| Basic Information | |
|---|---|
| Family ID | F041888 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 159 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MRKRSFLFLSLLVPAFLVLGGYAVVKAQQKTSSTASAKRWS |
| Number of Associated Samples | 134 |
| Number of Associated Scaffolds | 159 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.11 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.82 % |
| Associated GOLD sequencing projects | 128 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (56.604 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.692 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.302 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.881 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 55.07% β-sheet: 0.00% Coil/Unstructured: 44.93% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 159 Family Scaffolds |
|---|---|---|
| PF13577 | SnoaL_4 | 9.43 |
| PF01833 | TIG | 1.89 |
| PF10162 | G8 | 1.26 |
| PF13148 | DUF3987 | 0.63 |
| PF13365 | Trypsin_2 | 0.63 |
| PF01425 | Amidase | 0.63 |
| PF04397 | LytTR | 0.63 |
| PF13193 | AMP-binding_C | 0.63 |
| PF05292 | MCD | 0.63 |
| PF03400 | DDE_Tnp_IS1 | 0.63 |
| PF01548 | DEDD_Tnp_IS110 | 0.63 |
| PF13320 | DUF4091 | 0.63 |
| PF01625 | PMSR | 0.63 |
| PF02881 | SRP54_N | 0.63 |
| PF01799 | Fer2_2 | 0.63 |
| PF12543 | DUF3738 | 0.63 |
| PF01325 | Fe_dep_repress | 0.63 |
| PF00589 | Phage_integrase | 0.63 |
| PF02195 | ParBc | 0.63 |
| PF00872 | Transposase_mut | 0.63 |
| PF00665 | rve | 0.63 |
| PF13565 | HTH_32 | 0.63 |
| PF13180 | PDZ_2 | 0.63 |
| PF13589 | HATPase_c_3 | 0.63 |
| PF02469 | Fasciclin | 0.63 |
| PF01734 | Patatin | 0.63 |
| PF13651 | EcoRI_methylase | 0.63 |
| PF00756 | Esterase | 0.63 |
| PF07603 | DUF1566 | 0.63 |
| COG ID | Name | Functional Category | % Frequency in 159 Family Scaffolds |
|---|---|---|---|
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.63 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.63 |
| COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 0.63 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.63 |
| COG2335 | Uncaracterized surface protein containing fasciclin (FAS1) repeats | General function prediction only [R] | 0.63 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.63 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.63 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.63 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.63 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.63 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.63 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.63 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.63 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 57.23 % |
| Unclassified | root | N/A | 42.77 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459003|FZN2CUW02HBC9J | Not Available | 533 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_109064207 | Not Available | 631 | Open in IMG/M |
| 3300001471|JGI12712J15308_10181735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300001593|JGI12635J15846_10699305 | Not Available | 584 | Open in IMG/M |
| 3300001837|RCM39_1039621 | Not Available | 569 | Open in IMG/M |
| 3300001848|RCM47_1105076 | Not Available | 1334 | Open in IMG/M |
| 3300004801|Ga0058860_12146270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 693 | Open in IMG/M |
| 3300005295|Ga0065707_10604296 | Not Available | 688 | Open in IMG/M |
| 3300005334|Ga0068869_100288904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1321 | Open in IMG/M |
| 3300005365|Ga0070688_100503865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 914 | Open in IMG/M |
| 3300005439|Ga0070711_100186027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans | 1593 | Open in IMG/M |
| 3300005526|Ga0073909_10367106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 671 | Open in IMG/M |
| 3300005529|Ga0070741_10052911 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4881 | Open in IMG/M |
| 3300005534|Ga0070735_10411917 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300005539|Ga0068853_101532590 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300005541|Ga0070733_10527195 | Not Available | 791 | Open in IMG/M |
| 3300005541|Ga0070733_10996339 | Not Available | 563 | Open in IMG/M |
| 3300005544|Ga0070686_100510199 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 934 | Open in IMG/M |
| 3300005549|Ga0070704_101196616 | Not Available | 693 | Open in IMG/M |
| 3300005564|Ga0070664_100368798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1309 | Open in IMG/M |
