Basic Information | |
---|---|
Family ID | F042040 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 159 |
Average Sequence Length | 40 residues |
Representative Sequence | YRPALGTVVRCRSCDSVLMVFVKIHDRTCVDLLGLATLG |
Number of Associated Samples | 143 |
Number of Associated Scaffolds | 159 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 3.80 % |
% of genes near scaffold ends (potentially truncated) | 94.97 % |
% of genes from short scaffolds (< 2000 bps) | 88.05 % |
Associated GOLD sequencing projects | 139 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (66.038 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.786 % of family members) |
Environment Ontology (ENVO) | Unclassified (16.352 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.799 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.45% β-sheet: 23.88% Coil/Unstructured: 65.67% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 159 Family Scaffolds |
---|---|---|
PF00561 | Abhydrolase_1 | 9.43 |
PF00892 | EamA | 9.43 |
PF06628 | Catalase-rel | 2.52 |
PF01152 | Bac_globin | 2.52 |
PF03551 | PadR | 1.89 |
PF13478 | XdhC_C | 1.89 |
PF01844 | HNH | 1.26 |
PF00056 | Ldh_1_N | 1.26 |
PF13490 | zf-HC2 | 1.26 |
PF13546 | DDE_5 | 1.26 |
PF00005 | ABC_tran | 1.26 |
PF01475 | FUR | 1.26 |
PF13561 | adh_short_C2 | 1.26 |
PF01925 | TauE | 1.26 |
PF01212 | Beta_elim_lyase | 0.63 |
PF12806 | Acyl-CoA_dh_C | 0.63 |
PF10282 | Lactonase | 0.63 |
PF00753 | Lactamase_B | 0.63 |
PF13374 | TPR_10 | 0.63 |
PF08240 | ADH_N | 0.63 |
PF07690 | MFS_1 | 0.63 |
PF16483 | Glyco_hydro_64 | 0.63 |
PF01592 | NifU_N | 0.63 |
PF13193 | AMP-binding_C | 0.63 |
PF13378 | MR_MLE_C | 0.63 |
PF03450 | CO_deh_flav_C | 0.63 |
PF01935 | DUF87 | 0.63 |
PF00141 | peroxidase | 0.63 |
PF08031 | BBE | 0.63 |
PF07931 | CPT | 0.63 |
PF03971 | IDH | 0.63 |
PF03640 | Lipoprotein_15 | 0.63 |
PF03860 | DUF326 | 0.63 |
PF01828 | Peptidase_A4 | 0.63 |
PF13532 | 2OG-FeII_Oxy_2 | 0.63 |
PF00174 | Oxidored_molyb | 0.63 |
PF01042 | Ribonuc_L-PSP | 0.63 |
PF04029 | 2-ph_phosp | 0.63 |
PF00127 | Copper-bind | 0.63 |
PF12802 | MarR_2 | 0.63 |
PF01734 | Patatin | 0.63 |
PF00501 | AMP-binding | 0.63 |
PF00294 | PfkB | 0.63 |
COG ID | Name | Functional Category | % Frequency in 159 Family Scaffolds |
---|---|---|---|
COG0753 | Catalase | Inorganic ion transport and metabolism [P] | 2.52 |
COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 2.52 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.89 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.89 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 1.89 |
COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 1.26 |
COG1486 | Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase | Carbohydrate transport and metabolism [G] | 1.26 |
COG1167 | DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain | Transcription [K] | 1.26 |
COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 1.26 |
COG2045 | Phosphosulfolactate phosphohydrolase or related enzyme | Coenzyme transport and metabolism [H] | 1.26 |
COG0039 | Malate/lactate dehydrogenase | Energy production and conversion [C] | 1.26 |
COG2838 | Monomeric isocitrate dehydrogenase | Energy production and conversion [C] | 0.63 |
COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.63 |
COG4992 | Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase | Amino acid transport and metabolism [E] | 0.63 |
COG3033 | Tryptophanase | Amino acid transport and metabolism [E] | 0.63 |
COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.63 |
COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.63 |
COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.63 |
COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.63 |
COG3896 | Chloramphenicol 3-O-phosphotransferase | Defense mechanisms [V] | 0.63 |
COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.63 |
COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 0.63 |
COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.63 |
COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.63 |
COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.63 |
COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.63 |
COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 0.63 |
COG0822 | Fe-S cluster assembly scaffold protein IscU, NifU family | Posttranslational modification, protein turnover, chaperones [O] | 0.63 |
COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.63 |
COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.63 |
COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.63 |
COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.63 |
COG0376 | Catalase (peroxidase I) | Inorganic ion transport and metabolism [P] | 0.63 |
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.63 |
