213300018871MarineMDQFSRHFDLKNYDNARKIAGELGKPTPKVHSWALLNTAFTFPRIRRYQYVQENMDMLEHFEDNLNTNISNSVNVANFAKVGKTVVNNLKSKYHNGEFADPAAYDPRDDEE
Ga0192908_1005100823300018881MarineMDQFSRKFNKQNYLNAVEIAKELGAPLPRIHTWELLDKSFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFMKVGKTVVASLLNKYRDGEFVDPATIDPRDEE
Ga0193260_1015105413300018928MarineMDQFSRKFNKQNYLNAVEIAGKLGVPVPRIHSWELLDTSFTFPRIRRYQFVQENMDMLEHFEDNLNTNISNSINVANFIKVGKTVVANLAAKYHDGEFVDPATFDPRDA
Ga0193178_1005008113300018967MarineMDQFSRKFNKQNYLNAVEIAKELGAPLPRIHTWELLDKSFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLANKYHDGEFVDPATIDPRDE
Ga0192894_1024587623300018968MarineMEIAKELGVAAPRIHTWELLDKAFTFPRVRRYQFVQENMDMLEHFEDNLNTNISNSINVANFAKVGKTVIANLANKYHNGEFDNPANTDPREEPEEGPNHGWS
Ga0192873_1019408423300018974MarineMDQFSRKFNKQNYLNAVEIAGKLGVPLPRVHTWELLDTSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSINVANFIKVGKTVVANLSNKYHDGEFVDPATIDPRDE
Ga0193006_1015406913300018975MarineMDQFSRKFNKQNYLNAVEIAKELGTPLPRVHTWELLDKSFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLLNKYRDGEFVDPATIDPRDEE
Ga0193353_1021772313300018977MarineMDQFSRKFNKQNYLNAVEIAKELGTALPRIHTWELLDKSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLLNKYRDGEFVDPATIDPRDED
Ga0192961_1019759813300018980MarineMDQFSRHFDLKNYDNARKIAGELGKPTPKVHSWALLNTAFTFPRIRRYQYVQENMDMLEHFEDNMNTNISNTINVANFIKVGKTVVGNLAAKYHNGEFVNPADFDPRSEIEGWYEPTE
Ga0192947_1014573613300018982MarineLGAPLPRIHSWELLDKSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLSKKYADGEFVDPASVDPREEAKDE
Ga0192947_1015377023300018982MarineMDQFSRKFNKQNYLNAVEIAKELGTSLPRIHTWELLDKSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLSKKYADGEFVDPASVDPREEAKDE
Ga0193275_1006584613300018988MarineMDQFSRKFNKQNYLNAVEIAGKLGVQIPRIHTWELLDTAFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSINVANFIKVGKTVVANLNAKYHDGEFADPANYDPREDK
Ga0193030_1007869313300018989MarineMDQFSRKFDITNYNNAVFIAGKLGVPLPKIHTWALLDNAWSFRRIRRYQYVQENMDMLEHFEDNANMNISNSINIANFIKVGKTVVLNLKAKYHDGEFADPADFDPRDA
Ga0193030_1013085723300018989MarineMDQFSRKFNHQNYKNAVEIAGKLGVAIPRIHTWELLDTAFSFPRIRRYQFVQENMDMLEHFEDNVNTNISNSVNVANFMKVGKTVVANLNAKYHDGEFADPANFDPRDD
Ga0193030_1013226823300018989MarineMDQFSRKFNKQNYLNAVEIAKELGVAIPRIHTWELLDGSFTFPRIRRYQFVQENMDMLEHFEDNLNTNISNSINVANFIKVGKTVVANLAAKYHDGEFVDPATIDPRDED
Ga0193030_1015024923300018989MarineMDQFSRKFNKQNYLNAVEIAKELGTSLPRIHSWELLDKSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVSNLLNKYRDGEFVDPGTVDPREEAKEE