| 3300005602|Ga0070762_10538107 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300005718|Ga0068866_11069226 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 577 | Open in IMG/M |
| 3300005764|Ga0066903_104298299 | Not Available | 761 | Open in IMG/M |
| 3300005836|Ga0074470_10724688 | Not Available | 791 | Open in IMG/M |
| 3300005842|Ga0068858_100789967 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 926 | Open in IMG/M |
| 3300005842|Ga0068858_101167194 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300006059|Ga0075017_100116806 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → Methanosarcinales incertae sedis → ANME-2 cluster → unclassified ANME-2 cluster → ANME-2 cluster archaeon | 1872 | Open in IMG/M |
| 3300006102|Ga0075015_100431585 | Not Available | 748 | Open in IMG/M |
| 3300006102|Ga0075015_100915299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 532 | Open in IMG/M |
| 3300006176|Ga0070765_100521354 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300006176|Ga0070765_101870837 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 562 | Open in IMG/M |
| 3300006176|Ga0070765_102031526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Erythrobacter/Porphyrobacter group → Erythrobacter | 537 | Open in IMG/M |
| 3300006237|Ga0097621_100034374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4044 | Open in IMG/M |
| 3300006797|Ga0066659_10395518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1085 | Open in IMG/M |
| 3300006804|Ga0079221_10414225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 841 | Open in IMG/M |
| 3300006804|Ga0079221_11562655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 532 | Open in IMG/M |
| 3300009093|Ga0105240_11490494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 709 | Open in IMG/M |
| 3300009093|Ga0105240_12079076 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 590 | Open in IMG/M |
| 3300009545|Ga0105237_11415152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 702 | Open in IMG/M |
| 3300009551|Ga0105238_11898245 | Not Available | 628 | Open in IMG/M |
| 3300009683|Ga0116224_10594196 | Not Available | 529 | Open in IMG/M |
| 3300010043|Ga0126380_10798271 | Not Available | 772 | Open in IMG/M |
| 3300010043|Ga0126380_11779438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Erythrobacter/Porphyrobacter group → Erythrobacter | 556 | Open in IMG/M |
| 3300010048|Ga0126373_11712719 | Not Available | 693 | Open in IMG/M |
| 3300010361|Ga0126378_10844015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 1024 | Open in IMG/M |
| 3300010366|Ga0126379_11199950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 865 | Open in IMG/M |
| 3300010366|Ga0126379_11213848 | Not Available | 860 | Open in IMG/M |
| 3300010371|Ga0134125_12896778 | Not Available | 521 | Open in IMG/M |
| 3300010375|Ga0105239_10474993 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1420 | Open in IMG/M |
| 3300010375|Ga0105239_11988313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 675 | Open in IMG/M |
| 3300010375|Ga0105239_12432313 | Not Available | 610 | Open in IMG/M |
| 3300010376|Ga0126381_104562523 | Not Available | 534 | Open in IMG/M |
| 3300010379|Ga0136449_103894221 | Not Available | 560 | Open in IMG/M |
| 3300010397|Ga0134124_12885614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 524 | Open in IMG/M |
| 3300010401|Ga0134121_10122392 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2198 | Open in IMG/M |
| 3300010401|Ga0134121_10934563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 845 | Open in IMG/M |
| 3300010938|Ga0137716_10348595 | Not Available | 747 | Open in IMG/M |
| 3300012359|Ga0137385_10824762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 770 | Open in IMG/M |
| 3300012361|Ga0137360_11141297 | Not Available | 673 | Open in IMG/M |
| 3300012927|Ga0137416_10886927 | Not Available | 792 | Open in IMG/M |
| 3300012929|Ga0137404_10812038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 850 | Open in IMG/M |
| 3300012931|Ga0153915_11468495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. HDW15A | 797 | Open in IMG/M |
| 3300012982|Ga0168317_1003146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7312 | Open in IMG/M |
| 3300013100|Ga0157373_11474348 | Not Available | 519 | Open in IMG/M |
| 3300013296|Ga0157374_12458718 | Not Available | 548 | Open in IMG/M |
| 3300013297|Ga0157378_13175485 | Not Available | 510 | Open in IMG/M |