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.63 |
COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.63 |
COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.63 |
COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.63 |
COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.63 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 66.04 % |
Unclassified | root | N/A | 33.96 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090003|LJN_F7QKVOU01DAELT | Not Available | 515 | Open in IMG/M |
3300001544|JGI20163J15578_10861586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 508 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101339411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 608 | Open in IMG/M |
3300004091|Ga0062387_101656021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 518 | Open in IMG/M |
3300004479|Ga0062595_102100071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 549 | Open in IMG/M |
3300005336|Ga0070680_100155731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1919 | Open in IMG/M |
3300005435|Ga0070714_101927523 | Not Available | 576 | Open in IMG/M |
3300005436|Ga0070713_101906620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 576 | Open in IMG/M |
3300005439|Ga0070711_100230262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1444 | Open in IMG/M |
3300005439|Ga0070711_101418855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 604 | Open in IMG/M |
3300005471|Ga0070698_100103265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2821 | Open in IMG/M |
3300005610|Ga0070763_10730542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 582 | Open in IMG/M |
3300005614|Ga0068856_102577879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 515 | Open in IMG/M |
3300005617|Ga0068859_101203243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 834 | Open in IMG/M |
3300005712|Ga0070764_10664739 | Not Available | 639 | Open in IMG/M |
3300005764|Ga0066903_100200224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2986 | Open in IMG/M |
3300005764|Ga0066903_102602042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 981 | Open in IMG/M |
3300005993|Ga0080027_10349508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 592 | Open in IMG/M |
3300006028|Ga0070717_11465447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 619 | Open in IMG/M |
3300006163|Ga0070715_10567092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 660 | Open in IMG/M |
3300006174|Ga0075014_100716067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 584 | Open in IMG/M |
3300006755|Ga0079222_10289659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1061 | Open in IMG/M |
3300006806|Ga0079220_10888679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 689 | Open in IMG/M |
3300006871|Ga0075434_102219773 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300006903|Ga0075426_10720211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 749 | Open in IMG/M |
3300006954|Ga0079219_11797133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 573 | Open in IMG/M |
3300009098|Ga0105245_10737146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1020 | Open in IMG/M |
3300009524|Ga0116225_1485177 | Not Available | 549 | Open in IMG/M |
3300009545|Ga0105237_11654920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 647 | Open in IMG/M |
3300009623|Ga0116133_1137525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 635 | Open in IMG/M |
3300009672|Ga0116215_1064641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1652 | Open in IMG/M |
3300009698|Ga0116216_10114801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1657 | Open in IMG/M |
3300009700|Ga0116217_10618287 | Not Available | 674 | Open in IMG/M |
3300009840|Ga0126313_10764777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 785 | Open in IMG/M |
3300010152|Ga0126318_10551610 | Not Available | 552 | Open in IMG/M |
3300010154|Ga0127503_11309081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 647 | Open in IMG/M |
3300010333|Ga0134080_10265395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 761 | Open in IMG/M |
3300010358|Ga0126370_11256217 | Not Available | 692 | Open in IMG/M |
3300010366|Ga0126379_13530170 | Not Available | 524 | Open in IMG/M |
3300010379|Ga0136449_102098767 | Not Available | 829 | Open in IMG/M |
3300010396|Ga0134126_11131064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 872 | Open in IMG/M |
3300010397|Ga0134124_12128636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharothrix → Saccharothrix deserti | 600 | Open in IMG/M |
3300010401|Ga0134121_10146376 | All Organisms → cellular organisms → Bacteria | 2012 | Open in IMG/M |
3300010867|Ga0126347_1491843 | Not Available | 753 | Open in IMG/M |
