| Basic Information | |
|---|---|
| Family ID | F041892 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 159 |
| Average Sequence Length | 44 residues |
| Representative Sequence | GPLYAARVETQGQNSVVSIIPAASALTTISLPPVRDSYDAISP |
| Number of Associated Samples | 140 |
| Number of Associated Scaffolds | 158 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.26 % |
| % of genes near scaffold ends (potentially truncated) | 98.74 % |
| % of genes from short scaffolds (< 2000 bps) | 94.34 % |
| Associated GOLD sequencing projects | 137 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.761 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.673 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.415 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.767 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.63% β-sheet: 22.54% Coil/Unstructured: 71.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 158 Family Scaffolds |
|---|---|---|
| PF06262 | Zincin_1 | 58.86 |
| PF13561 | adh_short_C2 | 16.46 |
| PF12005 | DUF3499 | 3.80 |
| PF00999 | Na_H_Exchanger | 3.16 |
| PF02880 | PGM_PMM_III | 1.90 |
| PF02878 | PGM_PMM_I | 1.90 |
| PF12680 | SnoaL_2 | 1.90 |
| PF00149 | Metallophos | 1.27 |
| PF03966 | Trm112p | 1.27 |
| PF13472 | Lipase_GDSL_2 | 1.27 |
| PF00009 | GTP_EFTU | 0.63 |
| PF00440 | TetR_N | 0.63 |
| COG ID | Name | Functional Category | % Frequency in 158 Family Scaffolds |
|---|---|---|---|
| COG3824 | Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domain | Posttranslational modification, protein turnover, chaperones [O] | 58.86 |
| COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 3.80 |
| COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 3.80 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 3.16 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 3.16 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 3.16 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 3.16 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 3.16 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.76 % |
| Unclassified | root | N/A | 18.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459012|GOYVCMS01EW8ME | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 535 | Open in IMG/M |
| 2170459021|G14TP7Y02JDHVE | Not Available | 522 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10295162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 659 | Open in IMG/M |
| 3300004635|Ga0062388_102709104 | Not Available | 522 | Open in IMG/M |
| 3300005163|Ga0066823_10069132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 674 | Open in IMG/M |
| 3300005174|Ga0066680_10332556 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300005184|Ga0066671_10931723 | Not Available | 549 | Open in IMG/M |
| 3300005329|Ga0070683_100731657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 948 | Open in IMG/M |
| 3300005364|Ga0070673_100388532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1245 | Open in IMG/M |
| 3300005566|Ga0066693_10294133 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300005568|Ga0066703_10723193 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300005602|Ga0070762_10016640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3777 | Open in IMG/M |
| 3300005840|Ga0068870_10366251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 929 | Open in IMG/M |
| 3300006034|Ga0066656_10523798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 772 | Open in IMG/M |
| 3300006059|Ga0075017_101318570 | Not Available | 567 | Open in IMG/M |
| 3300006176|Ga0070765_100359533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1354 | Open in IMG/M |
| 3300006573|Ga0074055_11700226 | Not Available | 523 | Open in IMG/M |
| 3300006577|Ga0074050_10008764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1247 | Open in IMG/M |
| 3300006804|Ga0079221_11576224 | Not Available | 530 | Open in IMG/M |
| 3300006893|Ga0073928_10198810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1572 | Open in IMG/M |
| 3300006904|Ga0075424_101465045 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300006904|Ga0075424_102171485 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300006954|Ga0079219_12030370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 548 | Open in IMG/M |
| 3300007076|Ga0075435_100479112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1075 | Open in IMG/M |