| 3300013306|Ga0163162_10851566 | Not Available | 1027 | Open in IMG/M |
| 3300013503|Ga0120127_10046156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 861 | Open in IMG/M |
| 3300014325|Ga0163163_10699580 | Not Available | 1077 | Open in IMG/M |
| 3300014325|Ga0163163_12605536 | Not Available | 563 | Open in IMG/M |
| 3300014654|Ga0181525_10746998 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300014657|Ga0181522_10539966 | Not Available | 704 | Open in IMG/M |
| 3300014838|Ga0182030_10368204 | All Organisms → cellular organisms → Bacteria | 1522 | Open in IMG/M |
| 3300014968|Ga0157379_11360892 | Not Available | 687 | Open in IMG/M |
| 3300014969|Ga0157376_10415635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus albidus | 1304 | Open in IMG/M |
| 3300015264|Ga0137403_10893772 | Not Available | 739 | Open in IMG/M |
| 3300017822|Ga0187802_10122049 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 987 | Open in IMG/M |
| 3300017948|Ga0187847_10662008 | Not Available | 586 | Open in IMG/M |
| 3300017948|Ga0187847_10897528 | Not Available | 504 | Open in IMG/M |
| 3300017955|Ga0187817_10274122 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300017966|Ga0187776_11501739 | Not Available | 517 | Open in IMG/M |
| 3300017972|Ga0187781_10017516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5025 | Open in IMG/M |
| 3300018007|Ga0187805_10089969 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1386 | Open in IMG/M |
| 3300018009|Ga0187884_10326890 | Not Available | 619 | Open in IMG/M |
| 3300018013|Ga0187873_1213088 | Not Available | 720 | Open in IMG/M |
| 3300018019|Ga0187874_10055553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Erythrobacter/Porphyrobacter group → Erythrobacter | 1821 | Open in IMG/M |
| 3300018020|Ga0187861_10378573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 595 | Open in IMG/M |
| 3300018043|Ga0187887_10463901 | Not Available | 747 | Open in IMG/M |
| 3300018086|Ga0187769_10379167 | Not Available | 1062 | Open in IMG/M |
| 3300018429|Ga0190272_11370185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300018481|Ga0190271_12527056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300020580|Ga0210403_11306141 | Not Available | 554 | Open in IMG/M |
| 3300020582|Ga0210395_10758571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Erythrobacter/Porphyrobacter group → Erythrobacter | 724 | Open in IMG/M |
| 3300020583|Ga0210401_11596563 | Not Available | 510 | Open in IMG/M |
| 3300021170|Ga0210400_10863295 | Not Available | 740 | Open in IMG/M |
| 3300021181|Ga0210388_10130119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 2175 | Open in IMG/M |
| 3300021401|Ga0210393_10377752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1155 | Open in IMG/M |
| 3300021403|Ga0210397_10974376 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 658 | Open in IMG/M |
| 3300021406|Ga0210386_11731867 | Not Available | 516 | Open in IMG/M |
| 3300021420|Ga0210394_10852103 | Not Available | 794 | Open in IMG/M |
| 3300021433|Ga0210391_10400043 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300021433|Ga0210391_11344876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 550 | Open in IMG/M |
| 3300021474|Ga0210390_10384604 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1186 | Open in IMG/M |
| 3300021559|Ga0210409_10654832 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300021560|Ga0126371_12424023 | Not Available | 635 | Open in IMG/M |
| 3300022505|Ga0242647_1008653 | Not Available | 875 | Open in IMG/M |
| 3300025906|Ga0207699_10337575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1061 | Open in IMG/M |
| 3300025914|Ga0207671_10769746 | Not Available | 764 | Open in IMG/M |
| 3300025920|Ga0207649_10360673 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1078 | Open in IMG/M |
| 3300025921|Ga0207652_10378486 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1278 | Open in IMG/M |
| 3300025934|Ga0207686_10002778 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9470 | Open in IMG/M |
| 3300025934|Ga0207686_11367812 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 582 | Open in IMG/M |
| 3300025944|Ga0207661_11201180 | Not Available | 698 | Open in IMG/M |
| 3300025961|Ga0207712_10959192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Erythrobacter/Porphyrobacter group → Erythrobacter | 758 | Open in IMG/M |
| 3300026035|Ga0207703_11699195 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300026078|Ga0207702_10483519 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1205 | Open in IMG/M |