3300011120|Ga0150983_12892590 | Not Available | 527 | Open in IMG/M |
3300012176|Ga0153952_1106727 | Not Available | 614 | Open in IMG/M |
3300012189|Ga0137388_10085086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2678 | Open in IMG/M |
3300012201|Ga0137365_10134441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1859 | Open in IMG/M |
3300012206|Ga0137380_10120294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2399 | Open in IMG/M |
3300012209|Ga0137379_10916759 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
3300012211|Ga0137377_11832113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 526 | Open in IMG/M |
3300013306|Ga0163162_12255238 | Not Available | 625 | Open in IMG/M |
3300014162|Ga0181538_10376850 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300014325|Ga0163163_10791610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1011 | Open in IMG/M |
3300017654|Ga0134069_1173789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 727 | Open in IMG/M |
3300017928|Ga0187806_1091093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 966 | Open in IMG/M |
3300017937|Ga0187809_10268952 | Not Available | 621 | Open in IMG/M |
3300017955|Ga0187817_10430233 | Not Available | 842 | Open in IMG/M |
3300017961|Ga0187778_11160938 | Not Available | 540 | Open in IMG/M |
3300017970|Ga0187783_10770973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → unclassified Rhodococcus → Rhodococcus sp. WB9 | 694 | Open in IMG/M |
3300017973|Ga0187780_10125741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1772 | Open in IMG/M |
3300018037|Ga0187883_10741947 | Not Available | 513 | Open in IMG/M |
3300018047|Ga0187859_10331467 | Not Available | 827 | Open in IMG/M |
3300018482|Ga0066669_10564562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 993 | Open in IMG/M |
3300020002|Ga0193730_1080872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 919 | Open in IMG/M |
3300020075|Ga0206349_1227365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 604 | Open in IMG/M |
3300020580|Ga0210403_10902960 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300020581|Ga0210399_10600934 | Not Available | 910 | Open in IMG/M |
3300020582|Ga0210395_10501777 | Not Available | 913 | Open in IMG/M |
3300020582|Ga0210395_11254568 | Not Available | 543 | Open in IMG/M |
3300020582|Ga0210395_11316439 | Not Available | 528 | Open in IMG/M |
3300020610|Ga0154015_1042013 | Not Available | 614 | Open in IMG/M |
3300021088|Ga0210404_10410984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 757 | Open in IMG/M |
3300021180|Ga0210396_10770433 | Not Available | 827 | Open in IMG/M |
3300021181|Ga0210388_10124014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2229 | Open in IMG/M |
3300021404|Ga0210389_11173744 | Not Available | 592 | Open in IMG/M |
3300021404|Ga0210389_11268576 | Not Available | 565 | Open in IMG/M |
3300021407|Ga0210383_11330731 | Not Available | 600 | Open in IMG/M |
3300021432|Ga0210384_10816718 | Not Available | 830 | Open in IMG/M |
3300021432|Ga0210384_11734642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
3300021433|Ga0210391_11036053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 638 | Open in IMG/M |
3300021474|Ga0210390_11004161 | Not Available | 682 | Open in IMG/M |
3300021475|Ga0210392_11380929 | Not Available | 527 | Open in IMG/M |
3300021479|Ga0210410_10900955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 771 | Open in IMG/M |
3300021559|Ga0210409_10627349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 944 | Open in IMG/M |
3300022528|Ga0242669_1062788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 658 | Open in IMG/M |
3300022529|Ga0242668_1074802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 649 | Open in IMG/M |
3300024181|Ga0247693_1002531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2136 | Open in IMG/M |
3300025412|Ga0208194_1046999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 669 | Open in IMG/M |
3300025588|Ga0208586_1025275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae → Microlunatus → Microlunatus flavus | 1416 | Open in IMG/M |
3300025627|Ga0208220_1141385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 619 | Open in IMG/M |
3300025634|Ga0208589_1014507 | All Organisms → cellular organisms → Bacteria | 2327 | Open in IMG/M |
3300025906|Ga0207699_10476739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 898 | Open in IMG/M |
3300025915|Ga0207693_10593803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 862 | Open in IMG/M |
3300025915|Ga0207693_10694393 | Not Available | 788 | Open in IMG/M |
3300025928|Ga0207700_11841962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 531 | Open in IMG/M |