Ga0193030_1017438413300018989MarineMDQFSRKFNKQNYLNAVEIAKELGTSLPRIHSWELLDKSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLNAKYHDGEFDDPANTDPRDD
Ga0193030_1019678913300018989MarineQFSRKFNKQNYANAAEIASELGLKMPPVHTYELVDKAFSFPRVRRYEDVQESMTMLEHFQDNLNTNISNQVNVDRFIRVGKTVIAQLNEKYHNGEFADPANTDPREVQREDEA
Ga0193030_1021491613300018989MarineMDQFSRKGDIKNYKNAAKIADKLKTAIPRIHAWALLDKAFTYPRLRRYQFVQENMDMLEHFEDNLNTNISNSINVANFAKVLSTVRKNLATKYSNGEFDDPGLTDPRVEAEKEKEWFE
Ga0193030_1026381123300018989MarineMDQFSRKFNKQNYLNAVEIAKELGVAIPRIHTWELLDGSFTFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLSNKYHDGEFVDPATIDPREEDKE
Ga0193030_1029397713300018989MarineMDQFSRKFNKQNYLNAVEIAKELGSPLPRIHTWELLDKAFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLNAKYHDGEFDDPANTDPRDEDK
Ga0193030_1030728413300018989MarineLWINEDELAWQMDQFSRKFNKQNYLNAVEIAKELGTSLPRIHTWELLDKSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLSAKYADGEFVDPATIDPREEAKDE
Ga0193030_1031514513300018989MarineYLNAVEIAKELGTSLPRIHTWELLDKAFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLLNKYQDGEFVDPATYDPREDE
Ga0192951_1032929313300019022MarineAVEIAGKLGVPLPKVHTWELLDTAFSFPRLRRYQFVQENMDMLEHFEDNLNTNVSNSINVANFIKVGKTVVANLSAKYSNGEFNDPANTDPRD
Ga0193516_1010492613300019031MarineMDQFSRKFDITNYNNAVFIAGKLGVPLPKIHTWALLDNAWSFRRIRRYQYVQENMDMLEHFEDNANTNISNSINIANFIKVGKTVVANLKAKYHDGEFADPADFDPRDA
Ga0193516_1010494323300019031MarineMDQFSRKFNKGNYLNAVTIAGKLGVPVPRIHTWELLDKSFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSINVANFIKVGKTVVANLSNKYHNGEFVDPGTIDPRDED
Ga0193516_1011369923300019031MarineMDQFSRKFDIKNYNNSVFIAEKLGVPLPRIHSWALLDNAWAFRRIRRYQFVQENMDMLEHFEDNANTNISNSVNIANFIKVGKTVVSNLKTKYHDGEFADPADFDPRD
Ga0193516_1025870713300019031MarineMTIATSLGVHPPRIHTWELLDKAFSFPRVRRYQFVQENMDMLEHFQDNLNTNVSNEVNVDNFIRVGKTVVANFNGKYHDGEFADPALYDPREDK
Ga0192869_1041855613300019032MarineMDQFSRKFNKQNYLNAVEIAKELGAPLPRIHTWELLDKSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLLNKYRDGEFVDPATIDPRDEE
Ga0192998_1028043513300019043MarineMDQFSRKGLVKNYENAVKIAGKLKTAIPRIHAWALLDKSFTYPRLRRYQFAQENMDMLGHFEDNLNTNISNSVNVANFAKVLSTVRANLRNKYGNGEFSDPGDTDPRVEAEKEKVWFE
Ga0192981_1022374913300019048MarineHGDKQSYLNAVTIAGKLGSAIPRIHTWEILDGSFTFPRLRRYQFVQENMDMLEHFEDNLNTNISNSINVANFIKVGKTVVANLAAKYHDGEFVDPATVDPRD
Ga0193082_1047644413300019049MarineMDQFSRKFNKQNYLNAVEIAKELGAPLPRVHTWELVDKSFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLLNKYHDGEFVDPATIDPRDED
Ga0192826_1011568313300019051MarineMDQFSRKFDITNYNNAVFIAGKLGVPLPKIHTWALLDNAWSFRRIRRYQYVQENMDMLEHFEDNANMNISNSINIANFIKVGKTVVQNLKTKYHDGEFADPADFDPRDA
Ga0192826_1018840223300019051MarineMDQFSRKFNKQNYLNAVEIAKELGAPLPRVHTWELLDKAFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLSNKYHDGEFVDPATYDPREEEE
Ga0192826_1023862813300019051MarineMDQFSRKFNKQNYLNAVEIAKELGAPLPRVHTWELLDKAFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLNNKYHDGEFDDPANTDPRDE
Ga0192826_1025319713300019051MarinePPKGQCEERLWINEDELQWQMDQFSRKFNKQNYLNAVEIAKELGAPLPRVHTWELLDKSFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLANKYHDGEFVDPATIDPRDEEE
Ga0192826_1031527213300019051MarineMDQFSRKFNKQNYLNAVEIAKELGVPLPRVHTWELVDKSFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLLNKYHDGEFVDPATIDPRDED
Ga0192946_104434623300019103MarineLGAPLPRIHSWELLDKSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLNGKYHDGEFVDPSTVDPRDE
Ga0193157_103735713300019118MarineLNAVEIAKELGAPLPRIHTWELLDKSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLANKYRDGEFVDPATIDPRDDE
Ga0192980_105960413300019123MarineQFSRKFDKQSYLNAVTIAGKLGSAIPRIHTWEILDGSFTFPRLRRYQFVQENMDMLEHFEDNLNTNISNSINVANFIKVGKTVVANLAAKYHDGEFVDPATVDPRD
Ga0188870_1005582613300019149Freshwater LakeMDQFSRHFNLQNYDNARKIAGELGKPTPKVHSWALLNTAFTFPRIRRYQYVQENMDMLEHFEDNLNTNISNSVNVANFAKVGRTVVANLNAKYHNGEFADPANYDPRDDEEXINXECK
Ga0188870_1008052223300019149Freshwater LakeMDQFSRKFNKQNYLNAVEIAKELGTQLPRIHTWELLDKSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLANKYADGEFVDPATIDPRDEE
Ga0206687_114278223300021169SeawaterMDQFSRHFNLKNYDNARKIAGELGKPTPKVHSWALLNTAFTFPRIRRYQYVQENMDMLEHFEDNLNTNISNSVNVANFAKVGKTVVANLKAKYHNGEFADPANYDPRDDEE
Ga0206691_168671423300021342SeawaterMDQFSRHFDKKNYNNAVEIAEDLGGAKLPQLHTYELMDKSFSFPRVRRYEDVQDNMTMLEHFQDNANTNLSNQVNVDRFIRVGSTIAANLNSKYHNGEFDDPANHDSRDNSDPTWSSVXASKLEK
Ga0206688_1067860233300021345SeawaterMDQFSRKFNVKNYENAMEIAKELGVAAPRIHTWELLDKSFTFPRVRRYQFVQENMDMLEHFEDNLNTNLTNSINVANFAKVGKTVIANLANKYHNGEFDNPANTDPREEPEEGPNHGWS
Ga0206688_1081065313300021345SeawaterMDQFSRKFNVKNYENAREIAKELGVAVPRVHSWELLDKAFTFPRLRRYQFVQENMDMLEHFEDNLNTNISNSINVANFAKVGKTVVANLNNKYGNGEFADPANTDPRDDEEDKINNGWA
Ga0206688_1081293923300021345SeawaterMDQFSRHFDLKNYDNARKIAGELGKPTPKVHSWALLNTAFTFPRIRRYQYVQENMDMLEHFEDNLNTNISNSVNVANFAKVGKTVVANLKAKYHNGEFADPANYDPRDDEE
Ga0206688_1101536113300021345SeawaterMDQFSRKFNPQNYANAVEIAKELGKAVPRIHSWDLLDKAFTFPRVRRYQFVQENMDMLEHFEDNLNTNISNSVALANFAKVGKTVVANLNNKYHNGEFADPSKTDPRKEDDGDDPNNGWA