| 3300007265|Ga0099794_10537211 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300009522|Ga0116218_1070119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1595 | Open in IMG/M |
| 3300009665|Ga0116135_1408721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
| 3300010147|Ga0126319_1490056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 611 | Open in IMG/M |
| 3300010343|Ga0074044_10391974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 910 | Open in IMG/M |
| 3300010375|Ga0105239_13524326 | Not Available | 509 | Open in IMG/M |
| 3300010399|Ga0134127_10273880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1612 | Open in IMG/M |
| 3300010880|Ga0126350_11444741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1220 | Open in IMG/M |
| 3300011120|Ga0150983_14521136 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300012207|Ga0137381_11366195 | Not Available | 601 | Open in IMG/M |
| 3300012357|Ga0137384_10096905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2460 | Open in IMG/M |
| 3300012384|Ga0134036_1201704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 598 | Open in IMG/M |
| 3300012404|Ga0134024_1214820 | Not Available | 658 | Open in IMG/M |
| 3300012404|Ga0134024_1214820 | Not Available | 658 | Open in IMG/M |
| 3300012496|Ga0157353_1019996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 638 | Open in IMG/M |
| 3300012499|Ga0157350_1012134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 751 | Open in IMG/M |
| 3300012971|Ga0126369_12092508 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300014157|Ga0134078_10360597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 642 | Open in IMG/M |
| 3300015356|Ga0134073_10265314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 599 | Open in IMG/M |
| 3300015374|Ga0132255_103806364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 641 | Open in IMG/M |
| 3300016341|Ga0182035_11726355 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300016371|Ga0182034_10607833 | Not Available | 923 | Open in IMG/M |
| 3300016387|Ga0182040_11677407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 542 | Open in IMG/M |
| 3300016404|Ga0182037_11481651 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300016422|Ga0182039_11509792 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300017821|Ga0187812_1056536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1315 | Open in IMG/M |
| 3300017821|Ga0187812_1104992 | Not Available | 922 | Open in IMG/M |
| 3300017924|Ga0187820_1089937 | Not Available | 872 | Open in IMG/M |
| 3300017924|Ga0187820_1125733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 755 | Open in IMG/M |
| 3300017928|Ga0187806_1040194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae | 1404 | Open in IMG/M |
| 3300017946|Ga0187879_10802616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
| 3300017970|Ga0187783_10246483 | Not Available | 1307 | Open in IMG/M |
| 3300017970|Ga0187783_10296822 | Not Available | 1179 | Open in IMG/M |
| 3300017970|Ga0187783_11039418 | Not Available | 590 | Open in IMG/M |
| 3300017970|Ga0187783_11153756 | Not Available | 558 | Open in IMG/M |
| 3300018001|Ga0187815_10414937 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300018037|Ga0187883_10254723 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300018047|Ga0187859_10136228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1298 | Open in IMG/M |
| 3300019240|Ga0181510_1284394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 575 | Open in IMG/M |
| 3300021180|Ga0210396_11678898 | Not Available | 517 | Open in IMG/M |
| 3300021404|Ga0210389_10135503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1906 | Open in IMG/M |
| 3300021407|Ga0210383_10369040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1238 | Open in IMG/M |
| 3300021407|Ga0210383_10609878 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300021444|Ga0213878_10076969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1334 | Open in IMG/M |
| 3300021559|Ga0210409_10870559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 774 | Open in IMG/M |
| 3300022467|Ga0224712_10364908 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300022557|Ga0212123_10705578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 620 | Open in IMG/M |
| 3300022724|Ga0242665_10369300 | Not Available | 518 | Open in IMG/M |
| 3300024225|Ga0224572_1071659 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300024232|Ga0247664_1006089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2754 | Open in IMG/M |