| 3300026078|Ga0207702_11324235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 714 | Open in IMG/M |
| 3300026078|Ga0207702_11767278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 611 | Open in IMG/M |
| 3300026078|Ga0207702_12210734 | Not Available | 539 | Open in IMG/M |
| 3300026095|Ga0207676_11233409 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 742 | Open in IMG/M |
| 3300026306|Ga0209468_1182685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 530 | Open in IMG/M |
| 3300027662|Ga0208565_1118580 | Not Available | 787 | Open in IMG/M |
| 3300027853|Ga0209274_10415414 | Not Available | 695 | Open in IMG/M |
| 3300027879|Ga0209169_10060738 | All Organisms → cellular organisms → Bacteria | 1957 | Open in IMG/M |
| 3300027895|Ga0209624_10029214 | All Organisms → cellular organisms → Bacteria | 3501 | Open in IMG/M |
| 3300027895|Ga0209624_10873249 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300028011|Ga0265344_103434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 530 | Open in IMG/M |
| 3300028381|Ga0268264_11971850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 593 | Open in IMG/M |
| 3300028776|Ga0302303_10325600 | Not Available | 516 | Open in IMG/M |
| 3300028906|Ga0308309_11292932 | Not Available | 627 | Open in IMG/M |
| 3300029943|Ga0311340_10124191 | All Organisms → cellular organisms → Bacteria | 2775 | Open in IMG/M |
| 3300029943|Ga0311340_10730772 | Not Available | 844 | Open in IMG/M |
| 3300030007|Ga0311338_10263830 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1927 | Open in IMG/M |
| 3300030524|Ga0311357_11147789 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300030737|Ga0302310_10496304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 656 | Open in IMG/M |
| 3300030815|Ga0265746_1069018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 514 | Open in IMG/M |
| 3300030878|Ga0265770_1114664 | Not Available | 561 | Open in IMG/M |
| 3300030977|Ga0265721_1015661 | Not Available | 533 | Open in IMG/M |
| 3300031040|Ga0265754_1030153 | Not Available | 554 | Open in IMG/M |
| 3300031238|Ga0265332_10475324 | Not Available | 517 | Open in IMG/M |
| 3300031446|Ga0170820_10216098 | Not Available | 710 | Open in IMG/M |
| 3300031474|Ga0170818_101774198 | Not Available | 712 | Open in IMG/M |
| 3300031545|Ga0318541_10712205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 560 | Open in IMG/M |
| 3300031708|Ga0310686_100979979 | Not Available | 537 | Open in IMG/M |
| 3300031708|Ga0310686_102858945 | Not Available | 3953 | Open in IMG/M |
| 3300031708|Ga0310686_106427352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Erythrobacter/Porphyrobacter group → Erythrobacter | 2830 | Open in IMG/M |
| 3300031708|Ga0310686_115013063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4072 | Open in IMG/M |
| 3300031718|Ga0307474_10105555 | All Organisms → cellular organisms → Bacteria | 2108 | Open in IMG/M |
| 3300031753|Ga0307477_10706928 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300031753|Ga0307477_10861735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 599 | Open in IMG/M |
| 3300031833|Ga0310917_10923033 | Not Available | 587 | Open in IMG/M |
| 3300031959|Ga0318530_10308108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 655 | Open in IMG/M |
| 3300031996|Ga0308176_10954904 | Not Available | 902 | Open in IMG/M |
| 3300032160|Ga0311301_12232514 | Not Available | 626 | Open in IMG/M |
| 3300032783|Ga0335079_12253923 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 518 | Open in IMG/M |
| 3300032828|Ga0335080_12373782 | Not Available | 506 | Open in IMG/M |
| 3300032898|Ga0335072_10944243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 800 | Open in IMG/M |
| 3300033158|Ga0335077_11588939 | Not Available | 622 | Open in IMG/M |
| 3300033803|Ga0314862_0144808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 573 