3300025929|Ga0207664_10566748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1019 | Open in IMG/M |
3300025929|Ga0207664_11481291 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300025941|Ga0207711_11037257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 760 | Open in IMG/M |
3300025944|Ga0207661_10142414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2064 | Open in IMG/M |
3300026067|Ga0207678_10183210 | Not Available | 1788 | Open in IMG/M |
3300027609|Ga0209221_1089030 | Not Available | 799 | Open in IMG/M |
3300027812|Ga0209656_10223305 | Not Available | 903 | Open in IMG/M |
3300027817|Ga0209112_10182256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 716 | Open in IMG/M |
3300027884|Ga0209275_10889815 | Not Available | 513 | Open in IMG/M |
3300027908|Ga0209006_11225286 | Not Available | 585 | Open in IMG/M |
3300028379|Ga0268266_11573530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 633 | Open in IMG/M |
3300028742|Ga0302220_10125354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae → Nocardiopsis → Nocardiopsis chromatogenes | 992 | Open in IMG/M |
3300028789|Ga0302232_10124794 | Not Available | 1307 | Open in IMG/M |
3300028801|Ga0302226_10350718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 619 | Open in IMG/M |
3300028808|Ga0302228_10015055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4103 | Open in IMG/M |
3300028877|Ga0302235_10164718 | Not Available | 986 | Open in IMG/M |
3300029910|Ga0311369_11384209 | Not Available | 533 | Open in IMG/M |
3300030007|Ga0311338_10044069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6035 | Open in IMG/M |
3300030007|Ga0311338_11091974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 766 | Open in IMG/M |
3300030043|Ga0302306_10396017 | Not Available | 528 | Open in IMG/M |
3300030524|Ga0311357_10622362 | Not Available | 990 | Open in IMG/M |
3300030580|Ga0311355_10007261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 14646 | Open in IMG/M |
3300031543|Ga0318516_10367223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 830 | Open in IMG/M |
3300031544|Ga0318534_10046224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2428 | Open in IMG/M |
3300031544|Ga0318534_10597342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 627 | Open in IMG/M |
3300031640|Ga0318555_10341598 | Not Available | 811 | Open in IMG/M |
3300031640|Ga0318555_10429516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 716 | Open in IMG/M |
3300031681|Ga0318572_10260785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1020 | Open in IMG/M |
3300031682|Ga0318560_10271628 | Not Available | 912 | Open in IMG/M |
3300031708|Ga0310686_106566963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6423 | Open in IMG/M |
3300031718|Ga0307474_10439898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1018 | Open in IMG/M |
3300031747|Ga0318502_10232214 | Not Available | 1073 | Open in IMG/M |
3300031753|Ga0307477_10834636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 611 | Open in IMG/M |
3300031754|Ga0307475_10704355 | Not Available | 805 | Open in IMG/M |
3300031765|Ga0318554_10062981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2047 | Open in IMG/M |
3300031765|Ga0318554_10353630 | Not Available | 835 | Open in IMG/M |
3300031779|Ga0318566_10130958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1240 | Open in IMG/M |
3300031796|Ga0318576_10559751 | Not Available | 539 | Open in IMG/M |
3300031805|Ga0318497_10533803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 657 | Open in IMG/M |
3300031821|Ga0318567_10831744 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300031823|Ga0307478_11463860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 566 | Open in IMG/M |
3300031833|Ga0310917_10996030 | Not Available | 562 | Open in IMG/M |
3300031859|Ga0318527_10116270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 1107 | Open in IMG/M |
3300031859|Ga0318527_10254854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 746 | Open in IMG/M |
3300031890|Ga0306925_11124680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 792 | Open in IMG/M |
3300031946|Ga0310910_11359825 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300031959|Ga0318530_10353028 | Not Available | 609 | Open in IMG/M |
3300031962|Ga0307479_10667637 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
3300031996|Ga0308176_12854426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 513 | Open in IMG/M |
3300032160|Ga0311301_10234157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3064 | Open in IMG/M |
3300032160|Ga0311301_10419065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2038 | Open in IMG/M |
3300032160|Ga0311301_11443652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 854 | Open in IMG/M |