| 3300025898|Ga0207692_11212831 | Not Available | 501 | Open in IMG/M |
| 3300025899|Ga0207642_10882529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 572 | Open in IMG/M |
| 3300025908|Ga0207643_10093181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1758 | Open in IMG/M |
| 3300025913|Ga0207695_11377759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 586 | Open in IMG/M |
| 3300025914|Ga0207671_11210610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 591 | Open in IMG/M |
| 3300025922|Ga0207646_11348587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 622 | Open in IMG/M |
| 3300025924|Ga0207694_10158274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1828 | Open in IMG/M |
| 3300025926|Ga0207659_11104613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 682 | Open in IMG/M |
| 3300025928|Ga0207700_11596485 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300025935|Ga0207709_11656332 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300025981|Ga0207640_11209278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 672 | Open in IMG/M |
| 3300026035|Ga0207703_10896062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 849 | Open in IMG/M |
| 3300026142|Ga0207698_11544192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 679 | Open in IMG/M |
| 3300026377|Ga0257171_1025197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1012 | Open in IMG/M |
| 3300026508|Ga0257161_1010230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1690 | Open in IMG/M |
| 3300027108|Ga0207946_105963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 624 | Open in IMG/M |
| 3300027158|Ga0208725_1054534 | Not Available | 598 | Open in IMG/M |
| 3300027330|Ga0207777_1061220 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300027857|Ga0209166_10548496 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300027867|Ga0209167_10716091 | Not Available | 547 | Open in IMG/M |
| 3300027869|Ga0209579_10356340 | Not Available | 792 | Open in IMG/M |
| 3300027908|Ga0209006_10412315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1136 | Open in IMG/M |
| 3300028379|Ga0268266_11266704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 712 | Open in IMG/M |
| 3300028713|Ga0307303_10173468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 526 | Open in IMG/M |
| 3300028759|Ga0302224_10382523 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300028782|Ga0307306_10121210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 710 | Open in IMG/M |
| 3300028824|Ga0307310_10407619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 675 | Open in IMG/M |
| 3300028885|Ga0307304_10100598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1154 | Open in IMG/M |
| 3300029636|Ga0222749_10766911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 528 | Open in IMG/M |
| 3300029951|Ga0311371_11142474 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300029999|Ga0311339_10434023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1358 | Open in IMG/M |
| 3300030007|Ga0311338_10589895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1145 | Open in IMG/M |
| 3300030007|Ga0311338_10983494 | Not Available | 821 | Open in IMG/M |
| 3300030056|Ga0302181_10074663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1722 | Open in IMG/M |
| 3300030520|Ga0311372_11131298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1013 | Open in IMG/M |
| 3300030520|Ga0311372_12224529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 630 | Open in IMG/M |
| 3300030531|Ga0210274_1674558 | Not Available | 562 | Open in IMG/M |
| 3300030548|Ga0210252_10196627 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300030580|Ga0311355_11312688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 633 | Open in IMG/M |
| 3300030580|Ga0311355_11661990 | Not Available | 546 | Open in IMG/M |
| 3300031226|Ga0307497_10487798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 606 | Open in IMG/M |
| 3300031236|Ga0302324_102069523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 711 | Open in IMG/M |
| 3300031525|Ga0302326_11393704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 947 | Open in IMG/M |
| 3300031543|Ga0318516_10033090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2739 | Open in IMG/M |
| 3300031543|Ga0318516_10080383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1819 | Open in IMG/M |