Ga0206695_178835923300021348SeawaterMDQFSRKFNKQNYLNAVTIAGKLGSSIPRIHSWELLDGSFTFPRIRRYQFVQENMDMLEHFEDNLNTNISNSINVANFIKVGKTVVANLNAKYHDGEFVDPGTIDPRDD
Ga0206692_100695313300021350SeawaterDQFSRHFDLKNYDNARKIAGELGKPTPKVHSWALLNTAFTFPRIRRYQYVQENMDMLEHFEDNLNTNISNSVNVANFAKVGKTVVANLKAKYHNGEFADPANYDPRDDEE
Ga0206693_139480813300021353SeawaterMDQFSRKFNNQNYKNAVTIAGKLGVPIPRIHSWELLDTAFTFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLNAKYHDGEFADPALTDSRDD
Ga0206690_1016485213300021355SeawaterMDQFSRKFNKQNYLNAVEIAGKLGTALPRIHSWELLDVAFTFPRIRRYQFVQENMDMLEHFEDNLNTNISNSINVANFIKVGKTVVANLAAKYHDGEFVDPASFDPRDE
Ga0063109_10431523300021866MarineMDQFSRKFNKQNYLNAVEIAGKLGVAVPRIHTWELLDTSFTFPRIRRYQFVQENMDMLEHFEDNLNTNISNSINVANFIKVGKTVVANLGNKYHDGEFIDPATIDPRDD
Ga0063107_10082023300021869MarineMNAVEIAGKLGVSVPRVHTWELLDTAFSFPRIRRYQFVQENMDMLEHFEDNLNTNVSNSINVANFMKVGKTVVANLNAKYHDGEFVDPASVDPRDD
Ga0063132_10328823300021872MarineMDQFSRKFNKQNYLNAVEIAGKLGAPLPRVHTWELLDGSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSINVANFIKVGKTVVANLNAKYHDGEFVDPATIDPRDE
Ga0063132_10802423300021872MarineMDQFSRKFNKQNYLNAVEIAKELGTALPRIHTWELLDKSFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVSNLATKYHDGEFVDPATIDPRDEE
Ga0063117_103421513300021881MarineMDQFSRKGDIKNYKNAVKIADKLKTAIPRIHAWALLDKAFTYPRLRRYQFVQENMDMLEHFEDNLNTNISNSINVANFAKVLSTVRKNLATKYSNGEFDDPGLTDPRVEAEKEKEWFE
Ga0063096_100174323300021925MarineMDQFSRKFNKQNYLNAVEXAGKLGTALPRIHTWELLDTAFSFPRLRRYQFVQENMDMLEHFEDNANTNVSNSVNIANFIKVGRTVVANLNAKYHDGEFSDPANTDPRDA
Ga0063096_100921323300021925MarineMNAVEIAGKLGIATPRIHTWELLDTSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSINVANFIKVGKTVVANLSAKYQDGEFTDPATIDPRD
Ga0063096_101278723300021925MarineMDQFSRHFDLKNYDNARKIAGELGKPTPKVHSWALLNTAFTFPRIRRYQYVQENMDMLEHFEDNLNTNISNSVNVANFAKVGKTVVNNLKSKYHNGEFADPANYDPRDDEE
Ga0063103_106137223300021927MarineMDQFSRHYNIKNYDNARKIAGELGKPTPKVHSWALLNTAFTFPRIRRYQYVQENMDMLEHFEDNMNTNVSNSVNVANFVKVGKTVVGNLNAKYHNGEFADPANYDPRDDEE
Ga0063095_114355023300021939MarineMDQFSRKFNKQNYLNAVEIAGKLGTALPRIHTWELLDTAFSFPRLRRYQFVQENMDMLEHFEDNANTNVSNSVNIANFIKVGRTVVANLNAKYHDGEFSDPANTDPRDAXRN
Ga0063102_101821023300021941MarineMDQFSRHYNIKNYDNARKIAGELGKPTPKVHSWALLNTAFTFPRIRRYQYVQENMDMLEHFEDNMNTNLSNSVNVANFVKVGKTVVGNLNAKYSNGEFADPANYDPRDDEN
Ga0063102_105737523300021941MarineMNAVEIAGKLGVAVPRVHTWELLDTAFSFPRIRRYQFVQENMDMLEHFEDNLNTNVSNSINVANFMKVGKTVVANLNAKYHDGEFVDPASVDPRDD