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.29% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.03% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.03% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.40% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.40% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.77% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.14% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.14% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.14% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.14% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.52% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.52% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.52% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.52% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.89% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.89% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.89% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.26% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.26% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.26% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.26% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.26% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.26% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.26% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.26% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.26% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.26% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.63% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.63% |
| Hot Spring Fe-Si Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Fe-Si Sediment | 0.63% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.63% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.63% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.63% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.63% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.63% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.63% |
| Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.63% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.63% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001837 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM39, ROCA_DNA237_0.2um_Ob_C_3a | Environmental | Open in IMG/M |
| 3300001848 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3a | Environmental | Open in IMG/M |
| 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010938 | Sediment microbial community from Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA. Combined Assembly of Gp0156111, Gp0156114, Gp0156117 | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012982 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfield | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022505 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028011 | Plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE1 | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030815 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030977 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031040 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4A_10541450 | 2170459003 | Grass Soil | MRKRSLLLLSLLVPAFLVLGGYAAVKAQQQGSTSGKRWSDPAT |
| JGIcombinedJ13530_1090642072 | 3300001213 | Wetland | MQKRSFLLLSLLVPAFLGLGGYALVQAQQGGSSTAVKSGRWS |
| JGI12712J15308_101817352 | 3300001471 | Forest Soil | MRKRSLLFLSLLVPAFFVLGGYAVVQAQQKTSSTASAK |
| JGI12635J15846_106993051 | 3300001593 | Forest Soil | MIDHGGLTMRKRSLSFLSLLVAAFLVLGGYAVVQAQQKTSSTASAKRWSD |
| RCM39_10396211 | 3300001837 | Marine Plankton | MRKHTLLILSLLVPALLGLGGYAVITAQQPPSSTA |
| RCM47_11050762 | 3300001848 | Marine Plankton | MGKQHVLFLSSLLAAVLVLGGYTAVKAQQKGSSAAAKRWSDAA |
| Ga0058860_121462701 | 3300004801 | Host-Associated | MRKRSLLFLSLLVPAFLVLGGYAVVTAQQKTSSTASPKRW |
| Ga0065707_106042962 | 3300005295 | Switchgrass Rhizosphere | MRRRSLLFLGLLVPAFLGLGGYAVVQGQQKGSPAAGAKRWSDAAT |
| Ga0068869_1002889041 | 3300005334 | Miscanthus Rhizosphere | MIDHGGLTMRKRSLLFLSLVPAFLVLGGYAALKAQQKASS |
| Ga0070688_1005038651 | 3300005365 | Switchgrass Rhizosphere | MIDHGDLTMRKRSLLLLSLLAPAFLVLGGYAALKAQQKASYPPSAKRWSD |
| Ga0070711_1001860273 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKRSLLFLSLLVSAFLVLGGYAVVKAQQRTSSTASGKRWSDAATWP |
| Ga0073909_103671061 | 3300005526 | Surface Soil | MRKHYLLSLSLLVPAFLGLGGYAVVKAQQKASTPASAK |
| Ga0070741_100529115 | 3300005529 | Surface Soil | MQKRSLLFLSLLVPAFLVLGGYAVVHAQQKTSPASPKRWSDA |
| Ga0070735_104119171 | 3300005534 | Surface Soil | MRRHDRLFLSLLVQAFLILGGYTVVKAQQRTASTASGKRWSDPA |
| Ga0068853_1015325901 | 3300005539 | Corn Rhizosphere | MQKRSLLLLSLLVPAFLGLGGYAVVQGQQKSSPAAGAKRW |
| Ga0070733_105271951 | 3300005541 | Surface Soil | MIDHGGLTMRKRSLLFLSLLVSAFLVLGGYAVVQAQQKTSSTA |
| Ga0070733_109963391 | 3300005541 | Surface Soil | MRKRYFLFLSLLVPAFLVLGGYAALKAQQKTSSTTSGKRW |
| Ga0070686_1005101992 | 3300005544 | Switchgrass Rhizosphere | MRKRSFLFLSLLVPAFLVLGGYAVVKAQQKTSSTASAKRWS |
| Ga0070704_1011966162 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKRSLLLLSLLVPAVLGLGGYAALKAQQKASSAVKAGRW |