| 3300031544|Ga0318534_10169256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1263 | Open in IMG/M |
| 3300031572|Ga0318515_10113754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1426 | Open in IMG/M |
| 3300031572|Ga0318515_10303963 | Not Available | 855 | Open in IMG/M |
| 3300031668|Ga0318542_10219545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 962 | Open in IMG/M |
| 3300031679|Ga0318561_10239093 | Not Available | 989 | Open in IMG/M |
| 3300031679|Ga0318561_10239560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 988 | Open in IMG/M |
| 3300031679|Ga0318561_10592929 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300031681|Ga0318572_10391222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 826 | Open in IMG/M |
| 3300031713|Ga0318496_10008713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 4704 | Open in IMG/M |
| 3300031713|Ga0318496_10645057 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300031716|Ga0310813_11820328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 572 | Open in IMG/M |
| 3300031719|Ga0306917_10769187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 756 | Open in IMG/M |
| 3300031769|Ga0318526_10413199 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300031770|Ga0318521_10199853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1154 | Open in IMG/M |
| 3300031771|Ga0318546_10367559 | Not Available | 1002 | Open in IMG/M |
| 3300031793|Ga0318548_10204817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 968 | Open in IMG/M |
| 3300031795|Ga0318557_10012462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3144 | Open in IMG/M |
| 3300031821|Ga0318567_10019620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3248 | Open in IMG/M |
| 3300031835|Ga0318517_10084441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1378 | Open in IMG/M |
| 3300031846|Ga0318512_10406933 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300031846|Ga0318512_10448278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 651 | Open in IMG/M |
| 3300031860|Ga0318495_10130187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1134 | Open in IMG/M |
| 3300031879|Ga0306919_10516178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 921 | Open in IMG/M |
| 3300031894|Ga0318522_10067853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1286 | Open in IMG/M |
| 3300031910|Ga0306923_10411668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1537 | Open in IMG/M |
| 3300031910|Ga0306923_11809081 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300031959|Ga0318530_10267950 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300032008|Ga0318562_10547617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 669 | Open in IMG/M |
| 3300032008|Ga0318562_10688274 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300032009|Ga0318563_10472243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 678 | Open in IMG/M |
| 3300032025|Ga0318507_10451712 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300032052|Ga0318506_10011050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3021 | Open in IMG/M |
| 3300032067|Ga0318524_10599664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 580 | Open in IMG/M |
| 3300032068|Ga0318553_10084029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1607 | Open in IMG/M |
| 3300032091|Ga0318577_10648876 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300032261|Ga0306920_104173620 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300032515|Ga0348332_14429236 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300032783|Ga0335079_10232592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2033 | Open in IMG/M |
| 3300032829|Ga0335070_10561121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1077 | Open in IMG/M |
| 3300034124|Ga0370483_0221580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 645 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.67% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.29% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.14% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.14% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.52% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.89% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.89% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.89% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.89% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.26% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 