3300032160|Ga0311301_11694745 | Not Available | 761 | Open in IMG/M |
3300032805|Ga0335078_11674996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 699 | Open in IMG/M |
3300032828|Ga0335080_12356232 | Not Available | 508 | Open in IMG/M |
3300032895|Ga0335074_10240351 | All Organisms → cellular organisms → Bacteria | 2146 | Open in IMG/M |
3300032896|Ga0335075_11208814 | Not Available | 655 | Open in IMG/M |
3300032954|Ga0335083_10396186 | Not Available | 1181 | Open in IMG/M |
3300033134|Ga0335073_11119425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 800 | Open in IMG/M |
3300033289|Ga0310914_11834147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → unclassified Streptacidiphilus → Streptacidiphilus sp. P02-A3a | 511 | Open in IMG/M |
3300033407|Ga0214472_10658568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 956 | Open in IMG/M |
3300033475|Ga0310811_10959518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 758 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.79% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.92% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.29% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.66% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.77% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.14% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.14% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.14% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.89% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.89% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.89% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.89% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.89% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.89% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.89% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.89% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.26% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.26% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.26% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.26% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.26% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.26% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.26% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.26% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.26% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.63% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.63% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.63% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.63% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.63% |
Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.63% |
Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.63% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.63% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.63% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.63% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.63% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.63% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.63% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.63% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.63% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.63% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.63% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.63% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090003 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN | Host-Associated | Open in IMG/M |
3300001544 | Cubitermes ugandensis P1 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P1 | Host-Associated | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012176 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ036 MetaG | Host-Associated | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
3300025588 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025634 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
LJN_01465660 | 2088090003 | Quercus Rhizosphere | PGLGQVVRCRSCDSVLMVFIEARGLICVDLSGLASLG |
JGI20163J15578_108615861 | 3300001544 | Termite Gut | RLIVYRQAPGTVVRCPSCRSVLMVFVQKRGVACVDLMGLASLS* |
JGIcombinedJ26739_1013394112 | 3300002245 | Forest Soil | ARQVGELAVYAHAPGTVVRCPSCDNVLMVFVKIHDRTCVDLMGLAALG* |
Ga0062387_1016560212 | 3300004091 | Bog Forest Soil | TVVRCRHCDNLLMTFVTIRGVTCVDLGGLVALEHDETAS* |
Ga0062595_1021000711 | 3300004479 | Soil | LRAPGTVVRCRSCLNVLLVLVTAHGTTCVDLGGLVALERER* |
Ga0070680_1001557311 | 3300005336 | Corn Rhizosphere | YRPGLGTVVRCRSCDSVLMVFVSLHGTTCTDLMGLASLS* |
Ga0070714_1019275232 | 3300005435 | Agricultural Soil | AELAVYRPGLGTVVRCRSCDSVLMVFVSLHGTTCTDLMGLASLS* |