| Ga0070664_1003687981 | 3300005564 | Corn Rhizosphere | MRKRSLLFLSLLVPAFLVLGGYAALKAQQKASSTASAKRWSDASTWPD |
| Ga0070762_105381072 | 3300005602 | Soil | MRKRSLLFLSLLVPAFLVLGGYAALKAQQKASPAASAKRW |
| Ga0068866_110692261 | 3300005718 | Miscanthus Rhizosphere | MRKRSLLFLSLLFPALLVLGGYAVIKAQQKTSSTASGKRWSDA |
| Ga0066903_1042982993 | 3300005764 | Tropical Forest Soil | MRKRSFLFLSLLVPTFLVLGGYAVVEAQQKTSTAS |
| Ga0074470_107246882 | 3300005836 | Sediment (Intertidal) | MRKHSLLFLSSLLAAVLVLGGYAALKAQQKASSTVSAK |
| Ga0068858_1007899672 | 3300005842 | Switchgrass Rhizosphere | VRKHSLLFLSLLFPALLVLGGYAVIKAQQKTSSTASGKRWSDAA |
| Ga0068858_1011671943 | 3300005842 | Switchgrass Rhizosphere | MRKHSLLLLSVLVPVFLGLGGYAVLKAQQTPSSTAVKGGRW |
| Ga0075017_1001168063 | 3300006059 | Watersheds | MIDHGDLAMRKRSLLFLSLLVPAFLGLGGYAVLKAQQKT |
| Ga0075015_1004315852 | 3300006102 | Watersheds | MIDHGDLAMRKRSLLFLSLLVPAFLGLGGYAVLKAQQK |
| Ga0075015_1009152992 | 3300006102 | Watersheds | MIDHGDLTMRKRSLLFLSLLVPAFLGLGGYAVLKAQQKTSTASAKRWS |
| Ga0070765_1005213541 | 3300006176 | Soil | MRKHNLLFLSLLVPTFLVLGGYTALKAQQKTSSTASAKRW |
| Ga0070765_1018708371 | 3300006176 | Soil | MRKPSLLFLSLLVPAFLVLGGYAALKAQQKTSSTASAKRW |
| Ga0070765_1020315262 | 3300006176 | Soil | MQKRSLLLLSLLVPAFLGLGGYAVVQGQQKGSPAAGAKR |
| Ga0097621_1000343741 | 3300006237 | Miscanthus Rhizosphere | MRKHSLLLLSLLVPAFLVLGGYAALKAQQKASSTASAKRWSDA |
| Ga0066659_103955182 | 3300006797 | Soil | MRKRSLLSLSLLVPAVLVLGGYAALKAQQKASSTASG |
| Ga0079221_104142252 | 3300006804 | Agricultural Soil | MQKRSFLLVSLLVPAFLALGGFAVVQGQQKGSPAAGAKRW |
| Ga0079221_115626551 | 3300006804 | Agricultural Soil | MRKHYRWFLSLLVPVFLVLGGYAVLKAQQKTSTAK |
| Ga0105240_114904942 | 3300009093 | Corn Rhizosphere | MRKHSPLFLSLLVPAFLVLGGYAALKAQQKASSTASAKRWSDAS |
| Ga0105240_120790761 | 3300009093 | Corn Rhizosphere | MRKRSLLFLSLLVPAFLALGGYAVVKAQQRTSSTASGKRWSDAAT |
| Ga0105237_114151522 | 3300009545 | Corn Rhizosphere | MRKRSLLFLSLLVPAFLVLGGYAALKAQQKASSTASAKRWSDAS |
| Ga0105238_118982452 | 3300009551 | Corn Rhizosphere | MRKRSLLFLGLLVPAFLVLSGDAVKAQQKASSTASGKRWS |
| Ga0116224_105941961 | 3300009683 | Peatlands Soil | MIDHGDLTMRKRSLLFLSLLVPAFLGLGGYAVLNAQQKNAQQKT |
| Ga0126380_107982711 | 3300010043 | Tropical Forest Soil | MIDHGGLTMRKRSLLFLSLLVPAFLGLGGYAVVEAQQKTSSTARGKRWSDA |
| Ga0126380_117794381 | 3300010043 | Tropical Forest Soil | MQERSLLLLSLLVPAFLGLGGYAVVQGQEKGSSGTGAK |
| Ga0126373_117127191 | 3300010048 | Tropical Forest Soil | MRKNSLLFLSLLVLAFFVLGGYAVVKAQAQQKGSSTAAK |
| Ga0126378_108440151 | 3300010361 | Tropical Forest Soil | MRKHTLLILSLVVPAFLGLGGYAVLKAQQKTSTASAKRW |
| Ga0126379_111999502 | 3300010366 | Tropical Forest Soil | MRKHPLLFLSLLVPAFLVLGGYAVVKAQQKTSSTARAKR |
| Ga0126379_112138481 | 3300010366 | Tropical Forest Soil | MIDHGDLTMRKRSLLFLSLLVPAFLVLGGYAVVKAQQKTSSTARAKR |
| Ga0134125_128967782 | 3300010371 | Terrestrial Soil | MRKRSLLFLSLLVPAFLALGGYAVVKAQQKTSSTASGK |
| Ga0105239_104749932 | 3300010375 | Corn Rhizosphere | MRKHSLLFLSLLVPAFLVLGGYAVVKAQQKTSSTASGKRWSDAA |
| Ga0105239_119883132 | 3300010375 | Corn Rhizosphere | MRKHSPLFLLLLVPAFLVLGGYAALKAQQKASSTASAKRWSDASTW |
| Ga0105239_124323131 | 3300010375 | Corn Rhizosphere | MIDHGDLTMRKRSLLFLSLLVPAFLVLGGYAALKAQQKASSTPSAKRW |
| Ga0126381_1045625232 | 3300010376 | Tropical Forest Soil | MRKHPLLFLSLLVPTFLVLGGYAVVEAQQKTSSTASGK |
| Ga0136449_1038942211 | 3300010379 | Peatlands Soil | MNDHGDLTMRKRSLLFLSLLVPAFLGLGGYAVLKAQ |
| Ga0134124_128856142 | 3300010397 | Terrestrial Soil | MRQRSLLFLALLVPVFLVLGGYAVLKAQQKPSAASGKRWSDAA |
| Ga0134121_101223924 | 3300010401 | Terrestrial Soil | MIDHGDLTMRKRSLLFLSLLVPAFLVLGGYAVVKAQQK |
| Ga0134121_109345633 | 3300010401 | Terrestrial Soil | MRKRSLLSLSLLAPAFLVLGGYAVVKAQQTSSSAVK |
| Ga0137716_103485953 | 3300010938 | Hot Spring Fe-Si Sediment | MIDHGDFMMRKHYPLLLSLLGAAFLVLGGYAVIQAQQPPVSTAVKSGRWSDAA |
| Ga0137385_108247622 | 3300012359 | Vadose Zone Soil | MIDHGDLTMRKRSLLFLSLLVPAFLGLGGYAVLKAQQKTSTASAKRWSDP |
| Ga0137360_111412971 | 3300012361 | Vadose Zone Soil | MVDHGDLTMRKRSTLFISLLVPAVLGLGGYAVLEA |
| Ga0137416_108869272 | 3300012927 | Vadose Zone Soil | MIDHGDLTMRKRSLLFLSLLVPAFLGLGGYAALRAQQKASSTASAKRWS |
| Ga0137404_108120381 | 3300012929 | Vadose Zone Soil | MRRYNLLFLSLLVPAFLVLGGYAGLKAQQKTSSTASG |
| Ga0153915_114684951 | 3300012931 | Freshwater Wetlands | MMRKHSNLFLSLLAPALLVLGGYTVVKAQQKTSSTPVAKRWSDAAT |
| Ga0168317_10031467 | 3300012982 | Weathered Mine Tailings | MIDYRGLTMRKRFLLFLSLLVPAFLVLGGYAVLKAQQKTSTASMLSL |
| Ga0157373_114743482 | 3300013100 | Corn Rhizosphere | MIDHGDLTMRKRSLLFLGLLVPAFLVLSGDAVKAQQKASSTASGKRW |