1.26% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.26% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.26% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.26% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.26% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.26% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.63% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.63% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.63% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.63% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.63% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.63% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.63% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.63% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.63% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.63% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.63% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.63% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.63% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.63% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.63% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.63% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459012 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grass | Environmental | Open in IMG/M |
| 2170459021 | Litter degradation NP4 | Engineered | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012384 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012404 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012496 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.090610 | Environmental | Open in IMG/M |
| 3300012499 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300019240 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300027108 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF030 (SPAdes) | Environmental | Open in IMG/M |
| 3300027158 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030531 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO038SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030548 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR016SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N56_03116010 | 2170459012 | Grass Soil | PLYAARVETQGQNSVVSIIPAASALTTISLPPVRDSYDAISP |
| 4NP_00557720 | 2170459021 | Switchgrass, Maize And Mischanthus Litter | TKGRSSVVSIIPAASALTTISLPPVRDSYDAISPYPSSP |
| JGIcombinedJ51221_102951622 | 3300003505 | Forest Soil | VITPLPGSGPLYAARVETQDRSNVVSIIPAASALSTIGLPPVRDSYDAISPP* |
| Ga0062388_1027091041 | 3300004635 | Bog Forest Soil | EITPLAGSGPLYAARVEAQGTSIVSIIPAVSALASISLPPVRNSYDAVSP* |
| Ga0066823_100691322 | 3300005163 | Soil | YAARVETQDRSNVVSIIPAASALSTIGLPPVRDSYDAISPP* |
| Ga0066680_103325561 | 3300005174 | Soil | GPLYAARVETQDRSNVVSIIPAASALSTISLPPVRDSYDAISP* |
| Ga0066671_109317232 | 3300005184 | Soil | GSGPLYAARVETQDRSNVVSIIPAASALSTIGLPPVRDSYEAISPP* |
| Ga0070683_1007316572 | 3300005329 | Corn Rhizosphere | YAARVETKEQSTVVSIIPAASALTTMSLPPVSNSYSAVAP* |
| Ga0070673_1003885323 | 3300005364 | Switchgrass Rhizosphere | GPLYAARVETQGHSSVVSIIPAASALTTISLPPVRDSYEAISPYPSSP* |
| Ga0066693_102941332 | 3300005566 | Soil | GSGPLYAARVETQGRSSVVSIIPAASALTTISLPPVRDSYDAISPYPSSP* |
| Ga0066703_107231931 | 3300005568 | Soil | GGSGPLYAARVETHGQNSVVSIIPAASALTTISLPPVRDSYDAINP* |
| Ga0070762_100166401 | 3300005602 | Soil | PVYAARVEQSQSSVVSIVPAVTALTTISLPPVRESYDAISP* |
| Ga0068870_103662511 | 3300005840 | Miscanthus Rhizosphere | YAARVETQGRSSVASIIPAASALTTISLPPVRDSYEAISPYPSSP* |
| Ga0066656_105237982 | 3300006034 | Soil | LVITPLHGSGPLYAARVETQGRSSVVSIIPAASALTTISLPPVRDSYDAISP* |
| Ga0075017_1013185702 | 3300006059 | Watersheds | ITPLAGSGPLYAARVETQGQNTIVSVIPAVSALTTISLPPVRDSYDAISP* |
| Ga0070765_1003595333 | 3300006176 | Soil | PLAGSGPLYAARVETQGQDTIVSILPAASALTTISLPPVRDSYDAISPP* |
| Ga0074055_117002261 | 3300006573 | Soil | PLRGSGPLYAARVETQGQNSVVSIIPAASALTTISLPPVRDSYDAISPYPSSPYPSSP* |
| Ga0074050_100087641 | 3300006577 | Soil | GSGPLYAARVETQGRGSVVSIIPAASALTTISLPPVRDSYDAISPYPSSP* |
| Ga0079221_115762241 | 3300006804 | Agricultural Soil | PLYAARVETQGRSSVVSIIPAASALTTIGLPPVRDSYDAISP* |
| Ga0073928_101988101 | 3300006893 | Iron-Sulfur Acid Spring | ARVETQVQSTVVSIIPAVSALTTISLPPVRDSYDAIFP* |
| Ga0075424_1014650452 | 3300006904 | Populus Rhizosphere | TQGENGVVSIIPAVSALTTISLRPVRDSYDAVSP* |
| Ga0075424_1021714851 | 3300006904 | Populus Rhizosphere | VYAARVETKEQSTVVSIIPAASALTTISLPPVRNSYDAVSP* |