Ga0063094_100738323300021943MarineMNAVEIAGKLGVSVPRVHTWELLDTAFSFPRIRRYQFVQENMDMLEHFEXNLNTNVSNSINVANFMKVGKTVVANLNAKYHDGEFVDPASVDPRDD
Ga0063101_104080123300021950MarineMDQFSRHYNIKNYDNARKIAGELGKPTPKVHSWALLNTAFTFPRIRRYQYVQENMDMLEHFEDNMNTNVSNSVNVANFVKVGKTVVGNLNAKYSNGEFADPANYDPRDDEE
Ga0063101_109202923300021950MarineMDQFSRKFNKQSYLNAVEIAGKLGVAVPKIHTWEIVDGSFTFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLAAKYHDGEFVDPASFDPRDE
Ga0063755_114738723300021954MarineLNAVEIAGKLGVPAPRIHTWEILDTSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSINVANFIKVGKTVVANLSAKYADGEFIDPASVDPRG
Ga0222716_1031660233300021959Estuarine WaterMDQFSRKFNKQNYLNAVEIADKLGAPLPRVHTWDLLDKSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLANKYADGEFVDPATIDPRDEE
Ga0228688_11569513300023565SeawaterMDQFSRKFNKQNYLNAVEIAKELGTALPRIHTWELLDKSFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVNNLSTKYHDGEFVDPATIDPRDEE
Ga0228687_101272713300023696SeawaterMDQFSRHFNLKNYENARKIAGELGKPTPKVHSWALLNTAFTFPRIRRYQYVQENMDMLEHFEDNLNTNISNSVNVANFAKVGRTVVANLNAKYHNGEFADPANYDPRDDEXINXEKEKFQLSRGKVH
Ga0209634_131904923300025138MarineMDQFSRKFNKQNYLNAVEIAKELGAPLPRIHTWELVDKSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVSNLLNKYRDGEFVDPATIDPRDEEE
Ga0247594_109148513300026448SeawaterMDQFSRKFNKQNYLNAVEIAKELGTALPRIHTWELLDKSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLAQKYQDGEFVDPATIDPRDEDN
Ga0247593_110685213300026449SeawaterMDQFSRKFNKQNYLNAVEIAKELGTALPRIHTWELLDKSFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLNTKYHDGEFVDPATIDPRDEE
Ga0247600_105775023300026461SeawaterMDQFSRKFNKQNYLNAVEIAGKLGTPLPRIHTWELLDKSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLNTKYHDGEFVDPATIDPRDEE
Ga0247598_114867723300026466SeawaterVEIAKELGTALPRVHSWELLDKSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLAQKYQDGEFVDPATID
Ga0247571_110141223300026495SeawaterMDQFSRKFNKQNYLNAVEIAGKLGVPLPRVHTWELLDGSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLLNKYRDGEFVDPATIDPRDD
Ga0247590_118064013300026513SeawaterMDQFSRKFNKQNYLNAVEIAKELGSPLPRVHTWELLDKSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLNTKYHDGEFVDPATIDPRDEE
Ga0247596_107019823300028106SeawaterMDQFSRKFNKQNYLNAVEIAKELGSPLPRVHTWELLDKSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLLNKYRDGEFVDPATIDPRDD
Ga0256411_127096713300028134SeawaterMDQFSRKFNKQNYLNAVEIAKELGAPLPRIHTWELLDKSFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLSNKYHDGEFVDPATIDPRDEE