Ga0070713_1019066201 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | AVYRPGLGTVVRCRSCDSVLMVFVSLHGTTCTDLMGLASLS* |
Ga0070711_1002302622 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | ELAVYLTDLGAVVRCRSCGSVLMVFVSRREVTCVDLMGLASLS* |
Ga0070711_1014188551 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | GAVSVVAELAVYRPGLGTVVRCRSCDSVLMVFVSLHGTTCTDLMGLASLS* |
Ga0070698_1001032656 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | GAVSQVAELAVYRPALGTVVRCRNCNAVLMTFVRIRGITCVDLQGLASLT* |
Ga0070763_107305422 | 3300005610 | Soil | PGTVVRCRSCDSVLMVFVKVHDRTCVDLLGLAVLG* |
Ga0068856_1025778791 | 3300005614 | Corn Rhizosphere | LGTVVRCRSCDAMLMTFVRIRGVVCVDLMGLASLG* |
Ga0068859_1012032431 | 3300005617 | Switchgrass Rhizosphere | GLGTVVRCRSCDSVLMVFVSLHGTTCTDLMGLASLS* |
Ga0070764_106647391 | 3300005712 | Soil | GTVVRCRSCDSVLMVFVKVHERTCVDLLGLASLG* |
Ga0066903_1002002243 | 3300005764 | Tropical Forest Soil | VYRPGLGTVVRCRTCGSVLMVLAQFRGITCVDLPGLAALG* |
Ga0066903_1026020421 | 3300005764 | Tropical Forest Soil | AELVVYRPALGTVVRCRLCGNVLMVFTQIRGITCVDMQGIAEMN* |
Ga0080027_103495081 | 3300005993 | Prmafrost Soil | LRAPGTVVRCRTCDSVLMVFVKTHQRTCVDLLGLAALG* |
Ga0070717_114654471 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LAVYRPGLGTVVRCRSCDSVLMVFVSLHGTTCTDLMGLASLS* |
Ga0070715_105670922 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | LGTVVRCRSCDSVLMVFVSLHGTTCTDLMGLASLS* |
Ga0075014_1007160672 | 3300006174 | Watersheds | ALGTVVRCRTCDAVLMAFVRIHSVTCVDLQGLASLA* |
Ga0079222_102896593 | 3300006755 | Agricultural Soil | AVYMPELGTVVRCRSCDAMLMTFVRIRGVVCVDLMGLASLG* |
Ga0079220_108886792 | 3300006806 | Agricultural Soil | DLGAVVRCRSCGSVLMVFVSRREITCVDLMGLASLS* |
Ga0075434_1022197731 | 3300006871 | Populus Rhizosphere | AVSVVAELAVYRPGLGTVVRCRSCDSVLMVFVSLHGTTCTDLMGLTSLG* |
Ga0075426_107202111 | 3300006903 | Populus Rhizosphere | YLSELGAVVRCRSCDSVLMVFVSVREVVCVDLMGLASLS* |
Ga0079219_117971331 | 3300006954 | Agricultural Soil | LGAVVRCRSCDSVLMVFVSVREVVCVDLMGLASLS* |
Ga0105245_107371462 | 3300009098 | Miscanthus Rhizosphere | VYRPGLGTVVRCRSCDSVLMVFVSLHGTTCTDLMGLASLS* |
Ga0116225_14851772 | 3300009524 | Peatlands Soil | ALGTVVRCRACDAVLMTFVQIHGVTCVDLQGLASLA* |
Ga0105237_116549202 | 3300009545 | Corn Rhizosphere | GTVVRCRSCDSVLMVFVSLHGTTCTDLMGLASLS* |
Ga0116133_11375252 | 3300009623 | Peatland | ELAVYLQAPGTVVRCQSCDSILMVFVKMHDRTCVDLMGLAALG* |
Ga0116215_10646413 | 3300009672 | Peatlands Soil | RSALGTVVRCRACDAVLMTFVQIHGVTCVDLQGLASLA* |
Ga0116216_101148011 | 3300009698 | Peatlands Soil | LGTVVRCRACDAVLMTFVQIHGVTCVDLQGLASLA* |
Ga0116217_106182871 | 3300009700 | Peatlands Soil | VNRPGLGTVVRCRTCDAVLIVFLPVRGITCVDLQGLASLT* |
Ga0126313_107647773 | 3300009840 | Serpentine Soil | AVARCRSCRGLLAVLVEVRGVTCVDLTGLASLERS* |
Ga0126373_113636691 | 3300010048 | Tropical Forest Soil | YQRAPGTVVRCRSCGAVLMVVVRHRQQNCVDLLGLAALET* |
Ga0126318_105516102 | 3300010152 | Soil | VAELAVYRPGPGTVVRCPSCDSVLMVFVTIRGTTCVDLRGLARLGAGT* |
Ga0127503_113090812 | 3300010154 | Soil | LRGPGTVVRCRSCGSVLMVFVTIHDRTCVDLMGLAVLG* |
Ga0134080_102653952 | 3300010333 | Grasslands Soil | LGLGTVVRCRSCQNVLMVFVSLHGTTCTDLMGLASMG* |
Ga0126370_112562172 | 3300010358 | Tropical Forest Soil | MPELGIVVRCRSCNAVLMVFVRIHEVTCVDLEGLASLS* |
Ga0126379_135301701 | 3300010366 | Tropical Forest Soil | VYRPGLGTVVRCRTCGSVLMVLAQFRGITCVDRPGLAALG* |
Ga0136449_1020987671 | 3300010379 | Peatlands Soil | ALGTVVRCRACDAVLMTFVQIHGVTCVDLQGLAGLA* |
Ga0134126_111310642 | 3300010396 | Terrestrial Soil | TRQVAELAVYAYAHAPGTVVRCPSCDSVLMVFVKIHDRTCVDLLGLAALG* |
Ga0134124_121286361 | 3300010397 | Terrestrial Soil | PGLGTVVRCRSCDSVLMVFVSLHGTTCTDLMGLASLS* |
Ga0134121_101463762 | 3300010401 | Terrestrial Soil | YRPGLGTVVRCRSCDSVLMVFVSLHGATCTDLMGLASLS* |
Ga0126347_14918431 | 3300010867 | Boreal Forest Soil | LGTVVRCRSCDSVLMVFVTIHDRTCVDLMGIAVLG* |
Ga0150983_128925902 | 3300011120 | Forest Soil | VYLRAPGTVVRCRSCESVLMVFVTVHDRTCVDLMGLAALG* |
Ga0153952_11067271 | 3300012176 | Attine Ant Fungus Gardens | GVCGTRGQVAEMPVYQGRMGSVVRCRVCDNVLMVFVEVRGITCVDLSGLASLS* |
Ga0137388_100850864 | 3300012189 | Vadose Zone Soil | LAVYRPALGTVVRCRNCGAVLMTFVRIRGIVCVDLEGLASLT* |
Ga0137365_101344413 | 3300012201 | Vadose Zone Soil | TVVRCRSCGSVLMVLVRRADVIGVDLSGLADLSC* |
Ga0137380_101202943 | 3300012206 | Vadose Zone Soil | EIGTVVRCRSCQSVLMVFVSVRGVTFVELMGLASLS* |
Ga0137379_109167591 | 3300012209 | Vadose Zone Soil | GTVVRCRACGNVLMVFARHRRMMCVDLGGLADLAA* |
Ga0137377_118321131 | 3300012211 | Vadose Zone Soil | LRAPGTVVRCRSCCSVMMVLVTVQGTTCVDLRGLARLERL* |
Ga0163162_122552381 | 3300013306 | Switchgrass Rhizosphere | VSVVAELAVYRPGLGTVVRCRSCDSVLMVFVSLHGTTCTDLMGLASLS* |
Ga0181538_103768502 | 3300014162 | Bog | LGTVVRCRTCDAVLMTFVQIHGVTCVDLQGLASLA* |
Ga0163163_107916103 | 3300014325 | Switchgrass Rhizosphere | PGTVVRCPNCDSVLMVFVIAHGLICVDLTGLASLG* |