| Ga0157374_124587181 | 3300013296 | Miscanthus Rhizosphere | MRKRSLLFLSSLIPAFLVLGGYTAVNAQQKAAKRWSDAAT |
| Ga0157378_131754851 | 3300013297 | Miscanthus Rhizosphere | MIDYRGLTMRKRFLLFLSLLALGFLGLGGYAALQAQQK |
| Ga0163162_108515661 | 3300013306 | Switchgrass Rhizosphere | MIVHGGLTMRKQYLLLLSLLVPAFLGLGGYAVVKAQ |
| Ga0120127_100461561 | 3300013503 | Permafrost | MIDHGGLTMRKRSLLFLGLLVPAFLVLSGDAVKAQQKASSTASGKRWSD |
| Ga0163163_106995804 | 3300014325 | Switchgrass Rhizosphere | MRKRFLLFLSLLALGFLGLGGYAGLQAQQKTSTASMRWS |
| Ga0163163_126055362 | 3300014325 | Switchgrass Rhizosphere | MMRKHYVKFLSLLVPAFLGLGGYAVVQGQQKGSPAG |
| Ga0181525_107469982 | 3300014654 | Bog | MQKRSLLLLSLLVPAFLGLGGYAVAQGQQKGSPAAG |
| Ga0181522_105399662 | 3300014657 | Bog | MLDHGDLTMRKRSLLFLSLLVPAFLGLGGYAVVQGQQKGSPAAGAKRWSDAA |
| Ga0182030_103682041 | 3300014838 | Bog | MRKHTLLILSLLVPAFSGLGGYGVLSAQQKTSAATAKRWSDPAT |
| Ga0157379_113608921 | 3300014968 | Switchgrass Rhizosphere | MRKHSPLFLSLLVPAFLVLGGYAALKAQQKASSTA |
| Ga0157376_104156352 | 3300014969 | Miscanthus Rhizosphere | MQKRSFLLLSLLVPAFLGLGGYSVVQAQQKASPAASAK |
| Ga0137403_108937721 | 3300015264 | Vadose Zone Soil | MIDHGDLTMRKRSLLFLSLLVPAFLGLSGHAVLKAQQKTS |
| Ga0187802_101220492 | 3300017822 | Freshwater Sediment | MIDHGDLSMRKRSLLFLSLLVPAFLGLGGYAVLKAQQ |
| Ga0187847_106620081 | 3300017948 | Peatland | MIVHGGLTMRKHTHLLLSLLVPAFLVLGGYAALKAQQKTSSTTSG |
| Ga0187847_108975281 | 3300017948 | Peatland | MRKHTLLILSLVVPAFLGLGGHAVLKAQQKTSAGGARRWSDPAT |
| Ga0187817_102741223 | 3300017955 | Freshwater Sediment | MRKHSLLFLSLLVPAFLGLGGFALVQGQQKGSPAAGARRWSDAAT |
| Ga0187776_115017391 | 3300017966 | Tropical Peatland | MIDHGDLTMRKRSLLLLSLLVPAFLVLGGYAALKAQQKTSSTAKR |
| Ga0187781_100175161 | 3300017972 | Tropical Peatland | MRKRSLLSLSLLVPAFFVLGGDAVLKAQQKTSTPSGK |
| Ga0187805_100899693 | 3300018007 | Freshwater Sediment | MRKRSLLFLSLLVPAFLGLGGYAVLQAQQKTSTGS |
| Ga0187884_103268901 | 3300018009 | Peatland | MIDHGDLTMRKRSLLFLPLLVPAFLGLGGYAVLKAQ |
| Ga0187873_12130883 | 3300018013 | Peatland | MIDHGDLTMRKRSLLFLSLLVPAFLGLGGYAALKAQQKTSSTASAKRWS |
| Ga0187874_100555532 | 3300018019 | Peatland | MRKHSLLLLSLLVPAFLGLGGYAVLKAQQQTTTKARGKLWSDAAT |
| Ga0187861_103785731 | 3300018020 | Peatland | MRKRSLLFLSLLVPAFLGLGGYAVLKAQQKTSTASAKRWSDPAT |
| Ga0187887_104639012 | 3300018043 | Peatland | MIVHGGLTMRKHTHLILSLLVPAFLVLGGYAALKAQQKTSSTTSG |
| Ga0187769_103791671 | 3300018086 | Tropical Peatland | MRKHSLLFLTLLAPAFLVLGGYAVVKAQQRTSATASGKRWSE |
| Ga0190272_113701852 | 3300018429 | Soil | MRKPYHFFLCLLVPAFLGLGGYALVQGQQKGSPAAGA |
| Ga0190271_125270562 | 3300018481 | Soil | MIDHGGYTMRKHSLFVLSLLVPAFLGLGGYAVVTAQQ |
| Ga0210403_113061412 | 3300020580 | Soil | MRKRSLLFLSLLVPAFLVLGGHAVLKAQQNTSTASA |
| Ga0210395_107585711 | 3300020582 | Soil | MQKRSLLLLSLLVPAFLGLGGYAVVQGQQKGSPAAGAKRWSDAAT |
| Ga0210401_115965631 | 3300020583 | Soil | MRKHYHLFLSFLVPAFLVLGGYTVVKAQQKASTPAS |
| Ga0210400_108632951 | 3300021170 | Soil | MQKRSLLPLSLLVPAFLGLGGYAVVQGQQKGSPAAGAKRWSDAA |
| Ga0210388_101301192 | 3300021181 | Soil | MIDHGELTMRKRSLLFLSLLVPAFLVLGGYAVVQAQQK |
| Ga0210393_103777523 | 3300021401 | Soil | MRKRSLLFLSLLVSAFLVLGGYAVVQAQQKTSTPSGKRWSDASTWP |
| Ga0210397_109743762 | 3300021403 | Soil | MRKHSLLFLSLLVPAFLVLGGYAALKAQQKTSSTASAKRWSDAAT |
| Ga0210386_117318671 | 3300021406 | Soil | MIVRGGLTMRKHTHLILSLLVPAFLVLGGYAALKAQQKTSSTTS |
| Ga0210394_108521032 | 3300021420 | Soil | MQKRSLLFLSLLVPGFLGLGGYAVVQGQQKGSPAAGAKRW |
| Ga0210391_104000431 | 3300021433 | Soil | MRKNTHLFISLLVPAFLILGGYGVVQAQQKTSSTASAKRWSEASTW |
| Ga0210391_113448761 | 3300021433 | Soil | MRKRSLLFLSLLVPAFFVLGGYAVVQAQQNTSTASAKRWSDA |
| Ga0210390_103846042 | 3300021474 | Soil | MVDHGDLTMRKRSLLFLSLLVPAFLGLGGYAVLQAQQNTSTASAQRWSNA |
| Ga0210409_106548322 | 3300021559 | Soil | MRKRSLLFLSLLVPAFLILGGYAALKAQQKTSSTASAKR |
| Ga0126371_124240232 | 3300021560 | Tropical Forest Soil | MRKRSLLFLSLLVPAFLGLGGYAALKAQQKTSTASAKRWSDPATWPD |
| Ga0242647_10086531 | 3300022505 | Soil | MIDHGDLTMRKRSLLFLSLLVPAFLGLGGYAVLKA |
| Ga0207699_103375752 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MIDHGDLTMRKRSLLFLSLLVPAFLVLGGYTVVKAQQKASSTAS |
| Ga0207671_107697461 | 3300025914 | Corn Rhizosphere | MRKRSLLFLSLLVPALLGLGGYAALKAQQKASSTPSAE |
| Ga0207649_103606731 | 3300025920 | Corn Rhizosphere | MRKRSLLFLSLLVPAFLGLGGYTVVKAQQKASTPASGKRWSDAATW |
| Ga0207652_103784861 | 3300025921 | Corn Rhizosphere | MRKRSFLFLSLLVPAFLVLGGYAVVKAQQKTSSTASAKRWSDASTW |
| Ga0207686_1000277811 | 3300025934 | Miscanthus Rhizosphere | MRKYTLLLLSLLVPAFLGLGGYAVLKAQQKPFSAVN |