Ga0256412_112327823300028137SeawaterMDQFSRKFNKQNYLNAVEIAGKLGVPLPRVHTWELLDGSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSINVANFIKVGKTVVANLNNKYHDGEFVDPATIDPRDE
Ga0256412_118458113300028137SeawaterMDQFSRKFNKQNYLNAVEIAGKLGTPLPRIHTWELLDKSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVNNLATKYHDGEFVDPATIDPRDEE
Ga0256412_122961113300028137SeawaterMDQFSRKFNKQNYLNAVEIAKELGSPLPRIHTWELLDKAFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLNAKYHDGEFDDPANTDPRDDXIRGGIXGKFN
Ga0256412_133332313300028137SeawaterMDQFSRKFNKQNYLNAVEIAKELGAPLPRIHTWELLDKSFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLSNKYHDGEFVDPATIDP
Ga0256413_132326113300028282SeawaterQWQMDQFSRKFNKQNYLNAVEIAKELGAPLPRIHTWELLDKSFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLSNKYHDGEFVDPATIDPRDEE
Ga0247595_108131713300028333SeawaterLWLSADEMAWQMDQFSRKFDKTNYNNAAEIASELGLKMPKVHTYELIDKAFSFPRVRRYEDVQENMTMLEHFQDNLNTNISNQINVDRFIRTGKAVVANLNEKYSNGEFADPANTDPREVQREAEA
Ga0304731_1012633713300028575MarineMDQFSRKFNKQNYLNAVEIAGKLGTAIPRIHTWELLDGSFTFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLNNKYRDGEFDDPANTDPRDE
Ga0304731_1096687923300028575MarineMDQFSRKFDIKNYNNAVFIAGKLGVPLPKIHTWALLDNAWSFRRIRRYAYVQENMDMLEHFEDNANTNISNSINIANFIKVGKTVVLNLKTKYHDGEFADPADFDPRDV
Ga0257128_110868213300028672MarineEIAGKLGAPLPRIHTWELLDTSFSFPRLRRYQFVQENMDMLEHFEDNANTNVSNSVNIANFIKVGKTVVANFNAKYHEGEYADPGAFDPREVPEQNMPEGWGE
Ga0307398_1026519323300030699MarineMDQFSRKFDIKNYNNSVFIAGKLGVPLPKIHTWKILDNAWSFRRLRRYQFVQENMDMLEHFEDNANTNISNSVNIANYVKVAKTVVANLKAKYHDGEFADPADFDPRG
Ga0307398_1039972713300030699MarineMDQFSRKFSNQSYKNAVTIAGKLGVPIPRIHSWELLDTAFTFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLNAKYHDGEFADPANTDPRDD
Ga0308138_102376523300030724MarineMDQFSRKFNKQNYLNAVEIAGKLGTALPRIHTWELLDTAFSFPRLRRYQFVQENMDMLEHFEDNANTNVSNSVNIANFIKVGRTVVANLNAKYHDGEFSDPANTDPRDA
Ga0073988_1003320513300030780MarineMDQFSRKFNKQNYLNAVEIAKELGSPLPRVHTWELLDKAFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLNAKYHDGEFDDPANHDPRDDE
Ga0073988_1233698723300030780MarineMDQFSRKFNKQNYLNAVEIAKELGAPLPRVHTWNLLDKSFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLANKYHDGEFVDPATIDPRDEEE
Ga0073980_1130816823300031032MarineMDQFSRKFNKQNYLNAVEIAKELGAPLPRVHTWDLVDKSFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLLNKYHDGEFVDPATIDPRDEE
Ga0073986_1191266813300031038MarineMDQFSRKFNKQNYLNAVEIAKELGTPLPRVHTWELLDKSFSFPRIRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLAAKYHDGEFVDPATIDPREEEKE