Ga0134069_11737892 | 3300017654 | Grasslands Soil | LTEIGTVVRCRSCQSVLMVFVSVRGITCVDLMGLASLS |
Ga0187806_10910934 | 3300017928 | Freshwater Sediment | GTVVRCRTCGSVLMMLVRRRDVTSVDLSGLARLSQPGSALSRQAG |
Ga0187809_102689522 | 3300017937 | Freshwater Sediment | YQPKLGTVVRCRSCDNVLMVFVEVRGVTCVDLRGLAQLA |
Ga0187817_104302332 | 3300017955 | Freshwater Sediment | GTVVRCRSCDNVLMVFVEVRGVTCVDLQGLASLTST |
Ga0187778_111609381 | 3300017961 | Tropical Peatland | RTCTVVRCRACDAVLMAFVQIRGVTCVDLQGLASLT |
Ga0187783_107709731 | 3300017970 | Tropical Peatland | TVYLRAPGTVVRCRTCDTVLMVFVTTHNRTCVDLQGLAVFG |
Ga0187780_101257413 | 3300017973 | Tropical Peatland | ELAVNRPGLGTVVRCRTCDAVLMVVLPVRGSTCVDVQGLASLT |
Ga0187883_107419471 | 3300018037 | Peatland | AVSQVAELAVYRHGLGTVVRCRGCESILMVFVRVRGITGVDLQGLASLTPPDIGA |
Ga0187859_103314672 | 3300018047 | Peatland | PGTVVRCRSCDSVLMVFVRIHDRTCVDLLGLAALG |
Ga0066669_105645621 | 3300018482 | Grasslands Soil | RGPGTVVRCRSCGNVLMVFVTIHDRTCVDLMGLASLG |
Ga0193730_10808723 | 3300020002 | Soil | GFRLRGPGTVVRCRSCDSVLMVFVTIHDRTCVDLMGLATLG |
Ga0206349_12273652 | 3300020075 | Corn, Switchgrass And Miscanthus Rhizosphere | ASGPVAGLAVYGPAPGTVVRCPNCDSVLMVFIVAHGLICVDLTGLASLG |
Ga0210403_109029602 | 3300020580 | Soil | APGTVVRCRTCGNVLMVFAEVHGRNCVDLRGLAALEAV |
Ga0210399_106009342 | 3300020581 | Soil | QVAEMPVYQARMGAVVRCRVCDNVLMVFVEVRGITCVDLSGLASLS |
Ga0210395_105017772 | 3300020582 | Soil | YRPGLGTVVRCRTCEAILMTFVQIHGVTCVDLQGLASLA |
Ga0210395_112545681 | 3300020582 | Soil | PGRVVRCRTCDNVLMVFVTIHDRTCVDLQGLAVLG |
Ga0210395_113164391 | 3300020582 | Soil | YQARMGAVVRCRVCDNVLMVFVEVRGITCVDLSGLASLS |
Ga0154015_10420132 | 3300020610 | Corn, Switchgrass And Miscanthus Rhizosphere | LGTVVRCRSCDSVLMVFVKIHNRICVDLLGLAALG |
Ga0210404_104109841 | 3300021088 | Soil | VYLTDLGAVVRCRSCGSVLMVFVSRREVTCVDLMGLASLS |
Ga0210396_107704332 | 3300021180 | Soil | GQVAEMAVYQPRLGTVVRCRVCDNVLMVFVAIGGVTCVDLRGLASLS |
Ga0210388_101240141 | 3300021181 | Soil | VYRPALGTVVRCRSCDSVLMVFVKIHDRTCVDLLGLATLG |
Ga0210389_111737442 | 3300021404 | Soil | VGELAVYAQAPGTVVRCPSCDNVLMVFVKIHDRTCVDLLGLAALG |
Ga0210389_112685762 | 3300021404 | Soil | VYRPGPGTVVRCRSCDSVLMVFVSLHGTTCTDLMGLASLS |
Ga0210383_113307311 | 3300021407 | Soil | GRVSQVAELAVYRSTLGTVVRCRSCDAVLMAFVQIHDVTCVDLLGLASLT |
Ga0210384_108167182 | 3300021432 | Soil | VAEMPVYQARMGAVVRCRVCDNVLMVFVEVRGITCVDLSGLASLS |
Ga0210384_117346421 | 3300021432 | Soil | PVAELVVYRPGLGTVVRCRVCGCVLMVFTQVRGITCVDLQGLAALN |
Ga0210391_110360531 | 3300021433 | Soil | GTARQVGELAVYAHAPGTVVRCPSCDNVLMVFVKIHDRTCVDLLGLASLG |
Ga0210390_110041611 | 3300021474 | Soil | GSVGQVAEFAVYMPGLGTVVRCRVCNAVLMAFVQIRGIHCVDLEGLASLT |
Ga0210392_113809292 | 3300021475 | Soil | VARCRSCQSVLMVFTEVRRVTCVDLMGLASLSYGPN |
Ga0210410_109009552 | 3300021479 | Soil | VYLSHLGAVVRCRSCGSVLMVFVSRREVTCVDLMGLASLS |
Ga0210409_106273492 | 3300021559 | Soil | LGAVVRCRSCGSVLMVFVSRREVTCVDLMGLASLS |
Ga0242669_10627882 | 3300022528 | Soil | GPVAGLAVYAQGPGTVVRCPACDSVLMVFVTMHSLVCVDLSGLASLGQGGS |
Ga0242668_10748022 | 3300022529 | Soil | QVGELAVYAHAPGTVVRCPSCDNVLMVFVKIHDRTCVDLLGLAALG |
Ga0247693_10025311 | 3300024181 | Soil | SVVAELAVYRPGLGTVVRCRSCDSVLMVFVSLHGTTCTDLMGLASLS |
Ga0208194_10469991 | 3300025412 | Peatland | YLQAPGTVVRCQSCDSILMVFVKMHDRTCVDLMGLAALG |
Ga0208586_10252753 | 3300025588 | Arctic Peat Soil | LLVYLRAPGTVVRCPTCDNLLMAFVTVHDRMCVDLQGLAVLG |
Ga0208220_11413851 | 3300025627 | Arctic Peat Soil | PGTVVRCPTCDNLLMVFVTVHDRMCVDLQGLAVLG |
Ga0208589_10145071 | 3300025634 | Arctic Peat Soil | LVYLRAPGTVVRCPTCDNLLMVFVTVHDRMCIDLQGLAVLG |
Ga0207699_104767392 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | AVYRPGLGTVVRCRSCDSVLMVFVSLHGTTCTDLMGLASLS |
Ga0207693_105938031 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | ELAVYLTDLGAVVRCRSCGSVLMVFVSRREVTCVDLMGLASLS |
Ga0207693_106943932 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VVYMPGLGTVVRCRSCDAMLMTFVQIRGVVCVDLEGLASLG |
Ga0207700_118419621 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | GLGTVVRCRSCDSVLMVFVSLHGTTCTDLMGLASLS |
Ga0207664_105667481 | 3300025929 | Agricultural Soil | VAGLAVYGPAPGTVVRCPNCDSVLMVFVVAHGLICVDLTGLASLG |
Ga0207664_114812911 | 3300025929 | Agricultural Soil | LAVYLTDLGAVVRCRSCGSVLMVFVSRREVTCVDLMGLASLS |
Ga0207711_110372572 | 3300025941 | Switchgrass Rhizosphere | PGLGTVVRCRSCDSVLMVFVSLHGTTCTDLMGLASLS |
Ga0207661_101424141 | 3300025944 | Corn Rhizosphere | GPAPGTVVRCPNCDSVLMVFVIAHGLICVDLTGLASLG |
Ga0207678_101832104 | 3300026067 | Corn Rhizosphere | LAVYAHAPGTVVRCRSCDSVLMVFVKIHNRTCVDLLGLAALG |
Ga0209221_10890302 | 3300027609 | Forest Soil | LRAPGTVVRCRSCESILMVFVKIHDRTCVDLLGLAALG |
Ga0209656_102233052 | 3300027812 | Bog Forest Soil | GLGTVVRCRSCDAVLMTFVQIHSVTCVDLQGLASLA |
Ga0209112_101822562 | 3300027817 | Forest Soil | VAELPVYQARLGTVVRCRACASVLMVFVQVRGTYCVDLEGLASLS |