| Ga0207686_113678121 | 3300025934 | Miscanthus Rhizosphere | MRKRSLLFLSLLVPAFLVLGGYAVVKAQQKASTPASAK |
| Ga0207661_112011801 | 3300025944 | Corn Rhizosphere | MRKRSLLFLSSLIPAFLVLGGYTAVNAQKRAAKRW |
| Ga0207712_109591922 | 3300025961 | Switchgrass Rhizosphere | MQKRSLLLLSLLVPAFLGLGGYAVVQGQQKGSPAAGAKRWSDASTWP |
| Ga0207703_116991952 | 3300026035 | Switchgrass Rhizosphere | MRKRSLLFLGLLVPAFLVLSGDAVKAQQKASSTASGKRWSD |
| Ga0207702_104835191 | 3300026078 | Corn Rhizosphere | MRKRSLLFLSLLVPAFLGLGGYTVVKAQQKASTPASG |
| Ga0207702_113242352 | 3300026078 | Corn Rhizosphere | MIDHGNLTMRKRSLLFLSLLVAAFLGLGGYAVLKAQQKTSTA |
| Ga0207702_117672782 | 3300026078 | Corn Rhizosphere | MRKRSLLFLSLLVPAFLGLGGYAALEAQQKASLTGSAKRWSDASTW |
| Ga0207702_122107341 | 3300026078 | Corn Rhizosphere | MIDHGDLTMRKRSLLFLSLLVPAFLVLGGYAALKAQQKASSTPS |
| Ga0207676_112334092 | 3300026095 | Switchgrass Rhizosphere | MRKRSLLLLSLLVPAFLGLGGYAALKAQQKASSTASGKRWS |
| Ga0209468_11826852 | 3300026306 | Soil | MRKRSLLFLSLLVPAFLVLGGYAVVKAQQKASTPASAKRWSDAATW |
| Ga0208565_11185801 | 3300027662 | Peatlands Soil | MIDHGDLTMRKRSLLFLSLLVPAFLVLGGYAVLKAQQKTTPASAK |
| Ga0209274_104154142 | 3300027853 | Soil | MIDHGDLTMRKRSLLFLSLLVPAFLGLGGYAVVQAQQKTSTANAKR |
| Ga0209169_100607382 | 3300027879 | Soil | MRKRSLLFLSLLVPAFLGLGGYAALKAQQKASPDAGGK |
| Ga0209624_100292141 | 3300027895 | Forest Soil | MIDHGDLTMRKRSRLFLSLLVPAFLGLSGYGVLKAQQKTSSTASAKRWSDAS |
| Ga0209624_108732492 | 3300027895 | Forest Soil | MDELTMRKHTHLILSLLVPAFFVLGGYAVVQAQQKTSST |
| Ga0265344_1034341 | 3300028011 | Plant Litter | MRKRSTLFLSLLVPAFLGLGGYAVLKAQQKTSTASATRWSDAATWPD |
| Ga0268264_119718502 | 3300028381 | Switchgrass Rhizosphere | MRKRSLLFLSLLVPAFLVLGGYAALKAQQKASTPAS |
| Ga0302303_103256001 | 3300028776 | Palsa | MRKHTHMILSLLVPAFLGLGGYASLKAQQKASTPA |
| Ga0308309_112929322 | 3300028906 | Soil | MIDHGDLTMRKRSLLFLSLLVPAFLGLGGYAVVQAQQKT |
| Ga0311340_101241911 | 3300029943 | Palsa | MRKHTHMILSLLVPAFLGLGGYASLKAQQKASTPATAKRWSDAATWP |
| Ga0311340_107307723 | 3300029943 | Palsa | MIDHGDLTMRKRSLLFLSLLVPVFLVLGGYAVVQAQQKTSSTASAKRWSDAST |
| Ga0311338_102638301 | 3300030007 | Palsa | MIGHGDLTMRKRSLLFLSLLVPAFLVLGGDAVVQAQ |
| Ga0311357_111477891 | 3300030524 | Palsa | MIDHGDLTMRKRSLLFLSLLVPAFLVLGGDAVVQAQQKTS |
| Ga0302310_104963041 | 3300030737 | Palsa | MIDHGGLTMRKRSLLFLSLLVPAFLVLGGYAVLKAQQKTSTASAKRWSDP |
| Ga0265746_10690181 | 3300030815 | Soil | MRKRSLLFLSLLVPAFLGLGGYAVLKAEQKTSTASAKRWSDPAA |
| Ga0265770_11146642 | 3300030878 | Soil | MVDHGDLTMRKRSLLFLSLLVPAFLVLGGYALKAQQKTSSTAS |
| Ga0265721_10156611 | 3300030977 | Soil | MIVHGGLTMRKHTHLILSLLVPAFLVLGGYASLKAQQKTS |
| Ga0265754_10301531 | 3300031040 | Soil | MIVHGGLTMRKHPHLILSSLVPAFLVLGGYAALKAQQKASSTTTGKR |
| Ga0265332_104753242 | 3300031238 | Rhizosphere | MRKHSLLFLSLLVPAFLILGGYTVVKAQQKAAGAK |
| Ga0170820_102160981 | 3300031446 | Forest Soil | MRKPYPVFLSLLVPAFLVLGGYTVVKAQQKASTPASAKRWSDA |
| Ga0170818_1017741981 | 3300031474 | Forest Soil | MIDQGDLTMRKHHLLFLSSLLAAVLVLGGYGALKAQQKASSTAS |
| Ga0318541_107122051 | 3300031545 | Soil | MIDHGDLTMRKRSPLFLSLLVPALLGLGGYAVLKAQQKTSTASAKRWSD |
| Ga0310686_1009799791 | 3300031708 | Soil | MRKHTLLILSLLVPAFLGLGGHAVLKAQQKTSAASAKRWSDPATWP |
| Ga0310686_1028589455 | 3300031708 | Soil | MRKRSLLFLSLLVPAFLGLGGYAVLQAQQKTSTASAKRWSNP |
| Ga0310686_1064273525 | 3300031708 | Soil | MQKRSLLFLSLLVAAFLGLGGYAVVQGQQKGSPAAGAKRWS |
| Ga0310686_1150130631 | 3300031708 | Soil | MRKHTHFILSLLVPAFLVLGGYAALKAQQKTSSTTSGKRWS |
| Ga0307474_101055553 | 3300031718 | Hardwood Forest Soil | MRKRSLLFLSLLVPAFLGLGGYAVLQAQQNTSTASAKRWSNAA |
| Ga0307477_107069281 | 3300031753 | Hardwood Forest Soil | MIDHGDLTMRKRSLLFLSLLVPAFLGLGGYAVLKAQQKTSTAS |
| Ga0307477_108617351 | 3300031753 | Hardwood Forest Soil | LFLSLLVPAFLGLGGYAVLKAQQKTSTAKAKRWSDP |
| Ga0310917_109230331 | 3300031833 | Soil | MRKRSLLFLSLLVPAFLGLGGYAVVEAQQKTSSTA |
| Ga0318530_103081081 | 3300031959 | Soil | MRKRSLLFLSLLVPAFLGLGGDAVLKAQQKTSTAGAKRW |
| Ga0308176_109549041 | 3300031996 | Soil | MRRHTLLILSLMVPAFLGLGGGYAVLKAQQKTAAGAKRWSDAAT |
| Ga0311301_122325141 | 3300032160 | Peatlands Soil | MRKRSLLFLSLLVPAFLVLGGYAVVQAQQKTSSTA |
| Ga0335079_122539232 | 3300032783 | Soil | MRKRSLLFLSSLVPAFFVLGGYAVVKAQQKTSTPASAKR |
| Ga0335080_123737821 | 3300032828 | Soil | MRKRSLLFLSLLVPAFLVLSEYAVKAQEKPSSTARAKRWSDAST |
| Ga0335072_109442432 | 3300032898 | Soil | MIDHGDLTMRKRSLLFLSVLVPAFLGLGGHAVLKAQQNTSTA |
| Ga0335077_115889392 | 3300033158 | Soil | MRKHSPLFLSLLLPAFLVLGGYAVLKAQQRTSSTA |
| Ga0314862_0144808_2_133 | 3300033803 | Peatland | MRKHSLLFLPFLVSAFLVLGGYAALKAQQNASSTAGGKRWSDAA |
| ⦗Top⦘ |