| Ga0079219_120303702 | 3300006954 | Agricultural Soil | VITPLPGSGPLYAARVETQDRSSVVSIIPAASALSTISLPPVRDSYDAISP* |
| Ga0075435_1004791123 | 3300007076 | Populus Rhizosphere | SGPLYAARVETQDRSSVVSIIPAASALSTISLPPVRDSYDAISP* |
| Ga0099794_105372111 | 3300007265 | Vadose Zone Soil | SGPLYAARVETRGQNTVVSIIPAASALTTISLPPVRDSYDAISPPG* |
| Ga0116218_10701194 | 3300009522 | Peatlands Soil | GSGPLYAARVETQGQDTVVSILPAASALTTISLPPVRDSYNAISPPPGG* |
| Ga0116135_14087212 | 3300009665 | Peatland | ETQGKSTVVAIIPAASALTTISLPPVRDSYDAIAP* |
| Ga0126319_14900562 | 3300010147 | Soil | QNSVVSIIPAASALTTISLPPVRDSYDAISPYPSSS* |
| Ga0074044_103919742 | 3300010343 | Bog Forest Soil | SGPLFAARVETQGQNTVVSIIPAISALTTITLPPVRDSYDAISP* |
| Ga0105239_135243261 | 3300010375 | Corn Rhizosphere | LRGSGPLYAARVETQGHSSVVSIIPAASALTTISLPPVRDSYDAISPP* |
| Ga0134127_102738801 | 3300010399 | Terrestrial Soil | GSGPLYAARVETQGRSSVVSIIPAASALTTISLPPVRDSYEAISPYPSSP* |
| Ga0126350_114447411 | 3300010880 | Boreal Forest Soil | SGSGPLYAARVETQGQTVVSIIPAVSALTTISLPPVRDSYDAISP* |
| Ga0150983_145211362 | 3300011120 | Forest Soil | ITPLAGSGPLYGARVETQGQSTIVSIIPAASALTTISLLPVRDTYAAVSP* |
| Ga0137381_113661952 | 3300012207 | Vadose Zone Soil | VITPLAGSGPLYAARVETKGQNTVVSIIPAASALATISLPPVRDSYDAISPMGGPGG* |
| Ga0137384_100969054 | 3300012357 | Vadose Zone Soil | LAGSGPLYAARVETQGQNTVVSIIPAASALTTISLPPVRDSYDAISPPR* |
| Ga0134036_12017042 | 3300012384 | Grasslands Soil | VIEPQRGSGPLYAARVETQGRSSVVSIIPAASALTTISLPPVRDSYDAISPYPSSP* |
| Ga0134024_12148201 | 3300012404 | Grasslands Soil | YAARVETQDHSNVVSIIPAASALSTISLPPVRDSYDAISPP* |
| Ga0134024_12148203 | 3300012404 | Grasslands Soil | VETQDHSNVVSIIPAASALSTISLPPVRDSYDAISP |
| Ga0157353_10199962 | 3300012496 | Unplanted Soil | VITPLRGSGPLYAARVETQGRSSVVSIIPAASALTTISLPPVRDTYDAISPYPSSP* |
| Ga0157350_10121341 | 3300012499 | Unplanted Soil | TQGRSSVVSIIPAASALTTISLPPVRDSYEAISPYPSSP* |
| Ga0126369_120925081 | 3300012971 | Tropical Forest Soil | AARVETQDQKTVVSIIPVASALTMISLRPVRDSYDAIWPP* |
| Ga0134078_103605972 | 3300014157 | Grasslands Soil | SGPLYAARVETQGQNNLVSIIPAASALTTISLPPVRDSYDAISPP* |
| Ga0134073_102653141 | 3300015356 | Grasslands Soil | LPGSGPLYAARLETQGRSSVVSIIPAASALTTISLPPVRDSYDAISP* |
| Ga0132255_1038063642 | 3300015374 | Arabidopsis Rhizosphere | ARVETQGRSSVVSIIPAASALTTISLPPVRDSYDAISPYPSSP* |
| Ga0182035_117263552 | 3300016341 | Soil | ETQGQDTIVSIIPAASALTTISLLPVRDSYTAISP |
| Ga0182034_106078331 | 3300016371 | Soil | NAKHGSAFALVVIPLAGSGPLYAARVETQGQNTVVSIIPAISALTTITLPPAHDSYDAVS |
| Ga0182040_116774072 | 3300016387 | Soil | VETQDRTTVVSIIPAASALTTISLAPVRDSYDAISPR |
| Ga0182037_114816512 | 3300016404 | Soil | LAITPLAGSGPLYAARVETQGQNTVVSIIPAISALTTITLPPVHDSYDAVSP |
| Ga0182039_115097922 | 3300016422 | Soil | GSGPLYAARVETQGQSTVVSIIPAISALTTLTLPPVRDSYDAISPR |
| Ga0187812_10565361 | 3300017821 | Freshwater Sediment | PLAGSGPLYAARVETQGQNTVASILPAMSALTTITLDPVRDSYDAISP |
| Ga0187812_11049921 | 3300017821 | Freshwater Sediment | RVETQGQNTAVSIIPAMSALTTITLDPVRDSYAEISP |
| Ga0187820_10899372 | 3300017924 | Freshwater Sediment | RVETQGQNTVASIIPALSALTTITLPSVRDSYDAISP |
| Ga0187820_11257332 | 3300017924 | Freshwater Sediment | RVETKEQSTVVSIIPAASALTTMTLPPVSNSYSAVAP |
| Ga0187806_10401943 | 3300017928 | Freshwater Sediment | SGPLYAARVETQGQNTVVSIIPAISALTTITLPPVRDSYDAISP |
| Ga0187879_108026161 | 3300017946 | Peatland | LYAARIETKDGSTVVSIIPAVSALTTISLPPVRDSYDAIAP |
| Ga0187783_102464831 | 3300017970 | Tropical Peatland | AARVETQGQSSVVSIIPAVSALTTINLPPVRESYGAISP |
| Ga0187783_102968221 | 3300017970 | Tropical Peatland | PLPGSGPLYAARVETQGQSSVVSIIPAVSALTTINLPPVRESYGAISP |
| Ga0187783_110394181 | 3300017970 | Tropical Peatland | ETQGQSSVVSIIPAVSALTTINLPPVRESYGAISP |
| Ga0187783_111537561 | 3300017970 | Tropical Peatland | AVVITPLPGSGSLYAARVETQGQSSVVSIIPAVSALTTINLPPVRESYGAISP |
| Ga0187815_104149371 | 3300018001 | Freshwater Sediment | PLAGSGPLYAARVETQGQNTVASIIPALSALTTITLPSVRDSYDAISP |
| Ga0187883_102547232 | 3300018037 | Peatland | PLYAARVETRGQDTVVSILPAASALTTISLPPVRDSYNAISPP |
| Ga0187859_101362281 | 3300018047 | Peatland | PLPGSGPLYAARVETQGQSTVVAIIPAASALTTISLPPVRDSYDAIAP |
| Ga0181510_12843942 | 3300019240 | Peatland | TPLAGSGPVYAARVEQSQSSVISIVPAVSALTTISLPPVRDSYDAVSP |
| Ga0210396_116788981 | 3300021180 | Soil | ALVITPLAGSGPVYAARVETQGQNTAVSIIPAVSALTTITLSPVRDSYNAISP |
| Ga0210389_101355031 | 3300021404 | Soil | TPLAGSGQVYAARIETQDQNTVSILPARSALTSVGLPPVRQSYSAVSP |
| Ga0210383_103690401 | 3300021407 | Soil | LYAARVETQGQNTIVSIIPAASALTTISLPPVRESYDAISP |