Ga0209275_108898151 | 3300027884 | Soil | YLRAPGTVVRCRSCESVLMVFVTIHDRTCVDLLGLAALG |
Ga0209006_112252861 | 3300027908 | Forest Soil | PGTVVRCRSCESVLMVFVKVHDRTCVDLLGLAALG |
Ga0268266_115735301 | 3300028379 | Switchgrass Rhizosphere | YRPGLGTVVRCRSCDSVLMVFVSLHGTTCTDLMGLASLS |
Ga0302220_101253541 | 3300028742 | Palsa | LAVYRPALGTVVRCRSCDSVLMVFVKIHDRTCVDLLGLATLG |
Ga0302232_101247941 | 3300028789 | Palsa | LAVYLRAPGTVVRCRSCDSVLMVFVTIHDRTCVDLLGLAVLG |
Ga0302226_103507181 | 3300028801 | Palsa | YRPALGTVVRCRSCDSVLMVFVKIHDRTCVDLLGLATLG |
Ga0302228_100150557 | 3300028808 | Palsa | VSQVAELAVYLPGLGTVVRCRGCGSVLMVFVRVRGVICVDTEGLASLTPA |
Ga0302235_101647181 | 3300028877 | Palsa | PGTVVRCRTCDSVLMVLVRRKDVTSVDLSGLADLSQR |
Ga0311369_113842092 | 3300029910 | Palsa | LRAPGTVVRCRSCDSVLMVFVTIHDRTCVDLLGLAVLG |
Ga0311338_100440696 | 3300030007 | Palsa | LQAPGTVVRCRTCDSVLMVFVTVHERTCVDLQGLAALG |
Ga0311338_110919742 | 3300030007 | Palsa | SRVAELAVHQVTMGAVVCCRACASALMVFVQVRGIHCVDLWGLASLG |
Ga0302306_103960171 | 3300030043 | Palsa | GTVVRCRGCGSVLMVFVRVRGVICVDTEGLASLTPA |
Ga0311357_106223622 | 3300030524 | Palsa | APGTVVRCRTCDSVLMVLVRRKDVTSVDLSGLADLSQR |
Ga0311355_1000726114 | 3300030580 | Palsa | ALGTVVRCRSCDSVLMVFVKIHDRTCVDLLGLATLG |
Ga0318516_103672231 | 3300031543 | Soil | YRPDLGIVVRCRSCDSVLMVFATVRGVTCVDLMGVASMT |
Ga0318534_100462241 | 3300031544 | Soil | AVYRPRLGTVVRCRVCDNVLMVFVEVRGVHCVDLHGLASMS |
Ga0318534_105973421 | 3300031544 | Soil | VYLRAPGTVVRCRACTRVLMVFVGVRGRNCVDLTGLAALEVV |
Ga0318555_103415982 | 3300031640 | Soil | YMPGLGIVVRCRSCQSVLMVFTGVRQVTCVDLMGLASLG |
Ga0318555_104295161 | 3300031640 | Soil | MPGQVAEFAVYRPGLGTVVRCRVCDNALMVFVEAHGVTCVDLQGLASLS |
Ga0318572_102607852 | 3300031681 | Soil | YIPGLGIVVRCRSCESVLMVFTGVRQVTCVDLMGLASLG |
Ga0318560_102716281 | 3300031682 | Soil | LGTVVRCRKCDNVLMVFVEVRGVTCVDLWGLAQLA |
Ga0310686_1065669635 | 3300031708 | Soil | MVYLDAPGTVVRCRHCESVLMVFVRAYGRGCVDLRGLAALEVR |
Ga0307474_104398981 | 3300031718 | Hardwood Forest Soil | APGTIVRCRTCDNVLMAFVTVHDRMCVDLQGLAVLG |
Ga0318502_102322142 | 3300031747 | Soil | RPDLGTVVRCRHCDNVLMVLVQMHGVTCVDTRGLASLS |
Ga0307477_108346362 | 3300031753 | Hardwood Forest Soil | PKLGTVVRCRVCDNVLMVFVEVRGVTCVDLHGLAQLA |
Ga0307475_107043552 | 3300031754 | Hardwood Forest Soil | YRSELGSVVRCRVCDNVLMVFVAIHGVTCVDLRGLASLS |
Ga0318554_100629813 | 3300031765 | Soil | AELAVYRPDLGTVVRCRHCDNVLMVLVQMHGVTCVDTRGLASLS |
Ga0318554_103536301 | 3300031765 | Soil | VYRPGLGTVVRCRACGAVLMAFVRIHNVTCVDLQGLASLT |
Ga0318566_101309583 | 3300031779 | Soil | YRPGLGTVVRCRACGAVLMAFVRIHNVTCVDLQGLASLT |
Ga0318576_105597512 | 3300031796 | Soil | PQEPHLPVAELAVYRPELGTVVRCRHCDNVLMVFVQIRGITCVDMRGLASLT |
Ga0318497_105338033 | 3300031805 | Soil | PGLGTVARCRSCESVLMVFTEVHRVTCVDLMGLASLAQGPS |
Ga0318567_108317442 | 3300031821 | Soil | LGTVARCRVCDNTLMVFVEVRGVTCVDLRGLAQLA |
Ga0307478_114638602 | 3300031823 | Hardwood Forest Soil | SGPVAGLAVYAQGPGTVVRCPACDSVLMVFVTMHSLVCVDLSGLASLGQGGD |
Ga0310917_109960302 | 3300031833 | Soil | YRQAPGTVVRCRTCGSVLMVFVTRHGVTGVDLPGLASLSPPG |
Ga0318527_101162702 | 3300031859 | Soil | GQVAELAVYRPGLGTVVRCRHCDNVLMVFVQIRGITCVDMRGLASLT |
Ga0318527_102548542 | 3300031859 | Soil | AVYQPKLGTVVRCRACDNVLMVFVQVRGVTCVDLRGLAQLA |
Ga0306925_111246803 | 3300031890 | Soil | GTVARCRSCESVLMVFTEVHRVTCVDLMGLASLAQGPS |
Ga0310910_113598252 | 3300031946 | Soil | LGIVVRCRSCESVLMVFTGVRQVTCVDLMGLASLG |
Ga0318530_103530281 | 3300031959 | Soil | APGTVVRCRTCGSVLMVFVTRHGVTGVDLPGLASLSPPG |
Ga0307479_106676371 | 3300031962 | Hardwood Forest Soil | PGTVVRCRTCGSVLMVFVKAYGVTCVDLSGLASLDQL |
Ga0308176_128544262 | 3300031996 | Soil | MEAVDGNAIRCRSCGSVLMVFVTIHDRTCVDLTGLAALG |
Ga0311301_102341571 | 3300032160 | Peatlands Soil | YRSALGTVVRCRACDAVLMTFVQIHGVTCVDLQGLASLA |
Ga0311301_104190651 | 3300032160 | Peatlands Soil | ALGTIVRCRSCDAVLMAFVQIHSVTCVDLQGLASLT |
Ga0311301_114436521 | 3300032160 | Peatlands Soil | AVYQPGLGTVVRCRHCESVLMVFVRARGVTCVDLWGLASLA |
Ga0311301_116947451 | 3300032160 | Peatlands Soil | VYRSALGTVVRCRTCDAVLMTFVQIHGVTCVDLQGLASLA |
Ga0335078_116749961 | 3300032805 | Soil | RPGLGTVVRCRSCDNALMVFVQIRGVTCVDLRGLAQLA |
Ga0335080_123562321 | 3300032828 | Soil | AVYLRAPGTVVRCPSCGSVLMTFVQVHEVWSVDMRGLAELEL |
Ga0335074_102403511 | 3300032895 | Soil | QAPGTVVRCRSCDSVLMVLVKTHEQTCVDLLGLAALG |
Ga0335075_112088141 | 3300032896 | Soil | LRAPGTVVRCRSCGSVLMVFVTIHDRTCVDLMGLAALG |
Ga0335083_103961862 | 3300032954 | Soil | VAELAVYQPGLGTVVRCRSCDAVLMAFVRIHDVTCVDLAGLASLT |
Ga0335073_111194251 | 3300033134 | Soil | VYAHAPGTVVRCPSCDSVLMVFVTMHDRTCVDLMGLAALG |
Ga0310914_118341472 | 3300033289 | Soil | VVYGRAPGTVVRCRSCGAILMVFTHVHDVICVDLAGLAELG |
Ga0214472_106585681 | 3300033407 | Soil | PGTVVRCRSCSSVLIVIVDVRGTNCVDLRGLADLER |
Ga0310811_109595182 | 3300033475 | Soil | PVAGLAVYRLAPGTVVRCPNCDSVLMAFVQAHSLVCVDLSGLASLG |
⦗Top⦘ |