Ga0308149_102201213300031542MarineMDQFSRHFDLKNYDNARKIAGELGKPTPKVHSWALLNTAFTFPRIRRYQYVQENMDMLEHFEDNLNTNISNSVNDANFAKVGKTVVGNLNAKYSNGEFADPANYDPRDDEN
Ga0308149_103000513300031542MarineQNYMNAVEIAGKLGVSVPRVHTWELLDTAFSFPRIRRYQFVQENMDMLEHFEDNLNTNVSNSINVANFMKVGKTVVANLNAKYHDGEFVDPASVDPRDD
Ga0308142_106425413300031556MarineNSQENSKSKTTNAVEIAGKLGVSVPRVHTWELLDTAFSFPRIRRYQFVQENMDMLEHFEDNLNTNVSNSINVANFMKVGKTVVANLNAKYHDGEFVDPASVDPRDD
Ga0308148_102700113300031557MarineDLKNYDNARKIAGELGKPTPKVHSWALLNTAFTFPRIRRYQYVQENMDMLEHFEDNLNTNISNSVNVANFAKVGKTVVNNLKAKYSNGEFADPAAYDPRDDE
Ga0302125_1017070313300031638MarineMDQFSRKFNKQNYLNAVEIAGKLGTALPRIHTWELLDTAFSFPRLRRYQFVQENMDMLEHFEDNANTNVSNSVNIANFIKVGRTVVANLNAKYHDGEFSDPAN
Ga0307385_1024318823300031709MarineMDQFSRKFNKQNYLNAVEIAGELGAPLPRIHSWELLDKSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLNGKYHDGEFVDHPALTQEMSE
Ga0307386_1025299313300031710MarineMDQFSRKFDIKNYNNAVFIAGKLGNPLPKIHTWNLLDTAWSFRRLRRYQFVQENMDMLEHFEDNANTNISNSINIANFIKVGKTVVANLKAKYHDGEFADPADFDPRD
Ga0307386_1032227613300031710MarineMDQFSRKFNKQNYLNAVEIAGKLGTALPRIHTWELLDKSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFMKVGKTVVSNLATKYADGEFVDPATIDPRDEE
Ga0307381_1017300813300031725MarineMDQFSRKFDKKNYDNAATIAGQLGKPIPKIHSWALNDHAFTFPRLRRYQFVQENMDMLEHFEDNANTNISNTVNINNFIKVGKTVVNNLMTKYHDGEYANPADFDPRA
Ga0307391_1055773013300031729MarineAGKLGTALPKVHSWELLDVAFSFPRLRRYQFVQENMDMLEHFEDNLNTNVSNSINVANFIKVGKTVVANLNAKYSNGEFNDPANTDPRDA
Ga0307391_1084880413300031729MarineAGELGKPTPKVHSWALLNTAFTFPRIRRYQYVQENMDMLEHFEDNLNTNLSNSVNVANFIKVGKTVVTNMGAKYHNGEFADPANFDPRDEE
Ga0307397_1016955513300031734MarineMDQFSRKFDKQSYLNAVTIAGKLGSAIPRIHTWEILDGSFTFPRLRRYQFVQENMDMLEHFEDNLNTNISNSINVANFIKVGKTVVANLAAKYHDGEFVDPATVDPRD
Ga0307384_1019326213300031738MarineLDQFCRKFDKQNYLNAVEIAGKLGSSLPRIHTWELLDGAFSFPRIRRYQFVQENMDMLEHFEDNLNTNVSNSINVANFIKVGKTVVANLNAKYHDGEFVDPASYDPRKEEDKWL
Ga0307384_1026869113300031738MarineMDQFSRKFNKQNYLNAVEIAGELGAPLPRIHSWELLDKSFSFPRPRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLNGKYHDGEFVDPSSIDPRDE
Ga0314668_1038256713300032481SeawaterMDQFSRKFNKQNYLNAVEIAKELGTQLPRIHTWELLDKSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLANKYADGEFVDPATIDPRDE
Ga0314682_1041260723300032540SeawaterMDQFSRKFNKQNYLNAVEIAKELGTQLPRIHTWELLDKSFSFPRLRRYQFVQENMDMLEHFEDNLNTNISNSVNVANFIKVGKTVVANLANKYHDGEFVDPATIDPRDE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.