| Ga0210383_106098781 | 3300021407 | Soil | ARVETQGQDTIVSILPATSALTTISLPPVRDSYDAISPP |
| Ga0213878_100769693 | 3300021444 | Bulk Soil | RVETQGQDTVVSIIPAISALTTITLPPVRDSYDAVSP |
| Ga0210409_108705591 | 3300021559 | Soil | GPLYAARVETQGQNSVVSIIPAASALTTISLPPVRDSYDAISP |
| Ga0224712_103649082 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | VVITPLAGSGPVYAARVGTKGQSTVVSIIPAASTLTTMRLPPVSNSYNALSP |
| Ga0212123_107055781 | 3300022557 | Iron-Sulfur Acid Spring | ARVATQGQNTVVSIVPAISALTTIMLPPVRDSYDAISP |
| Ga0242665_103693001 | 3300022724 | Soil | ARVETQGQNTVVSIIPAASALTTISLPPVRDSYDAISP |
| Ga0224572_10716592 | 3300024225 | Rhizosphere | AGSGPLYAARVETQDQSTVVSIIPAASALTTISLPPVRDSYDAINP |
| Ga0247664_10060891 | 3300024232 | Soil | QNSVVSIIPAASALTTISLPPVRDSYEAISPYPSSP |
| Ga0207692_112128311 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLPGSGPLYAARVETQDRSNVVSIIPAASALSTISLPPVRDSYDAISPP |
| Ga0207642_108825292 | 3300025899 | Miscanthus Rhizosphere | GRSSVASIIPAASALTTISLPPVRDSYEAISPYPSSP |
| Ga0207643_100931814 | 3300025908 | Miscanthus Rhizosphere | YAARVETQGRSSVASIIPAASALTTISLPPVRDSYEAISPYPSSP |
| Ga0207695_113777591 | 3300025913 | Corn Rhizosphere | VETQGRSSVASIIPAASALTTISLPPVRDSYEAISPYPSSP |
| Ga0207671_112106102 | 3300025914 | Corn Rhizosphere | PLRGSGPLYAARVETQGRSSVVSIIPAASALTTISLPPVRDSYEAISPYPSSP |
| Ga0207646_113485872 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | PGSGPLYAARVETQGQNSVVSIIPAASALTTISLPPVRDSYDAISP |
| Ga0207694_101582744 | 3300025924 | Corn Rhizosphere | QGHSSVVSIIPAASALTTISLPPVRDSYEAISPYPSSP |
| Ga0207659_111046131 | 3300025926 | Miscanthus Rhizosphere | EIQGQNSVVSIIPAASALTTISLPPVRDSYEAISPYPSSP |
| Ga0207700_115964851 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | RIESQSQGGVASIVPALTAPTTVGLPPVRESYWAIAP |
| Ga0207709_116563322 | 3300025935 | Miscanthus Rhizosphere | ARVEIQGQNSVVSIIPAASALTTISLPPVRDSYEAISPYPSSP |
| Ga0207640_112092781 | 3300025981 | Corn Rhizosphere | IQGQNSVVSIIPAASALTTISLPPVRDSYEAISPYPSSP |
| Ga0207703_108960622 | 3300026035 | Switchgrass Rhizosphere | YAARVEIQGQNSVVSIIPAASALTTISLPPVRDSYEAISPYPSSP |
| Ga0207698_115441922 | 3300026142 | Corn Rhizosphere | NSVVSIIPAASALTTISLPPVRDSYEAISPYPSSP |
| Ga0257171_10251973 | 3300026377 | Soil | PLYAARVETQDHSSVVSIIPAASALSTISLPPVRDSYDAISPP |
| Ga0257161_10102303 | 3300026508 | Soil | VATQGQNTVVSIVPAISALTTIILPPVRDSYDAISP |
| Ga0207946_1059632 | 3300027108 | Forest Soil | TPLPGSGPLYAARVETQDRSNVVSIIPAASALSTISLPPVRDSYDAISPP |
| Ga0208725_10545341 | 3300027158 | Forest Soil | TPLAGSGPVYAARVETQGQNTAVSIIPAVSALTTITLSPVRDSYNAISP |
| Ga0207777_10612201 | 3300027330 | Tropical Forest Soil | VYAARVETQGQNTVISIIPAVSALTTIMLPPVRYSYHAMSP |
| Ga0209166_105484962 | 3300027857 | Surface Soil | ETQGQNTIVSIIPAASALSTISLPSVRDSYSAISP |
| Ga0209167_107160912 | 3300027867 | Surface Soil | TGSGPLYAARFETQGQNTVVSIIPAVSALTTITLSPVRDSYNAISP |
| Ga0209579_103563401 | 3300027869 | Surface Soil | GPLYAARIETQGQSTVISIMPAISALTTINLPPVRESYSAISP |
| Ga0209006_104123152 | 3300027908 | Forest Soil | AARVETQGQTVVSIIPAVSALTTISLPPVRDSYDAISP |
| Ga0268266_112667042 | 3300028379 | Switchgrass Rhizosphere | RGSGPLYAARVETQGRSSVVSIIPAASALTTISLPPVRDSYEAISPYPSSP |
| Ga0307303_101734681 | 3300028713 | Soil | GRSSVVSIIPAASALTTISLPPVRDSYDAISPYPS |
| Ga0302224_103825232 | 3300028759 | Palsa | LAGSGPLYAARVETQDQSTVVSIIPAASALTTIGLPPVSDSYDAINP |
| Ga0307306_101212101 | 3300028782 | Soil | LHGSGPLYAARVETQGRSSVVSIIPAASALTTISLPPVRDSYDAISPYPS |
| Ga0307310_104076192 | 3300028824 | Soil | QNSVVSIIPAASALTTISLPPVRDSYDAISPYPSSP |
| Ga0307304_101005981 | 3300028885 | Soil | PLYAARVETQGRSSVVSIIPAASALTTISLPPVRDSYDAISPYPSSP |
| Ga0222749_107669112 | 3300029636 | Soil | VITPLPGSGPLYAARVETQDHSSVVSIIPAASALTTISLPPVRDSYDAISP |
| Ga0311371_111424742 | 3300029951 | Palsa | ETQDQSTVVSIIPAASALTTISLPPVRDSYDAINP |
| Ga0311339_104340231 | 3300029999 | Palsa | ETQGQNTVASIVPAVSALTTITLPPVRDSYDAISP |
| Ga0311338_105898951 | 3300030007 | Palsa | GPLYAARVETQGQSTVVSIIPAASALTTISLPPVRDSYDAINP |
| Ga0311338_109834941 | 3300030007 | Palsa | VAAQGSSIVSIIPAVSALTSISLPPVRNSYDAISP |
| Ga0302181_100746633 | 3300030056 | Palsa | DQTVVSIIPAVSALTTISLAPVRDSYDAISPDGRL |
| Ga0311372_111312983 | 3300030520 | Palsa | PGSGPLYAARVETQGQSTVSIIPATSALTTIGLPPVRDSYDAIAP |
| Ga0311372_122245291 | 3300030520 | Palsa | SGPLYAARVETQGQSAVAGIIPAASALTTISLPPVRDSYDAIAP |
| Ga0210274_16745581 | 3300030531 | Soil | TPLAGAGPLYAARVETQGQNTIVSILPAASALTTISLPPVRDSYNAISPPPGANGGDGSP |
| Ga0210252_101966272 | 3300030548 | Soil | PQAGSGPVYAARVESQGAQSNAVSIIPAQSALTTIGLPPVRDSYDAVAP |
| Ga0311355_113126881 | 3300030580 | Palsa | LYAARVETQGQSTVVGIIPAVSALTTISLPPVRDSYDAITP |
| Ga0311355_116619901 | 3300030580 | Palsa | RVETRGQTVVSIIPAVSALTTISLAPVRDSYDAISP |
| Ga0307497_104877981 | 3300031226 | Soil | ETQGRGSVVSIIPAASALTTISLPPVRDSYDAISPYPSSP |
| Ga0302324_1020695232 | 3300031236 | Palsa | ITPLAGSGPLYAARVETQDQSTVVSIIPAASALTTIGLPPVSDSYDAINP |
| Ga0302326_113937043 | 3300031525 | Palsa | AARVETQDQSTVVSIIPAASALTTISLPPVRDSYDAINP |
| Ga0318516_100330904 | 3300031543 | Soil | AARVETQGQDTIVSIIPAASALTTISLPPARDSYTAISP |
| Ga0318516_100803831 | 3300031543 | Soil | AGSGPVYAARVETRGQNTVVSIIPAVSALTTIPLPPVRDSYDAISP |
| Ga0318534_101692561 | 3300031544 | Soil | YAARVETQDHSTVVSIIPAVSALSTISLPPVRDSYDAIWP |
| Ga0318515_101137544 | 3300031572 | Soil | GPVYAARVETRGHSTVVSIIPAASALTTISLPPVRDSYDAISG |
| Ga0318515_103039632 | 3300031572 | Soil | PVYAARVETQGQSTVVSIIPAVSALTTIMLPPVRDSYDAISP |
| Ga0318542_102195452 | 3300031668 | Soil | VITPLAGSGPVYAARVETQDQKTVVSIIPAASALTTISLRPVRDSYDAIWPS |
| Ga0318561_102390932 | 3300031679 | Soil | ITPLAGSGPLYAARVEMQGQNTVTSIIPAVSALTTITLSPVRDSYDAVSP |
| Ga0318561_102395603 | 3300031679 | Soil | AGSGPLYAARVETQDRSTVVSIIPAASALTTISLPPVRDSYDAISP |
| Ga0318561_105929292 | 3300031679 | Soil | PLAGSGPLYAARVETQGQSTVVSIIPAISALTTLTLPPVRDSYDAISPR |
| Ga0318572_103912222 | 3300031681 | Soil | TPLAGSGPLYAARVETQGQDTVVSIIPAISALTTITLPPVRDSYDAISP |
| Ga0318496_100087137 | 3300031713 | Soil | LAESGPVYAARVETQGQNTVVSIIPAVSALTTIPLPPVRDSYDAISP |
| Ga0318496_106450571 | 3300031713 | Soil | LVITPLAGSGPLYAARVEMQGQNTVTSIIPAVSALTTITLSPVRDSYDAVSP |
| Ga0310813_118203281 | 3300031716 | Soil | VITPLRGSGPLYAARVETQGRSSVVSIIPAASALTTISLPPVRDSYEAISPYPSSP |
| Ga0306917_107691872 | 3300031719 | Soil | PLAGSGPLYAARVETQGQNTVTSIIPAVSALTTITLAPVHDSYDAISP |
| Ga0318526_104131992 | 3300031769 | Soil | ARVETQGQSTVVSIIPAVSALTTIMLPPVRDSYDAISP |
| Ga0318521_101998531 | 3300031770 | Soil | VETQGQNTVTSIIPAVSALTTITLAPVHDSYDAISP |
| Ga0318546_103675592 | 3300031771 | Soil | VVTPLAGSGPLYAARVETQGQNTVVSIIPAISALTTITLPPAHDSYDAVSP |
| Ga0318548_102048172 | 3300031793 | Soil | ITPLAGSGPVYAARVETQDHSTVVSIIPAVSALSTISLPPVRDSYDAIWP |
| Ga0318557_100124621 | 3300031795 | Soil | AARVETQGQNTVVSIIPAISALTTITLPPVHDSYDAVSP |
| Ga0318567_100196201 | 3300031821 | Soil | SGPVYAARVETQGQSTVVSIIPAVSALTTIMLPPVRDSYDAISP |
| Ga0318517_100844413 | 3300031835 | Soil | SGPVYAARVETQGQNTVVSIIPAVSALTTIPLPPVRDSYDAISP |
| Ga0318512_104069331 | 3300031846 | Soil | VITPLAGSGPLYAARVETQGQNTVVSIIPAVSALTMITLPPVRDSYDAISP |
| Ga0318512_104482782 | 3300031846 | Soil | VETQGENTVVSIIPAISALTTITLPPVHDSYDAVSP |
| Ga0318495_101301873 | 3300031860 | Soil | PLAGSGPLYAARVETQGQNTVVSIIPAVSALTTITLPPVRDSYDAISPEP |
| Ga0306919_105161783 | 3300031879 | Soil | PVYAARVETQDQKTVVSIIPAASALTTISLRPVRDSYDAIWPS |
| Ga0318522_100678533 | 3300031894 | Soil | LYAARVETQGQDTIVSIIPAASALTTISLPPARDSYTAISP |
| Ga0306923_104116684 | 3300031910 | Soil | LVITPLAGSGPVYAARVETQDHSTVVSIIPAVSALSTISLPPVRDSYDAIWP |
| Ga0306923_118090811 | 3300031910 | Soil | ITPLAGSGPLYAARVETEGQNTVVSIIPAVSALTTISLPPARDSYDAVSP |
| Ga0318530_102679501 | 3300031959 | Soil | LAGSGPVYAARVETRGQNTVVSIIPAVSALTTIPLPPVRDSYDAISP |
| Ga0318562_105476171 | 3300032008 | Soil | YAARVETQGQNTVVSIIPAISALTTITLPPAHDSYDAVSP |
| Ga0318562_106882742 | 3300032008 | Soil | AARVETQGQNTVVSIIPAVSALTTIPLPPVRDSYDAISP |
| Ga0318563_104722431 | 3300032009 | Soil | AGSGPVYAARVETQDRTTVVSIIPAASALTTISLPPVRDSYDAISG |
| Ga0318507_104517122 | 3300032025 | Soil | VITPLAGSGPLCAARVETQGQNTVVSIIPAVSALTTITLVPAHDSYDAISP |
| Ga0318506_100110501 | 3300032052 | Soil | LYAARVETQGQNTVVSIIPAISALTTITLPPAHDSYDAVSP |
| Ga0318524_105996642 | 3300032067 | Soil | SGPLYAARVETQGQGTIASIIPAVSALTTISLPGASDSYDAISP |
| Ga0318553_100840294 | 3300032068 | Soil | VITPLAGSGPVYAARVETQDHSTVVSIIPAASALTTISLPPVRDSYDAISP |
| Ga0318577_106488762 | 3300032091 | Soil | GPLYAARVETQGQNTVVSIIPAISALTTITLPPVHDSYDAVSP |
| Ga0306920_1041736201 | 3300032261 | Soil | LYAARVETQGQDTVVSIIPAISALTTITLPPVRDSYDAISP |
| Ga0348332_144292362 | 3300032515 | Plant Litter | VYAARVEAKGSQGAVSIIPAASALTTIGLPPVRDSYTAVSR |
| Ga0335079_102325924 | 3300032783 | Soil | AFAVVITPLAGSGPVYAARVETQDQKTVVSIIPAASALTTISLRPVGDSYDAIWPEGDPG |
| Ga0335070_105611212 | 3300032829 | Soil | VETTKEQSTVVSIIPAASALTTITLPPVSNSYTAVSP |
| Ga0370483_0221580_493_645 | 3300034124 | Untreated Peat Soil | ITPLPGSGPLYAARVETQGQSTVVAIIPAASALTTISLPPVRDSYDAIAP |
| ⦗Top⦘ |